F462913
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 234 | 1106 | 455 |
Family's Representative Sequence
| Representative Sequence | 3300048915|Ga0496112_0044365|Ga0496112_0044365_1129_2595 |
| Length | 488 |
| Sequence | VACLRRANRLDRALTKHVALIGFMGAGKTTLGEETARRLNWLLKDVDQVVEASQSRSIPELFAEGESVFRDVELRVVRGLLAHPRPSVIALGGGAVTTPEVRGLLHDHAVTVWIDEDVDTCWERVRGTDRPLAQDEAEFRRLFDERHPLYAAAADAVVRDADDIVLAAAGVRVGRGALRRLGELVPGDGQVALVSDPNVAGIYGMDAQLALGGRLAQVHELPLGEDAKTISALDRLWQDLRLDRSGTVVALGGGCTTDAAGFAAATYLRGIPWVPVPTSLVAQVDAAIGGKTGIDLPQGKNLVGSFHWPVRTIIDPALLETLPPAQRLEGMAEVVKTGLLAGEPLWELPDDELVRRCASFKAALCLRDPEDNAERKMLNLGHTFAHALEAAAGYEGLSHGRAVALGLLAALRLSGGRLSGRDIGQVEEILRPKPVKVDRERAWQAMQRDKKNVGGELRLVLIGEDGPEWDVAVPAEDVRRELDALIAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 40 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 91 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 98 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 99 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 100 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 102 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 103 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 108 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 111 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 112 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 113 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 118 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 119 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 122 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 123 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 124 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 125 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 126 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 127 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 128 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 129 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 130 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 131 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 132 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 135 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 136 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 185 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 186 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 187 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 188 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 189 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 192 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 193 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 194 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 195 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 196 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 232 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 234 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.18 |
| Nodule | 0 |
| Rhizoplane | 14.1 |
| Rhizosphere | 85.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496112_0044365 | 3300048915 | Bacteria | 4356 |
| 2 | Ga0070658_10147574 | 3300005327 | Bacteria | 1968 |
| 3 | Ga0070683_100002787 | 3300005329 | Bacteria | 13976 |
| 4 | Ga0070683_100092238 | 3300005329 | Bacteria | 2845 |
| 5 | Ga0070690_100103245 | 3300005330 | Bacteria | 1893 |
| 6 | Ga0070680_100026368 | 3300005336 | Bacteria | 4648 |
| 7 | Ga0070680_100097872 | 3300005336 | Bacteria | 2433 |
| 8 | Ga0070680_100243614 | 3300005336 | Bacteria | 1520 |
| 9 | Ga0070682_100019819 | 3300005337 | Bacteria | 3950 |
| 10 | Ga0070682_100042246 | 3300005337 | Bacteria | 2813 |
| 11 | Ga0068868_100038305 | 3300005338 | Bacteria | 3721 |
| 12 | Ga0070660_100008515 | 3300005339 | Bacteria | 7179 |
| 13 | Ga0070660_100022105 | 3300005339 | Bacteria | 4699 |
| 14 | Ga0070691_10027327 | 3300005341 | Bacteria | 2662 |
| 15 | Ga0070714_100021353 | 3300005435 | Bacteria | 5298 |
| 16 | Ga0070714_100130249 | 3300005435 | Bacteria | 2248 |
| 17 | Ga0070714_100163274 | 3300005435 | Bacteria | 2017 |
| 18 | Ga0070713_100045051 | 3300005436 | Bacteria | 3613 |
| 19 | Ga0070713_100055254 | 3300005436 | Bacteria | 3298 |
| 20 | Ga0070713_100190735 | 3300005436 | Bacteria | 1846 |
| 21 | Ga0070710_10001590 | 3300005437 | Bacteria | 10722 |
| 22 | Ga0070710_10020109 | 3300005437 | Bacteria | 3459 |
| 23 | Ga0070711_100005385 | 3300005439 | Bacteria | 7655 |
| 24 | Ga0070711_100009007 | 3300005439 | Bacteria | 6127 |
| 25 | Ga0070711_100163962 | 3300005439 | Bacteria | 1687 |
| 26 | Ga0070705_100055551 | 3300005440 | Bacteria | 2328 |
| 27 | Ga0070700_100013906 | 3300005441 | Bacteria | 4531 |
| 28 | Ga0070708_100020147 | 3300005445 | Bacteria | 5618 |
| 29 | Ga0070708_100025940 | 3300005445 | Bacteria | 5012 |
| 30 | Ga0070663_100018013 | 3300005455 | Bacteria | 4621 |
| 31 | Ga0070678_100027748 | 3300005456 | Bacteria | 3849 |
| 32 | Ga0070681_10046805 | 3300005458 | Bacteria | 4324 |
| 33 | Ga0070706_100002089 | 3300005467 | Bacteria | 20346 |
| 34 | Ga0070706_100054927 | 3300005467 | Bacteria | 3676 |
| 35 | Ga0070706_100169990 | 3300005467 | Bacteria | 2035 |
| 36 | Ga0070707_100000736 | 3300005468 | Bacteria | 32520 |
| 37 | Ga0070707_100001273 | 3300005468 | Bacteria | 24807 |
| 38 | Ga0070707_100018978 | 3300005468 | Bacteria | 6477 |
| 39 | Ga0070707_100225462 | 3300005468 | Bacteria | 1825 |
| 40 | Ga0070707_100296720 | 3300005468 | Bacteria | 1570 |
| 41 | Ga0070698_100010276 | 3300005471 | Bacteria | 9999 |
| 42 | Ga0070698_100016163 | 3300005471 | Bacteria | 7880 |
| 43 | Ga0070698_100024678 | 3300005471 | Bacteria | 6271 |
| 44 | Ga0070698_100088976 | 3300005471 | Bacteria | 3072 |
| 45 | Ga0070698_100162872 | 3300005471 | Bacteria | 2174 |
| 46 | Ga0070699_100028631 | 3300005518 | Bacteria | 4804 |
| 47 | Ga0070699_100085700 | 3300005518 | Bacteria | 2749 |
| 48 | Ga0070679_100086916 | 3300005530 | Bacteria | 3113 |
| 49 | Ga0070679_100098170 | 3300005530 | Bacteria | 2917 |
| 50 | Ga0070679_100161104 | 3300005530 | Bacteria | 2218 |
| 51 | Ga0070679_100293685 | 3300005530 | Bacteria | 1576 |
| 52 | Ga0070684_100021195 | 3300005535 | Bacteria | 5402 |
| 53 | Ga0070684_100047821 | 3300005535 | Bacteria | 3709 |
| 54 | Ga0070684_100151272 | 3300005535 | Bacteria | 2103 |
| 55 | Ga0070684_100179417 | 3300005535 | Bacteria | 1925 |
| 56 | Ga0070686_100041358 | 3300005544 | Bacteria | 2881 |
| 57 | Ga0070686_100048181 | 3300005544 | Bacteria | 2699 |
| 58 | Ga0070695_100000023 | 3300005545 | Bacteria | 60293 |
| 59 | Ga0070696_100097446 | 3300005546 | Bacteria | 2103 |
| 60 | Ga0068855_100039573 | 3300005563 | Bacteria | 5598 |
| 61 | Ga0068855_100076760 | 3300005563 | Bacteria | 3876 |
| 62 | Ga0068856_100004494 | 3300005614 | Bacteria | 13869 |
| 63 | Ga0070702_100018393 | 3300005615 | Bacteria | 3626 |
| 64 | Ga0068864_100058340 | 3300005618 | Bacteria | 3335 |
| 65 | Ga0068861_100049503 | 3300005719 | Bacteria | 3182 |
| 66 | Ga0081455_10027516 | 3300005937 | Bacteria | 5211 |
| 67 | Ga0081538_10014854 | 3300005981 | Bacteria | 6068 |
| 68 | Ga0081540_1001884 | 3300005983 | Bacteria | 17556 |
| 69 | Ga0081539_10002903 | 3300005985 | Bacteria | 22670 |
| 70 | Ga0070717_10003907 | 3300006028 | Bacteria | 10721 |
| 71 | Ga0070717_10018851 | 3300006028 | Bacteria | 5397 |
| 72 | Ga0070717_10022558 | 3300006028 | Bacteria | 4975 |
| 73 | Ga0070717_10030392 | 3300006028 | Bacteria | 4340 |
| 74 | Ga0070717_10040702 | 3300006028 | Bacteria | 3786 |
| 75 | Ga0075432_10010379 | 3300006058 | Bacteria | 3159 |
| 76 | Ga0070715_10007105 | 3300006163 | Bacteria | 3840 |
| 77 | Ga0070712_100052940 | 3300006175 | Bacteria | 2833 |
| 78 | Ga0075428_100200927 | 3300006844 | Bacteria | 2155 |
| 79 | Ga0075433_10007908 | 3300006852 | Bacteria | 8457 |
| 80 | Ga0075433_10020701 | 3300006852 | Bacteria | 5506 |
| 81 | Ga0075433_10074172 | 3300006852 | Bacteria | 2994 |
| 82 | Ga0075434_100013194 | 3300006871 | Bacteria | 7851 |
| 83 | Ga0075434_100035968 | 3300006871 | Bacteria | 4897 |
| 84 | Ga0075429_100052446 | 3300006880 | Bacteria | 3549 |
| 85 | Ga0075436_100002736 | 3300006914 | Bacteria | 12126 |
| 86 | Ga0075436_100041892 | 3300006914 | Bacteria | 3158 |
| 87 | Ga0075436_100044442 | 3300006914 | Bacteria | 3063 |
| 88 | Ga0075435_100000579 | 3300007076 | Bacteria | 22387 |
| 89 | Ga0075435_100001676 | 3300007076 | Bacteria | 14382 |
| 90 | Ga0075435_100036783 | 3300007076 | Bacteria | 3893 |
| 91 | Ga0111539_10001928 | 3300009094 | Bacteria | 27646 |
| 92 | Ga0111539_10219406 | 3300009094 | Bacteria | 2215 |
| 93 | Ga0111539_10356086 | 3300009094 | Bacteria | 1703 |
| 94 | Ga0105245_10005774 | 3300009098 | Bacteria | 10857 |
| 95 | Ga0105245_10014739 | 3300009098 | Bacteria | 6808 |
| 96 | Ga0105245_10085538 | 3300009098 | Bacteria | 2890 |
| 97 | Ga0105245_10110840 | 3300009098 | Bacteria | 2552 |
| 98 | Ga0105245_10159705 | 3300009098 | Bacteria | 2138 |
| 99 | Ga0114129_10002630 | 3300009147 | Bacteria | 24990 |
| 100 | Ga0114129_10044266 | 3300009147 | Bacteria | 6262 |
| 101 | Ga0114129_10171551 | 3300009147 | Bacteria | 2957 |
| 102 | Ga0114129_10179373 | 3300009147 | Bacteria | 2883 |
| 103 | Ga0105242_10038235 | 3300009176 | Bacteria | 3859 |
| 104 | Ga0105242_10087126 | 3300009176 | Bacteria | 2622 |
| 105 | Ga0105237_10101443 | 3300009545 | Bacteria | 2870 |
| 106 | Ga0157370_10005484 | 3300013104 | Bacteria | 14227 |
| 107 | Ga0157370_10010689 | 3300013104 | Bacteria | 9656 |
| 108 | Ga0157369_10008456 | 3300013105 | Bacteria | 11805 |
| 109 | Ga0157369_10038348 | 3300013105 | Bacteria | 5240 |
| 110 | Ga0157375_10003176 | 3300013308 | Bacteria | 14277 |
| 111 | Ga0182008_10002973 | 3300014497 | Bacteria | 10433 |
| 112 | Ga0157379_10071265 | 3300014968 | Bacteria | 3109 |
| 113 | Ga0157376_10017745 | 3300014969 | Bacteria | 5438 |
| 114 | Ga0182006_1043204 | 3300015261 | Bacteria | 1762 |
| 115 | Ga0206354_10286303 | 3300020081 | Bacteria | 3867 |
| 116 | Ga0206353_11257401 | 3300020082 | Bacteria | 17170 |
| 117 | Ga0207653_10007342 | 3300025885 | Bacteria | 3435 |
| 118 | Ga0207692_10018241 | 3300025898 | Bacteria | 3146 |
| 119 | Ga0207699_10059306 | 3300025906 | Bacteria | 2293 |
| 120 | Ga0207684_10004837 | 3300025910 | Bacteria | 12604 |
| 121 | Ga0207684_10102878 | 3300025910 | Bacteria | 2442 |
| 122 | Ga0207707_10100991 | 3300025912 | Bacteria | 2521 |
| 123 | Ga0207707_10195325 | 3300025912 | Bacteria | 1765 |
| 124 | Ga0207671_10068278 | 3300025914 | Bacteria | 2648 |
| 125 | Ga0207693_10000198 | 3300025915 | Bacteria | 54576 |
| 126 | Ga0207693_10007712 | 3300025915 | Bacteria | 8836 |
| 127 | Ga0207693_10008363 | 3300025915 | Bacteria | 8468 |
| 128 | Ga0207693_10009671 | 3300025915 | Bacteria | 7850 |
| 129 | Ga0207693_10059093 | 3300025915 | Bacteria | 3003 |
| 130 | Ga0207660_10041793 | 3300025917 | Bacteria | 3214 |
| 131 | Ga0207657_10016396 | 3300025919 | Bacteria | 7147 |
| 132 | Ga0207657_10024716 | 3300025919 | Bacteria | 5555 |
| 133 | Ga0207652_10223975 | 3300025921 | Bacteria | 1695 |
| 134 | Ga0207646_10002219 | 3300025922 | Bacteria | 23119 |
| 135 | Ga0207646_10004655 | 3300025922 | Bacteria | 14797 |
| 136 | Ga0207681_10126008 | 3300025923 | Bacteria | 1886 |
| 137 | Ga0207687_10139227 | 3300025927 | Bacteria | 1839 |
| 138 | Ga0207700_10038025 | 3300025928 | Bacteria | 3490 |
| 139 | Ga0207700_10162115 | 3300025928 | Bacteria | 1858 |
| 140 | Ga0207664_10005271 | 3300025929 | Bacteria | 8832 |
| 141 | Ga0207664_10032010 | 3300025929 | Bacteria | 4028 |
| 142 | Ga0207664_10037991 | 3300025929 | Bacteria | 3730 |
| 143 | Ga0207706_10011285 | 3300025933 | Bacteria | 8142 |
| 144 | Ga0207706_10178576 | 3300025933 | Bacteria | 1865 |
| 145 | Ga0207665_10000197 | 3300025939 | Bacteria | 40246 |
| 146 | Ga0207665_10005170 | 3300025939 | Bacteria | 8713 |
| 147 | Ga0207691_10181656 | 3300025940 | Bacteria | 1838 |
| 148 | Ga0207711_10135444 | 3300025941 | Unclassified | 2212 |
| 149 | Ga0207661_10016534 | 3300025944 | Bacteria | 5445 |
| 150 | Ga0207661_10017872 | 3300025944 | Bacteria | 5258 |
| 151 | Ga0207661_10125382 | 3300025944 | Bacteria | 2192 |
| 152 | Ga0207668_10029028 | 3300025972 | Bacteria | 3623 |
| 153 | Ga0207678_10027462 | 3300026067 | Bacteria | 4965 |
| 154 | Ga0207678_10220475 | 3300026067 | Bacteria | 1623 |
| 155 | Ga0207708_10009298 | 3300026075 | Bacteria | 7276 |
| 156 | Ga0207702_10006207 | 3300026078 | Bacteria | 10334 |
| 157 | Ga0207648_10002132 | 3300026089 | Bacteria | 21520 |
| 158 | Ga0207675_100004186 | 3300026118 | Bacteria | 13960 |
| 159 | Ga0207675_100181309 | 3300026118 | Bacteria | 2016 |
| 160 | Ga0207683_10029845 | 3300026121 | Bacteria | 4722 |
| 161 | Ga0207683_10098762 | 3300026121 | Bacteria | 2605 |
| 162 | Ga0207698_10150922 | 3300026142 | Bacteria | 2017 |
| 163 | Ga0207428_10013176 | 3300027907 | Bacteria | 7239 |
| 164 | Ga0265319_1001059 | 3300028563 | Bacteria | 17170 |
| 165 | Ga0265334_10007596 | 3300028573 | Bacteria | 4645 |
| 166 | Ga0265318_10001637 | 3300028577 | Bacteria | 12919 |
| 167 | Ga0265318_10003407 | 3300028577 | Bacteria | 7986 |
| 168 | Ga0265338_10004619 | 3300028800 | Bacteria | 18512 |
| 169 | Ga0265338_10005076 | 3300028800 | Bacteria | 17375 |
| 170 | Ga0265338_10125573 | 3300028800 | Bacteria | 2036 |
| 171 | Ga0265330_10016974 | 3300031235 | Bacteria | 3356 |
| 172 | Ga0265330_10047333 | 3300031235 | Bacteria | 1893 |
| 173 | Ga0265328_10010907 | 3300031239 | Bacteria | 3647 |
| 174 | Ga0265320_10017712 | 3300031240 | Bacteria | 3947 |
| 175 | Ga0265320_10040777 | 3300031240 | Bacteria | 2312 |
| 176 | Ga0265325_10018259 | 3300031241 | Bacteria | 3889 |
| 177 | Ga0265325_10028698 | 3300031241 | Bacteria | 2996 |
| 178 | Ga0265340_10059216 | 3300031247 | Bacteria | 1838 |
| 179 | Ga0265339_10004983 | 3300031249 | Bacteria | 8940 |
| 180 | Ga0265331_10023049 | 3300031250 | Bacteria | 3168 |
| 181 | Ga0265327_10023772 | 3300031251 | Bacteria | 3618 |
| 182 | Ga0265327_10025765 | 3300031251 | Bacteria | 3421 |
| 183 | Ga0265316_10025321 | 3300031344 | Bacteria | 4953 |
| 184 | Ga0265316_10053801 | 3300031344 | Bacteria | 3153 |
| 185 | Ga0265313_10016189 | 3300031595 | Bacteria | 4298 |
| 186 | Ga0265314_10005893 | 3300031711 | Bacteria | 10961 |
| 187 | Ga0265342_10025222 | 3300031712 | Bacteria | 3741 |
| 188 | Ga0265342_10038371 | 3300031712 | Bacteria | 2917 |
| 189 | Ga0373926_0018619 | 3300035083 | Bacteria | 2390 |
| 190 | Ga0373936_0043462 | 3300035113 | Bacteria | 1806 |
| 191 | Ga0373941_0015705 | 3300035115 | Bacteria | 2047 |
| 192 | Ga0373960_0016274 | 3300035121 | Bacteria | 1911 |
| 193 | Ga0373943_0003173 | 3300035170 | Bacteria | 7463 |
| 194 | Ga0373943_0013462 | 3300035170 | Bacteria | 3695 |
| 195 | Ga0373943_0031502 | 3300035170 | Bacteria | 2516 |
| 196 | Ga0373927_0028600 | 3300035695 | Bacteria | 3636 |
| 197 | Ga0373947_0001279 | 3300035725 | Bacteria | 15509 |
| 198 | Ga0373947_0010190 | 3300035725 | Bacteria | 5396 |
| 199 | Ga0373947_0038701 | 3300035725 | Bacteria | 2835 |
| 200 | Ga0373937_0060417 | 3300036401 | Bacteria | 3483 |
| 201 | Ga0373925_0001456 | 3300037068 | Bacteria | 20442 |
| 202 | Ga0395899_0004144 | 3300037312 | Bacteria | 11391 |
| 203 | Ga0395899_0007114 | 3300037312 | Bacteria | 8657 |
| 204 | Ga0395899_0028568 | 3300037312 | Bacteria | 4198 |
| 205 | Ga0395899_0030874 | 3300037312 | Bacteria | 4028 |
| 206 | Ga0395899_0044205 | 3300037312 | Bacteria | 3320 |
| 207 | Ga0395899_0079820 | 3300037312 | Bacteria | 2383 |
| 208 | Ga0395899_0149461 | 3300037312 | Bacteria | 1656 |
| 209 | Ga0395900_0005056 | 3300037418 | Bacteria | 13836 |
| 210 | Ga0395900_0008595 | 3300037418 | Bacteria | 10492 |
| 211 | Ga0395900_0016527 | 3300037418 | Bacteria | 7527 |
| 212 | Ga0395900_0024289 | 3300037418 | Bacteria | 6206 |
| 213 | Ga0395900_0030925 | 3300037418 | Bacteria | 5498 |
| 214 | Ga0395900_0043110 | 3300037418 | Bacteria | 4649 |
| 215 | Ga0395900_0050166 | 3300037418 | Bacteria | 4299 |
| 216 | Ga0395900_0054382 | 3300037418 | Bacteria | 4122 |
| 217 | Ga0395900_0073531 | 3300037418 | Bacteria | 3515 |
| 218 | Ga0395900_0126617 | 3300037418 | Bacteria | 2620 |
| 219 | Ga0395900_0266910 | 3300037418 | Bacteria | 1707 |
| 220 | Ga0395898_0006932 | 3300037466 | Bacteria | 12043 |
| 221 | Ga0395898_0008878 | 3300037466 | Bacteria | 10587 |
| 222 | Ga0395898_0010279 | 3300037466 | Bacteria | 9794 |
| 223 | Ga0395898_0015998 | 3300037466 | Bacteria | 7684 |
| 224 | Ga0395898_0019348 | 3300037466 | Bacteria | 6931 |
| 225 | Ga0395898_0031845 | 3300037466 | Bacteria | 5267 |
| 226 | Ga0395898_0041537 | 3300037466 | Bacteria | 4542 |
| 227 | Ga0395898_0047572 | 3300037466 | Bacteria | 4209 |
| 228 | Ga0395898_0177134 | 3300037466 | Bacteria | 2038 |
| 229 | Ga0395898_0303662 | 3300037466 | Bacteria | 1522 |
| 230 | Ga0395898_0351975 | 3300037466 | Bacteria | 1404 |
| 231 | Ga0395905_0002930 | 3300037471 | Bacteria | 18574 |
| 232 | Ga0395905_0006934 | 3300037471 | Bacteria | 11329 |
| 233 | Ga0395905_0007022 | 3300037471 | Bacteria | 11255 |
| 234 | Ga0395905_0011779 | 3300037471 | Bacteria | 8443 |
| 235 | Ga0395905_0012413 | 3300037471 | Bacteria | 8200 |
| 236 | Ga0395905_0022282 | 3300037471 | Bacteria | 5993 |
| 237 | Ga0395905_0035578 | 3300037471 | Bacteria | 4677 |
| 238 | Ga0395905_0069044 | 3300037471 | Bacteria | 3310 |
| 239 | Ga0395901_0004146 | 3300038443 | Bacteria | 14623 |
| 240 | Ga0395901_0009150 | 3300038443 | Bacteria | 10032 |
| 241 | Ga0395901_0020678 | 3300038443 | Bacteria | 6737 |
| 242 | Ga0395901_0026455 | 3300038443 | Bacteria | 5956 |
| 243 | Ga0395901_0033046 | 3300038443 | Bacteria | 5338 |
| 244 | Ga0395901_0034280 | 3300038443 | Bacteria | 5242 |
| 245 | Ga0395901_0067732 | 3300038443 | Bacteria | 3718 |
| 246 | Ga0395901_0075445 | 3300038443 | Bacteria | 3517 |
| 247 | Ga0395901_0150034 | 3300038443 | Bacteria | 2450 |
| 248 | Ga0395901_0175745 | 3300038443 | Bacteria | 2246 |
| 249 | Ga0436360_1320551 | 3300039438 | Bacteria | 1929 |
| 250 | Ga0439433_0003796 | 3300041999 | Bacteria | 3248 |
| 251 | Ga0439441_003139 | 3300042001 | Bacteria | 2403 |
| 252 | Ga0439446_0004144 | 3300042156 | Bacteria | 3655 |
| 253 | Ga0466969_0001820 | 3300044656 | Bacteria | 11388 |
| 254 | Ga0466961_0021458 | 3300044693 | Bacteria | 4156 |
| 255 | Ga0466961_0059646 | 3300044693 | Bacteria | 2426 |
| 256 | Ga0466961_0117836 | 3300044693 | Bacteria | 1668 |
| 257 | Ga0466963_0000518 | 3300044694 | Bacteria | 18034 |
| 258 | Ga0466963_0003462 | 3300044694 | Bacteria | 9043 |
| 259 | Ga0466963_0009739 | 3300044694 | Bacteria | 5797 |
| 260 | Ga0466963_0011497 | 3300044694 | Bacteria | 5391 |
| 261 | Ga0466963_0012038 | 3300044694 | Bacteria | 5284 |
| 262 | Ga0466963_0015702 | 3300044694 | Bacteria | 4696 |
| 263 | Ga0466963_0016045 | 3300044694 | Bacteria | 4651 |
| 264 | Ga0466963_0018541 | 3300044694 | Bacteria | 4353 |
| 265 | Ga0466963_0052155 | 3300044694 | Bacteria | 2713 |
| 266 | Ga0466963_0053911 | 3300044694 | Bacteria | 2671 |
| 267 | Ga0466963_0059039 | 3300044694 | Bacteria | 2559 |
| 268 | Ga0466963_0065364 | 3300044694 | Bacteria | 2438 |
| 269 | Ga0466963_0163594 | 3300044694 | Bacteria | 1549 |
| 270 | Ga0466964_0001008 | 3300044706 | Bacteria | 9347 |
| 271 | Ga0466964_0003578 | 3300044706 | Bacteria | 5676 |
| 272 | Ga0466964_0012047 | 3300044706 | Bacteria | 3271 |
| 273 | Ga0466964_0044427 | 3300044706 | Bacteria | 1805 |
| 274 | Ga0466971_0011727 | 3300044719 | Bacteria | 3839 |
| 275 | Ga0466971_0047373 | 3300044719 | Bacteria | 1932 |
| 276 | Ga0466968_0000984 | 3300044735 | Bacteria | 10030 |
| 277 | Ga0466968_0003485 | 3300044735 | Bacteria | 5819 |
| 278 | Ga0466968_0008612 | 3300044735 | Bacteria | 3910 |
| 279 | Ga0466968_0036833 | 3300044735 | Bacteria | 2050 |
| 280 | Ga0466968_0066912 | 3300044735 | Bacteria | 1557 |
| 281 | Ga0466957_0005617 | 3300044842 | Bacteria | 7050 |
| 282 | Ga0466957_0018705 | 3300044842 | Bacteria | 4070 |
| 283 | Ga0466957_0023144 | 3300044842 | Bacteria | 3670 |
| 284 | Ga0466957_0031556 | 3300044842 | Bacteria | 3167 |
| 285 | Ga0466957_0102279 | 3300044842 | Bacteria | 1807 |
| 286 | Ga0466959_0013448 | 3300045049 | Bacteria | 5931 |
| 287 | Ga0466959_0031281 | 3300045049 | Bacteria | 3938 |
| 288 | Ga0451576_0163520 | 3300045051 | Bacteria | 2323 |
| 289 | Ga0466958_0001119 | 3300045836 | Bacteria | 12370 |
| 290 | Ga0466958_0010910 | 3300045836 | Bacteria | 5103 |
| 291 | Ga0466958_0011491 | 3300045836 | Bacteria | 4986 |
| 292 | Ga0466958_0013018 | 3300045836 | Bacteria | 4726 |
| 293 | Ga0466958_0023697 | 3300045836 | Bacteria | 3606 |
| 294 | Ga0466958_0035521 | 3300045836 | Bacteria | 2978 |
| 295 | Ga0466958_0075408 | 3300045836 | Bacteria | 2069 |
| 296 | Ga0466967_0000215 | 3300045976 | Bacteria | 24572 |
| 297 | Ga0466967_0002633 | 3300045976 | Bacteria | 11303 |
| 298 | Ga0466967_0004694 | 3300045976 | Bacteria | 9282 |
| 299 | Ga0466967_0008665 | 3300045976 | Bacteria | 7481 |
| 300 | Ga0466967_0010632 | 3300045976 | Bacteria | 6915 |
| 301 | Ga0466967_0011472 | 3300045976 | Bacteria | 6715 |
| 302 | Ga0466967_0012538 | 3300045976 | Bacteria | 6490 |
| 303 | Ga0466967_0021924 | 3300045976 | Bacteria | 5199 |
| 304 | Ga0466967_0044730 | 3300045976 | Bacteria | 3842 |
| 305 | Ga0466967_0052580 | 3300045976 | Bacteria | 3576 |
| 306 | Ga0466967_0056012 | 3300045976 | Bacteria | 3475 |
| 307 | Ga0466967_0114388 | 3300045976 | Bacteria | 2484 |
| 308 | Ga0466967_0117806 | 3300045976 | Bacteria | 2449 |
| 309 | Ga0466967_0129048 | 3300045976 | Bacteria | 2345 |
| 310 | Ga0466967_0148982 | 3300045976 | Bacteria | 2185 |
| 311 | Ga0466967_0168275 | 3300045976 | Bacteria | 2060 |
| 312 | Ga0495592_0000597 | 3300046454 | Bacteria | 25448 |
| 313 | Ga0495592_0003845 | 3300046454 | Bacteria | 10858 |
| 314 | Ga0495592_0086273 | 3300046454 | Bacteria | 2261 |
| 315 | Ga0495603_0000450 | 3300046455 | Bacteria | 22609 |
| 316 | Ga0495629_0001473 | 3300046459 | Bacteria | 18571 |
| 317 | Ga0495629_0007112 | 3300046459 | Bacteria | 8244 |
| 318 | Ga0495629_0034375 | 3300046459 | Bacteria | 3584 |
| 319 | Ga0495641_0001513 | 3300046461 | Bacteria | 19794 |
| 320 | Ga0495641_0013562 | 3300046461 | Bacteria | 4466 |
| 321 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 322 | Ga0495651_0086787 | 3300046462 | Bacteria | 2353 |
| 323 | Ga0495653_0000725 | 3300046463 | Bacteria | 25130 |
| 324 | Ga0495653_0032755 | 3300046463 | Bacteria | 4124 |
| 325 | Ga0495653_0052434 | 3300046463 | Bacteria | 3126 |
| 326 | Ga0495653_0061380 | 3300046463 | Bacteria | 2845 |
| 327 | Ga0495580_0006863 | 3300046472 | Bacteria | 9209 |
| 328 | Ga0495580_0040667 | 3300046472 | Bacteria | 3320 |
| 329 | Ga0495582_0000711 | 3300046473 | Bacteria | 18383 |
| 330 | Ga0495582_0008066 | 3300046473 | Bacteria | 5812 |
| 331 | Ga0495582_0052075 | 3300046473 | Bacteria | 2258 |
| 332 | Ga0495639_0000520 | 3300046475 | Bacteria | 18060 |
| 333 | Ga0495639_0024573 | 3300046475 | Bacteria | 2653 |
| 334 | Ga0495664_0016797 | 3300046477 | Bacteria | 4176 |
| 335 | Ga0495664_0053361 | 3300046477 | Bacteria | 2404 |
| 336 | Ga0495664_0074459 | 3300046477 | Bacteria | 2031 |
| 337 | Ga0495594_0001436 | 3300046499 | Bacteria | 12355 |
| 338 | Ga0495594_0056014 | 3300046499 | Bacteria | 2175 |
| 339 | Ga0495607_0023628 | 3300046501 | Bacteria | 3845 |
| 340 | Ga0495608_0000957 | 3300046511 | Bacteria | 20357 |
| 341 | Ga0495608_0074310 | 3300046511 | Bacteria | 2215 |
| 342 | Ga0495608_0127465 | 3300046511 | Bacteria | 1630 |
| 343 | Ga0495618_0002854 | 3300046514 | Bacteria | 10943 |
| 344 | Ga0495618_0019968 | 3300046514 | Bacteria | 4123 |
| 345 | Ga0495628_0000105 | 3300046516 | Bacteria | 68159 |
| 346 | Ga0495628_0177868 | 3300046516 | Bacteria | 1611 |
| 347 | Ga0495630_0001692 | 3300046517 | Bacteria | 15385 |
| 348 | Ga0495630_0010267 | 3300046517 | Bacteria | 6756 |
| 349 | Ga0495630_0068616 | 3300046517 | Bacteria | 2667 |
| 350 | Ga0495666_0000272 | 3300046526 | Bacteria | 22361 |
| 351 | Ga0495666_0011671 | 3300046526 | Bacteria | 4380 |
| 352 | Ga0495652_0001221 | 3300046529 | Bacteria | 28813 |
| 353 | Ga0495652_0008764 | 3300046529 | Bacteria | 9205 |
| 354 | Ga0495652_0032894 | 3300046529 | Bacteria | 4532 |
| 355 | Ga0495652_0185802 | 3300046529 | Bacteria | 1590 |
| 356 | Ga0495665_0001436 | 3300046531 | Bacteria | 12777 |
| 357 | Ga0495665_0039270 | 3300046531 | Bacteria | 2522 |
| 358 | Ga0495640_0026292 | 3300046533 | Bacteria | 4207 |
| 359 | Ga0495640_0158659 | 3300046533 | Bacteria | 1451 |
| 360 | Ga0495586_0031982 | 3300046535 | Bacteria | 2820 |
| 361 | Ga0495587_0000048 | 3300046536 | Bacteria | 105358 |
| 362 | Ga0495645_0000029 | 3300046543 | Bacteria | 113119 |
| 363 | Ga0495667_0044697 | 3300046559 | Bacteria | 2933 |
| 364 | Ga0495667_0088446 | 3300046559 | Bacteria | 2008 |
| 365 | Ga0495634_0021950 | 3300046642 | Bacteria | 4503 |
| 366 | Ga0495634_0025274 | 3300046642 | Bacteria | 4158 |
| 367 | Ga0495634_0045959 | 3300046642 | Bacteria | 2948 |
| 368 | Ga0495635_0028500 | 3300046663 | Bacteria | 3882 |
| 369 | Ga0495635_0057167 | 3300046663 | Bacteria | 2684 |
| 370 | Ga0495635_0076700 | 3300046663 | Bacteria | 2290 |
| 371 | Ga0495588_0000857 | 3300046674 | Bacteria | 13453 |
| 372 | Ga0495657_0007940 | 3300046675 | Bacteria | 8137 |
| 373 | Ga0495657_0047066 | 3300046675 | Bacteria | 2918 |
| 374 | Ga0495599_0000110 | 3300046678 | Bacteria | 55240 |
| 375 | Ga0495623_0000379 | 3300046679 | Bacteria | 29118 |
| 376 | Ga0495623_0137413 | 3300046679 | Unclassified | 1457 |
| 377 | Ga0495646_0002891 | 3300046680 | Bacteria | 10637 |
| 378 | Ga0495646_0038682 | 3300046680 | Bacteria | 2944 |
| 379 | Ga0495646_0061681 | 3300046680 | Bacteria | 2232 |
| 380 | Ga0495647_0000245 | 3300046681 | Bacteria | 14888 |
| 381 | Ga0495658_0000675 | 3300046683 | Bacteria | 18488 |
| 382 | Ga0495658_0064418 | 3300046683 | Bacteria | 2112 |
| 383 | Ga0495613_0006283 | 3300046689 | Bacteria | 8885 |
| 384 | Ga0495613_0057824 | 3300046689 | Bacteria | 2847 |
| 385 | Ga0495613_0079252 | 3300046689 | Bacteria | 2388 |
| 386 | Ga0495624_0018866 | 3300046690 | Bacteria | 4609 |
| 387 | Ga0495624_0044760 | 3300046690 | Bacteria | 2820 |
| 388 | Ga0495624_0060654 | 3300046690 | Bacteria | 2371 |
| 389 | Ga0495581_0019156 | 3300047315 | Bacteria | 3972 |
| 390 | Ga0495604_0000687 | 3300047317 | Bacteria | 28670 |
| 391 | Ga0495674_0026681 | 3300047319 | Bacteria | 5284 |
| 392 | Ga0495676_0000602 | 3300047321 | Bacteria | 29783 |
| 393 | Ga0495676_0019704 | 3300047321 | Bacteria | 5930 |
| 394 | Ga0495680_0011528 | 3300047322 | Bacteria | 7819 |
| 395 | Ga0495680_0053256 | 3300047322 | Bacteria | 3150 |
| 396 | Ga0495675_0000419 | 3300047444 | Bacteria | 28791 |
| 397 | Ga0495684_0013033 | 3300047471 | Bacteria | 6417 |
| 398 | Ga0495684_0068032 | 3300047471 | Bacteria | 2708 |
| 399 | Ga0495684_0135856 | 3300047471 | Bacteria | 1845 |
| 400 | Ga0495593_0000863 | 3300047673 | Bacteria | 17564 |
| 401 | Ga0495602_0001409 | 3300048088 | Bacteria | 23791 |
| 402 | Ga0495602_0052498 | 3300048088 | Bacteria | 3620 |
| 403 | Ga0495614_0000132 | 3300048089 | Bacteria | 26286 |
| 404 | Ga0496100_0064186 | 3300048903 | Bacteria | 2429 |
| 405 | Ga0496101_0111629 | 3300048904 | Bacteria | 2058 |
| 406 | Ga0496102_0005223 | 3300048905 | Bacteria | 11027 |
| 407 | Ga0496102_0031576 | 3300048905 | Bacteria | 4752 |
| 408 | Ga0496102_0107343 | 3300048905 | Bacteria | 2599 |
| 409 | Ga0496102_0120253 | 3300048905 | Bacteria | 2453 |
| 410 | Ga0496102_0194329 | 3300048905 | Bacteria | 1912 |
| 411 | Ga0496102_0203938 | 3300048905 | Bacteria | 1864 |
| 412 | Ga0496103_0040604 | 3300048906 | Bacteria | 2859 |
| 413 | Ga0496103_0044226 | 3300048906 | Bacteria | 2743 |
| 414 | Ga0496104_0000977 | 3300048907 | Bacteria | 24462 |
| 415 | Ga0496104_0001337 | 3300048907 | Bacteria | 21325 |
| 416 | Ga0496104_0006401 | 3300048907 | Bacteria | 10356 |
| 417 | Ga0496104_0027991 | 3300048907 | Bacteria | 5220 |
| 418 | Ga0496104_0037468 | 3300048907 | Bacteria | 4535 |
| 419 | Ga0496104_0074386 | 3300048907 | Bacteria | 3234 |
| 420 | Ga0496104_0116472 | 3300048907 | Bacteria | 2564 |
| 421 | Ga0496105_0002654 | 3300048908 | Bacteria | 13026 |
| 422 | Ga0496105_0006474 | 3300048908 | Bacteria | 9001 |
| 423 | Ga0496105_0027308 | 3300048908 | Bacteria | 4661 |
| 424 | Ga0496105_0030208 | 3300048908 | Bacteria | 4440 |
| 425 | Ga0496105_0055423 | 3300048908 | Bacteria | 3273 |
| 426 | Ga0496105_0060729 | 3300048908 | Bacteria | 3119 |
| 427 | Ga0496105_0068146 | 3300048908 | Bacteria | 2939 |
| 428 | Ga0496105_0185920 | 3300048908 | Bacteria | 1700 |
| 429 | Ga0496106_0016435 | 3300048909 | Bacteria | 5475 |
| 430 | Ga0496106_0046647 | 3300048909 | Bacteria | 3258 |
| 431 | Ga0496106_0071848 | 3300048909 | Bacteria | 2645 |
| 432 | Ga0496107_0002059 | 3300048910 | Bacteria | 12861 |
| 433 | Ga0496107_0145618 | 3300048910 | Bacteria | 1752 |
| 434 | Ga0496108_0000272 | 3300048911 | Bacteria | 44414 |
| 435 | Ga0496108_0000473 | 3300048911 | Bacteria | 32225 |
| 436 | Ga0496108_0009090 | 3300048911 | Bacteria | 8046 |
| 437 | Ga0496108_0014268 | 3300048911 | Bacteria | 6483 |
| 438 | Ga0496108_0026913 | 3300048911 | Bacteria | 4746 |
| 439 | Ga0496108_0031484 | 3300048911 | Bacteria | 4402 |
| 440 | Ga0496108_0059181 | 3300048911 | Bacteria | 3221 |
| 441 | Ga0496109_0000857 | 3300048912 | Bacteria | 25402 |
| 442 | Ga0496109_0001789 | 3300048912 | Bacteria | 17869 |
| 443 | Ga0496109_0001891 | 3300048912 | Bacteria | 17380 |
| 444 | Ga0496109_0007450 | 3300048912 | Bacteria | 9265 |
| 445 | Ga0496109_0045880 | 3300048912 | Bacteria | 3967 |
| 446 | Ga0496109_0063963 | 3300048912 | Bacteria | 3365 |
| 447 | Ga0496109_0214523 | 3300048912 | Bacteria | 1810 |
| 448 | Ga0496110_0001277 | 3300048913 | Bacteria | 18022 |
| 449 | Ga0496110_0001545 | 3300048913 | Bacteria | 16749 |
| 450 | Ga0496110_0019310 | 3300048913 | Bacteria | 5733 |
| 451 | Ga0496110_0111175 | 3300048913 | Bacteria | 2462 |
| 452 | Ga0496110_0182078 | 3300048913 | Unclassified | 1908 |
| 453 | Ga0496110_0246090 | 3300048913 | Bacteria | 1627 |
| 454 | Ga0496111_0001182 | 3300048914 | Bacteria | 14531 |
| 455 | Ga0496111_0002257 | 3300048914 | Bacteria | 11581 |
| 456 | Ga0496111_0005116 | 3300048914 | Bacteria | 8350 |
| 457 | Ga0496111_0013548 | 3300048914 | Bacteria | 5554 |
| 458 | Ga0496111_0075944 | 3300048914 | Bacteria | 2449 |
| 459 | Ga0496111_0118303 | 3300048914 | Bacteria | 1956 |
| 460 | Ga0496112_0001515 | 3300048915 | Bacteria | 17883 |
| 461 | Ga0496112_0013792 | 3300048915 | Bacteria | 7475 |
| 462 | Ga0496112_0014155 | 3300048915 | Bacteria | 7390 |
| 463 | Ga0496112_0026349 | 3300048915 | Bacteria | 5591 |
| 464 | Ga0496112_0077189 | 3300048915 | Bacteria | 3294 |
| 465 | Ga0496112_0096162 | 3300048915 | Bacteria | 2932 |
| 466 | Ga0496112_0112909 | 3300048915 | Bacteria | 2688 |
| 467 | Ga0496113_0000040 | 3300048916 | Bacteria | 55517 |
| 468 | Ga0496113_0025600 | 3300048916 | Bacteria | 4208 |
| 469 | Ga0496113_0078575 | 3300048916 | Bacteria | 2525 |
| 470 | Ga0496113_0089839 | 3300048916 | Unclassified | 2365 |
| 471 | Ga0496113_0102117 | 3300048916 | Bacteria | 2223 |
| 472 | Ga0496113_0166368 | 3300048916 | Bacteria | 1745 |
| 473 | Ga0496114_0019761 | 3300048917 | Bacteria | 5460 |
| 474 | Ga0496114_0024418 | 3300048917 | Bacteria | 4934 |
| 475 | Ga0496114_0041623 | 3300048917 | Bacteria | 3808 |
| 476 | Ga0496114_0163796 | 3300048917 | Bacteria | 1935 |
| 477 | Ga0496115_0003551 | 3300048918 | Bacteria | 11223 |
| 478 | Ga0496115_0031760 | 3300048918 | Bacteria | 4163 |
| 479 | Ga0496115_0049895 | 3300048918 | Bacteria | 3351 |
| 480 | Ga0496115_0068958 | 3300048918 | Bacteria | 2863 |
| 481 | Ga0501031_0005441 | 3300049568 | Bacteria | 8289 |
| 482 | Ga0501031_0054773 | 3300049568 | Bacteria | 2598 |
| 483 | Ga0501032_0033753 | 3300049569 | Bacteria | 3506 |
| 484 | Ga0501033_0042923 | 3300049570 | Bacteria | 3370 |
| 485 | Ga0501034_0047696 | 3300049571 | Bacteria | 4324 |
| 486 | Ga0501036_0004334 | 3300049572 | Bacteria | 11454 |
| 487 | Ga0501038_0079630 | 3300049574 | Bacteria | 2762 |
| 488 | Ga0501039_0001308 | 3300049575 | Bacteria | 18206 |
| 489 | Ga0501039_0066739 | 3300049575 | Bacteria | 2793 |
| 490 | Ga0501040_0020791 | 3300049576 | Bacteria | 4376 |
| 491 | Ga0501040_0025343 | 3300049576 | Bacteria | 3987 |
| 492 | Ga0501040_0101227 | 3300049576 | Bacteria | 2010 |
| 493 | Ga0501041_0003653 | 3300049577 | Bacteria | 8853 |
| 494 | Ga0501042_0003274 | 3300049578 | Bacteria | 10134 |
| 495 | Ga0501046_0054257 | 3300049580 | Bacteria | 3154 |
| 496 | Ga0501048_0047132 | 3300049582 | Bacteria | 3075 |
| 497 | Ga0501067_0002463 | 3300049583 | Bacteria | 10212 |
| 498 | Ga0501067_0023056 | 3300049583 | Bacteria | 3448 |
| 499 | Ga0501068_0007776 | 3300049584 | Bacteria | 5938 |
| 500 | Ga0501069_0081322 | 3300049585 | Bacteria | 1825 |
| 501 | Ga0501070_0005438 | 3300049586 | Bacteria | 10873 |
| 502 | Ga0501070_0007027 | 3300049586 | Bacteria | 9576 |
| 503 | Ga0501070_0011769 | 3300049586 | Bacteria | 7390 |
| 504 | Ga0501070_0106192 | 3300049586 | Bacteria | 2321 |
| 505 | Ga0501071_0004653 | 3300049587 | Bacteria | 8718 |
| 506 | Ga0501072_0007897 | 3300049588 | Bacteria | 8079 |
| 507 | Ga0501074_0014194 | 3300049590 | Bacteria | 5794 |
| 508 | Ga0501074_0022361 | 3300049590 | Bacteria | 4593 |
| 509 | Ga0501075_0024524 | 3300049591 | Bacteria | 4424 |
| 510 | Ga0501077_0013661 | 3300049593 | Bacteria | 5089 |
| 511 | Ga0501077_0041231 | 3300049593 | Bacteria | 2940 |
| 512 | Ga0501079_0003331 | 3300049741 | Bacteria | 11787 |
| 513 | Ga0501079_0167427 | 3300049741 | Bacteria | 1714 |
| 514 | Ga0501080_0119901 | 3300049742 | Bacteria | 2438 |
| 515 | Ga0501080_0252351 | 3300049742 | Bacteria | 1608 |
| 516 | Ga0501083_0005190 | 3300049744 | Bacteria | 9216 |
| 517 | Ga0501035_0076668 | 3300049822 | Bacteria | 2956 |
| 518 | Ga0501045_0001410 | 3300049824 | Bacteria | 16040 |
| 519 | Ga0501045_0003106 | 3300049824 | Bacteria | 11356 |
| 520 | nmdc:mga05p37_20642_c1 | 3300050507 | Bacteria | 7970 |
| 521 | nmdc:mga05p37_2406_c1 | 3300050507 | Bacteria | 21776 |
| 522 | nmdc:mga05p37_73426_c1 | 3300050507 | Bacteria | 4210 |
| 523 | nmdc:mga08y16_186314_c1 | 3300050511 | Bacteria | 2153 |
| 524 | nmdc:mga08y16_249655_c1 | 3300050511 | Bacteria | 1834 |
| 525 | nmdc:mga08y16_46181_c1 | 3300050511 | Bacteria | 4560 |
| 526 | nmdc:mga0n895_66523_c1 | 3300050512 | Bacteria | 3569 |
| 527 | nmdc:mga0rr50_172478_c1 | 3300050513 | Bacteria | 1764 |
| 528 | nmdc:mga0rr50_19021_c1 | 3300050513 | Bacteria | 4626 |
| 529 | nmdc:mga0a205_117780_c1 | 3300050515 | Bacteria | 2554 |
| 530 | nmdc:mga0a205_148100_c1 | 3300050515 | Bacteria | 2248 |
| 531 | nmdc:mga0a205_5953_c1 | 3300050515 | Bacteria | 10994 |
| 532 | Ga0495601_0000340 | 3300053077 | Bacteria | 24567 |
| 533 | Ga0495601_0020585 | 3300053077 | Bacteria | 4030 |
| 534 | Ga0495601_0040461 | 3300053077 | Bacteria | 2918 |
| 535 | Ga0495601_0043183 | 3300053077 | Bacteria | 2831 |
| 536 | Ga0495601_0098497 | 3300053077 | Bacteria | 1887 |
| 537 | Ga0495612_0021355 | 3300053078 | Bacteria | 2597 |
| 538 | Ga0495612_0037794 | 3300053078 | Bacteria | 1961 |
| 539 | Ga0495612_0051693 | 3300053078 | Bacteria | 1689 |
| 540 | Ga0495595_0001185 | 3300053084 | Bacteria | 10134 |
| 541 | Ga0495595_0021365 | 3300053084 | Bacteria | 2827 |
| 542 | Ga0495595_0057566 | 3300053084 | Bacteria | 1813 |
| 543 | Ga0495619_0001752 | 3300053085 | Bacteria | 14426 |
| 544 | Ga0495619_0049831 | 3300053085 | Bacteria | 2763 |
| 545 | Ga0495619_0080627 | 3300053085 | Bacteria | 2190 |
| 546 | Ga0495619_0088496 | 3300053085 | Bacteria | 2094 |
| 547 | Ga0500566_0098407 | 3300053094 | Bacteria | 1607 |
| 548 | Ga0501084_0027489 | 3300054114 | Bacteria | 4752 |
| 549 | Ga0501084_0079059 | 3300054114 | Bacteria | 2756 |
| 550 | Ga0466962_0001837 | 3300061719 | Bacteria | 9996 |
| 551 | Ga0466962_0009133 | 3300061719 | Bacteria | 4748 |
| 552 | Ga0466962_0019961 | 3300061719 | Bacteria | 3221 |
| 553 | Ga0530510_0005142 | 3300061734 | Bacteria | 9027 |
| 554 | Ga0496112_0044365 | |||
| 555 | Ga0070658_10147574 | |||
| 556 | Ga0070683_100002787 | |||
| 557 | Ga0070683_100092238 | |||
| 558 | Ga0070690_100103245 | |||
| 559 | Ga0070680_100026368 | |||
| 560 | Ga0070680_100097872 | |||
| 561 | Ga0070680_100243614 | |||
| 562 | Ga0070682_100019819 | |||
| 563 | Ga0070682_100042246 | |||
| 564 | Ga0068868_100038305 | |||
| 565 | Ga0070660_100008515 | |||
| 566 | Ga0070660_100022105 | |||
| 567 | Ga0070691_10027327 | |||
| 568 | Ga0070714_100021353 | |||
| 569 | Ga0070714_100130249 | |||
| 570 | Ga0070714_100163274 | |||
| 571 | Ga0070713_100045051 | |||
| 572 | Ga0070713_100055254 | |||
| 573 | Ga0070713_100190735 | |||
| 574 | Ga0070710_10001590 | |||
| 575 | Ga0070710_10020109 | |||
| 576 | Ga0070711_100005385 | |||
| 577 | Ga0070711_100009007 | |||
| 578 | Ga0070711_100163962 | |||
| 579 | Ga0070705_100055551 | |||
| 580 | Ga0070700_100013906 | |||
| 581 | Ga0070708_100020147 | |||
| 582 | Ga0070708_100025940 | |||
| 583 | Ga0070663_100018013 | |||
| 584 | Ga0070678_100027748 | |||
| 585 | Ga0070681_10046805 | |||
| 586 | Ga0070706_100002089 | |||
| 587 | Ga0070706_100054927 | |||
| 588 | Ga0070706_100169990 | |||
| 589 | Ga0070707_100000736 | |||
| 590 | Ga0070707_100001273 | |||
| 591 | Ga0070707_100018978 | |||
| 592 | Ga0070707_100225462 | |||
| 593 | Ga0070707_100296720 | |||
| 594 | Ga0070698_100010276 | |||
| 595 | Ga0070698_100016163 | |||
| 596 | Ga0070698_100024678 | |||
| 597 | Ga0070698_100088976 | |||
| 598 | Ga0070698_100162872 | |||
| 599 | Ga0070699_100028631 | |||
| 600 | Ga0070699_100085700 | |||
| 601 | Ga0070679_100086916 | |||
| 602 | Ga0070679_100098170 | |||
| 603 | Ga0070679_100161104 | |||
| 604 | Ga0070679_100293685 | |||
| 605 | Ga0070684_100021195 | |||
| 606 | Ga0070684_100047821 | |||
| 607 | Ga0070684_100151272 | |||
| 608 | Ga0070684_100179417 | |||
| 609 | Ga0070686_100041358 | |||
| 610 | Ga0070686_100048181 | |||
| 611 | Ga0070695_100000023 | |||
| 612 | Ga0070696_100097446 | |||
| 613 | Ga0068855_100039573 | |||
| 614 | Ga0068855_100076760 | |||
| 615 | Ga0068856_100004494 | |||
| 616 | Ga0070702_100018393 | |||
| 617 | Ga0068864_100058340 | |||
| 618 | Ga0068861_100049503 | |||
| 619 | Ga0081455_10027516 | |||
| 620 | Ga0081538_10014854 | |||
| 621 | Ga0081540_1001884 | |||
| 622 | Ga0081539_10002903 | |||
| 623 | Ga0070717_10003907 | |||
| 624 | Ga0070717_10018851 | |||
| 625 | Ga0070717_10022558 | |||
| 626 | Ga0070717_10030392 | |||
| 627 | Ga0070717_10040702 | |||
| 628 | Ga0075432_10010379 | |||
| 629 | Ga0070715_10007105 | |||
| 630 | Ga0070712_100052940 | |||
| 631 | Ga0075428_100200927 | |||
| 632 | Ga0075433_10007908 | |||
| 633 | Ga0075433_10020701 | |||
| 634 | Ga0075433_10074172 | |||
| 635 | Ga0075434_100013194 | |||
| 636 | Ga0075434_100035968 | |||
| 637 | Ga0075429_100052446 | |||
| 638 | Ga0075436_100002736 | |||
| 639 | Ga0075436_100041892 | |||
| 640 | Ga0075436_100044442 | |||
| 641 | Ga0075435_100000579 | |||
| 642 | Ga0075435_100001676 | |||
| 643 | Ga0075435_100036783 | |||
| 644 | Ga0111539_10001928 | |||
| 645 | Ga0111539_10219406 | |||
| 646 | Ga0111539_10356086 | |||
| 647 | Ga0105245_10005774 | |||
| 648 | Ga0105245_10014739 | |||
| 649 | Ga0105245_10085538 | |||
| 650 | Ga0105245_10110840 | |||
| 651 | Ga0105245_10159705 | |||
| 652 | Ga0114129_10002630 | |||
| 653 | Ga0114129_10044266 | |||
| 654 | Ga0114129_10171551 | |||
| 655 | Ga0114129_10179373 | |||
| 656 | Ga0105242_10038235 | |||
| 657 | Ga0105242_10087126 | |||
| 658 | Ga0105237_10101443 | |||
| 659 | Ga0157370_10005484 | |||
| 660 | Ga0157370_10010689 | |||
| 661 | Ga0157369_10008456 | |||
| 662 | Ga0157369_10038348 | |||
| 663 | Ga0157375_10003176 | |||
| 664 | Ga0182008_10002973 | |||
| 665 | Ga0157379_10071265 | |||
| 666 | Ga0157376_10017745 | |||
| 667 | Ga0182006_1043204 | |||
| 668 | Ga0206354_10286303 | |||
| 669 | Ga0206353_11257401 | |||
| 670 | Ga0207653_10007342 | |||
| 671 | Ga0207692_10018241 | |||
| 672 | Ga0207699_10059306 | |||
| 673 | Ga0207684_10004837 | |||
| 674 | Ga0207684_10102878 | |||
| 675 | Ga0207707_10100991 | |||
| 676 | Ga0207707_10195325 | |||
| 677 | Ga0207671_10068278 | |||
| 678 | Ga0207693_10000198 | |||
| 679 | Ga0207693_10007712 | |||
| 680 | Ga0207693_10008363 | |||
| 681 | Ga0207693_10009671 | |||
| 682 | Ga0207693_10059093 | |||
| 683 | Ga0207660_10041793 | |||
| 684 | Ga0207657_10016396 | |||
| 685 | Ga0207657_10024716 | |||
| 686 | Ga0207652_10223975 | |||
| 687 | Ga0207646_10002219 | |||
| 688 | Ga0207646_10004655 | |||
| 689 | Ga0207681_10126008 | |||
| 690 | Ga0207687_10139227 | |||
| 691 | Ga0207700_10038025 | |||
| 692 | Ga0207700_10162115 | |||
| 693 | Ga0207664_10005271 | |||
| 694 | Ga0207664_10032010 | |||
| 695 | Ga0207664_10037991 | |||
| 696 | Ga0207706_10011285 | |||
| 697 | Ga0207706_10178576 | |||
| 698 | Ga0207665_10000197 | |||
| 699 | Ga0207665_10005170 | |||
| 700 | Ga0207691_10181656 | |||
| 701 | Ga0207711_10135444 | |||
| 702 | Ga0207661_10016534 | |||
| 703 | Ga0207661_10017872 | |||
| 704 | Ga0207661_10125382 | |||
| 705 | Ga0207668_10029028 | |||
| 706 | Ga0207678_10027462 | |||
| 707 | Ga0207678_10220475 | |||
| 708 | Ga0207708_10009298 | |||
| 709 | Ga0207702_10006207 | |||
| 710 | Ga0207648_10002132 | |||
| 711 | Ga0207675_100004186 | |||
| 712 | Ga0207675_100181309 | |||
| 713 | Ga0207683_10029845 | |||
| 714 | Ga0207683_10098762 | |||
| 715 | Ga0207698_10150922 | |||
| 716 | Ga0207428_10013176 | |||
| 717 | Ga0265319_1001059 | |||
| 718 | Ga0265334_10007596 | |||
| 719 | Ga0265318_10001637 | |||
| 720 | Ga0265318_10003407 | |||
| 721 | Ga0265338_10004619 | |||
| 722 | Ga0265338_10005076 | |||
| 723 | Ga0265338_10125573 | |||
| 724 | Ga0265330_10016974 | |||
| 725 | Ga0265330_10047333 | |||
| 726 | Ga0265328_10010907 | |||
| 727 | Ga0265320_10017712 | |||
| 728 | Ga0265320_10040777 | |||
| 729 | Ga0265325_10018259 | |||
| 730 | Ga0265325_10028698 | |||
| 731 | Ga0265340_10059216 | |||
| 732 | Ga0265339_10004983 | |||
| 733 | Ga0265331_10023049 | |||
| 734 | Ga0265327_10023772 | |||
| 735 | Ga0265327_10025765 | |||
| 736 | Ga0265316_10025321 | |||
| 737 | Ga0265316_10053801 | |||
| 738 | Ga0265313_10016189 | |||
| 739 | Ga0265314_10005893 | |||
| 740 | Ga0265342_10025222 | |||
| 741 | Ga0265342_10038371 | |||
| 742 | Ga0373926_0018619 | |||
| 743 | Ga0373936_0043462 | |||
| 744 | Ga0373941_0015705 | |||
| 745 | Ga0373960_0016274 | |||
| 746 | Ga0373943_0003173 | |||
| 747 | Ga0373943_0013462 | |||
| 748 | Ga0373943_0031502 | |||
| 749 | Ga0373927_0028600 | |||
| 750 | Ga0373947_0001279 | |||
| 751 | Ga0373947_0010190 | |||
| 752 | Ga0373947_0038701 | |||
| 753 | Ga0373937_0060417 | |||
| 754 | Ga0373925_0001456 | |||
| 755 | Ga0395899_0004144 | |||
| 756 | Ga0395899_0007114 | |||
| 757 | Ga0395899_0028568 | |||
| 758 | Ga0395899_0030874 | |||
| 759 | Ga0395899_0044205 | |||
| 760 | Ga0395899_0079820 | |||
| 761 | Ga0395899_0149461 | |||
| 762 | Ga0395900_0005056 | |||
| 763 | Ga0395900_0008595 | |||
| 764 | Ga0395900_0016527 | |||
| 765 | Ga0395900_0024289 | |||
| 766 | Ga0395900_0030925 | |||
| 767 | Ga0395900_0043110 | |||
| 768 | Ga0395900_0050166 | |||
| 769 | Ga0395900_0054382 | |||
| 770 | Ga0395900_0073531 | |||
| 771 | Ga0395900_0126617 | |||
| 772 | Ga0395900_0266910 | |||
| 773 | Ga0395898_0006932 | |||
| 774 | Ga0395898_0008878 | |||
| 775 | Ga0395898_0010279 | |||
| 776 | Ga0395898_0015998 | |||
| 777 | Ga0395898_0019348 | |||
| 778 | Ga0395898_0031845 | |||
| 779 | Ga0395898_0041537 | |||
| 780 | Ga0395898_0047572 | |||
| 781 | Ga0395898_0177134 | |||
| 782 | Ga0395898_0303662 | |||
| 783 | Ga0395898_0351975 | |||
| 784 | Ga0395905_0002930 | |||
| 785 | Ga0395905_0006934 | |||
| 786 | Ga0395905_0007022 | |||
| 787 | Ga0395905_0011779 | |||
| 788 | Ga0395905_0012413 | |||
| 789 | Ga0395905_0022282 | |||
| 790 | Ga0395905_0035578 | |||
| 791 | Ga0395905_0069044 | |||
| 792 | Ga0395901_0004146 | |||
| 793 | Ga0395901_0009150 | |||
| 794 | Ga0395901_0020678 | |||
| 795 | Ga0395901_0026455 | |||
| 796 | Ga0395901_0033046 | |||
| 797 | Ga0395901_0034280 | |||
| 798 | Ga0395901_0067732 | |||
| 799 | Ga0395901_0075445 | |||
| 800 | Ga0395901_0150034 | |||
| 801 | Ga0395901_0175745 | |||
| 802 | Ga0436360_1320551 | |||
| 803 | Ga0439433_0003796 | |||
| 804 | Ga0439441_003139 | |||
| 805 | Ga0439446_0004144 | |||
| 806 | Ga0466969_0001820 | |||
| 807 | Ga0466961_0021458 | |||
| 808 | Ga0466961_0059646 | |||
| 809 | Ga0466961_0117836 | |||
| 810 | Ga0466963_0000518 | |||
| 811 | Ga0466963_0003462 | |||
| 812 | Ga0466963_0009739 | |||
| 813 | Ga0466963_0011497 | |||
| 814 | Ga0466963_0012038 | |||
| 815 | Ga0466963_0015702 | |||
| 816 | Ga0466963_0016045 | |||
| 817 | Ga0466963_0018541 | |||
| 818 | Ga0466963_0052155 | |||
| 819 | Ga0466963_0053911 | |||
| 820 | Ga0466963_0059039 | |||
| 821 | Ga0466963_0065364 | |||
| 822 | Ga0466963_0163594 | |||
| 823 | Ga0466964_0001008 | |||
| 824 | Ga0466964_0003578 | |||
| 825 | Ga0466964_0012047 | |||
| 826 | Ga0466964_0044427 | |||
| 827 | Ga0466971_0011727 | |||
| 828 | Ga0466971_0047373 | |||
| 829 | Ga0466968_0000984 | |||
| 830 | Ga0466968_0003485 | |||
| 831 | Ga0466968_0008612 | |||
| 832 | Ga0466968_0036833 | |||
| 833 | Ga0466968_0066912 | |||
| 834 | Ga0466957_0005617 | |||
| 835 | Ga0466957_0018705 | |||
| 836 | Ga0466957_0023144 | |||
| 837 | Ga0466957_0031556 | |||
| 838 | Ga0466957_0102279 | |||
| 839 | Ga0466959_0013448 | |||
| 840 | Ga0466959_0031281 | |||
| 841 | Ga0451576_0163520 | |||
| 842 | Ga0466958_0001119 | |||
| 843 | Ga0466958_0010910 | |||
| 844 | Ga0466958_0011491 | |||
| 845 | Ga0466958_0013018 | |||
| 846 | Ga0466958_0023697 | |||
| 847 | Ga0466958_0035521 | |||
| 848 | Ga0466958_0075408 | |||
| 849 | Ga0466967_0000215 | |||
| 850 | Ga0466967_0002633 | |||
| 851 | Ga0466967_0004694 | |||
| 852 | Ga0466967_0008665 | |||
| 853 | Ga0466967_0010632 | |||
| 854 | Ga0466967_0011472 | |||
| 855 | Ga0466967_0012538 | |||
| 856 | Ga0466967_0021924 | |||
| 857 | Ga0466967_0044730 | |||
| 858 | Ga0466967_0052580 | |||
| 859 | Ga0466967_0056012 | |||
| 860 | Ga0466967_0114388 | |||
| 861 | Ga0466967_0117806 | |||
| 862 | Ga0466967_0129048 | |||
| 863 | Ga0466967_0148982 | |||
| 864 | Ga0466967_0168275 | |||
| 865 | Ga0495592_0000597 | |||
| 866 | Ga0495592_0003845 | |||
| 867 | Ga0495592_0086273 | |||
| 868 | Ga0495603_0000450 | |||
| 869 | Ga0495629_0001473 | |||
| 870 | Ga0495629_0007112 | |||
| 871 | Ga0495629_0034375 | |||
| 872 | Ga0495641_0001513 | |||
| 873 | Ga0495641_0013562 | |||
| 874 | Ga0495651_0000008 | |||
| 875 | Ga0495651_0086787 | |||
| 876 | Ga0495653_0000725 | |||
| 877 | Ga0495653_0032755 | |||
| 878 | Ga0495653_0052434 | |||
| 879 | Ga0495653_0061380 | |||
| 880 | Ga0495580_0006863 | |||
| 881 | Ga0495580_0040667 | |||
| 882 | Ga0495582_0000711 | |||
| 883 | Ga0495582_0008066 | |||
| 884 | Ga0495582_0052075 | |||
| 885 | Ga0495639_0000520 | |||
| 886 | Ga0495639_0024573 | |||
| 887 | Ga0495664_0016797 | |||
| 888 | Ga0495664_0053361 | |||
| 889 | Ga0495664_0074459 | |||
| 890 | Ga0495594_0001436 | |||
| 891 | Ga0495594_0056014 | |||
| 892 | Ga0495607_0023628 | |||
| 893 | Ga0495608_0000957 | |||
| 894 | Ga0495608_0074310 | |||
| 895 | Ga0495608_0127465 | |||
| 896 | Ga0495618_0002854 | |||
| 897 | Ga0495618_0019968 | |||
| 898 | Ga0495628_0000105 | |||
| 899 | Ga0495628_0177868 | |||
| 900 | Ga0495630_0001692 | |||
| 901 | Ga0495630_0010267 | |||
| 902 | Ga0495630_0068616 | |||
| 903 | Ga0495666_0000272 | |||
| 904 | Ga0495666_0011671 | |||
| 905 | Ga0495652_0001221 | |||
| 906 | Ga0495652_0008764 | |||
| 907 | Ga0495652_0032894 | |||
| 908 | Ga0495652_0185802 | |||
| 909 | Ga0495665_0001436 | |||
| 910 | Ga0495665_0039270 | |||
| 911 | Ga0495640_0026292 | |||
| 912 | Ga0495640_0158659 | |||
| 913 | Ga0495586_0031982 | |||
| 914 | Ga0495587_0000048 | |||
| 915 | Ga0495645_0000029 | |||
| 916 | Ga0495667_0044697 | |||
| 917 | Ga0495667_0088446 | |||
| 918 | Ga0495634_0021950 | |||
| 919 | Ga0495634_0025274 | |||
| 920 | Ga0495634_0045959 | |||
| 921 | Ga0495635_0028500 | |||
| 922 | Ga0495635_0057167 | |||
| 923 | Ga0495635_0076700 | |||
| 924 | Ga0495588_0000857 | |||
| 925 | Ga0495657_0007940 | |||
| 926 | Ga0495657_0047066 | |||
| 927 | Ga0495599_0000110 | |||
| 928 | Ga0495623_0000379 | |||
| 929 | Ga0495623_0137413 | |||
| 930 | Ga0495646_0002891 | |||
| 931 | Ga0495646_0038682 | |||
| 932 | Ga0495646_0061681 | |||
| 933 | Ga0495647_0000245 | |||
| 934 | Ga0495658_0000675 | |||
| 935 | Ga0495658_0064418 | |||
| 936 | Ga0495613_0006283 | |||
| 937 | Ga0495613_0057824 | |||
| 938 | Ga0495613_0079252 | |||
| 939 | Ga0495624_0018866 | |||
| 940 | Ga0495624_0044760 | |||
| 941 | Ga0495624_0060654 | |||
| 942 | Ga0495581_0019156 | |||
| 943 | Ga0495604_0000687 | |||
| 944 | Ga0495674_0026681 | |||
| 945 | Ga0495676_0000602 | |||
| 946 | Ga0495676_0019704 | |||
| 947 | Ga0495680_0011528 | |||
| 948 | Ga0495680_0053256 | |||
| 949 | Ga0495675_0000419 | |||
| 950 | Ga0495684_0013033 | |||
| 951 | Ga0495684_0068032 | |||
| 952 | Ga0495684_0135856 | |||
| 953 | Ga0495593_0000863 | |||
| 954 | Ga0495602_0001409 | |||
| 955 | Ga0495602_0052498 | |||
| 956 | Ga0495614_0000132 | |||
| 957 | Ga0496100_0064186 | |||
| 958 | Ga0496101_0111629 | |||
| 959 | Ga0496102_0005223 | |||
| 960 | Ga0496102_0031576 | |||
| 961 | Ga0496102_0107343 | |||
| 962 | Ga0496102_0120253 | |||
| 963 | Ga0496102_0194329 | |||
| 964 | Ga0496102_0203938 | |||
| 965 | Ga0496103_0040604 | |||
| 966 | Ga0496103_0044226 | |||
| 967 | Ga0496104_0000977 | |||
| 968 | Ga0496104_0001337 | |||
| 969 | Ga0496104_0006401 | |||
| 970 | Ga0496104_0027991 | |||
| 971 | Ga0496104_0037468 | |||
| 972 | Ga0496104_0074386 | |||
| 973 | Ga0496104_0116472 | |||
| 974 | Ga0496105_0002654 | |||
| 975 | Ga0496105_0006474 | |||
| 976 | Ga0496105_0027308 | |||
| 977 | Ga0496105_0030208 | |||
| 978 | Ga0496105_0055423 | |||
| 979 | Ga0496105_0060729 | |||
| 980 | Ga0496105_0068146 | |||
| 981 | Ga0496105_0185920 | |||
| 982 | Ga0496106_0016435 | |||
| 983 | Ga0496106_0046647 | |||
| 984 | Ga0496106_0071848 | |||
| 985 | Ga0496107_0002059 | |||
| 986 | Ga0496107_0145618 | |||
| 987 | Ga0496108_0000272 | |||
| 988 | Ga0496108_0000473 | |||
| 989 | Ga0496108_0009090 | |||
| 990 | Ga0496108_0014268 | |||
| 991 | Ga0496108_0026913 | |||
| 992 | Ga0496108_0031484 | |||
| 993 | Ga0496108_0059181 | |||
| 994 | Ga0496109_0000857 | |||
| 995 | Ga0496109_0001789 | |||
| 996 | Ga0496109_0001891 | |||
| 997 | Ga0496109_0007450 | |||
| 998 | Ga0496109_0045880 | |||
| 999 | Ga0496109_0063963 | |||
| 1000 | Ga0496109_0214523 | |||
| 1001 | Ga0496110_0001277 | |||
| 1002 | Ga0496110_0001545 | |||
| 1003 | Ga0496110_0019310 | |||
| 1004 | Ga0496110_0111175 | |||
| 1005 | Ga0496110_0182078 | |||
| 1006 | Ga0496110_0246090 | |||
| 1007 | Ga0496111_0001182 | |||
| 1008 | Ga0496111_0002257 | |||
| 1009 | Ga0496111_0005116 | |||
| 1010 | Ga0496111_0013548 | |||
| 1011 | Ga0496111_0075944 | |||
| 1012 | Ga0496111_0118303 | |||
| 1013 | Ga0496112_0001515 | |||
| 1014 | Ga0496112_0013792 | |||
| 1015 | Ga0496112_0014155 | |||
| 1016 | Ga0496112_0026349 | |||
| 1017 | Ga0496112_0077189 | |||
| 1018 | Ga0496112_0096162 | |||
| 1019 | Ga0496112_0112909 | |||
| 1020 | Ga0496113_0000040 | |||
| 1021 | Ga0496113_0025600 | |||
| 1022 | Ga0496113_0078575 | |||
| 1023 | Ga0496113_0089839 | |||
| 1024 | Ga0496113_0102117 | |||
| 1025 | Ga0496113_0166368 | |||
| 1026 | Ga0496114_0019761 | |||
| 1027 | Ga0496114_0024418 | |||
| 1028 | Ga0496114_0041623 | |||
| 1029 | Ga0496114_0163796 | |||
| 1030 | Ga0496115_0003551 | |||
| 1031 | Ga0496115_0031760 | |||
| 1032 | Ga0496115_0049895 | |||
| 1033 | Ga0496115_0068958 | |||
| 1034 | Ga0501031_0005441 | |||
| 1035 | Ga0501031_0054773 | |||
| 1036 | Ga0501032_0033753 | |||
| 1037 | Ga0501033_0042923 | |||
| 1038 | Ga0501034_0047696 | |||
| 1039 | Ga0501036_0004334 | |||
| 1040 | Ga0501038_0079630 | |||
| 1041 | Ga0501039_0001308 | |||
| 1042 | Ga0501039_0066739 | |||
| 1043 | Ga0501040_0020791 | |||
| 1044 | Ga0501040_0025343 | |||
| 1045 | Ga0501040_0101227 | |||
| 1046 | Ga0501041_0003653 | |||
| 1047 | Ga0501042_0003274 | |||
| 1048 | Ga0501046_0054257 | |||
| 1049 | Ga0501048_0047132 | |||
| 1050 | Ga0501067_0002463 | |||
| 1051 | Ga0501067_0023056 | |||
| 1052 | Ga0501068_0007776 | |||
| 1053 | Ga0501069_0081322 | |||
| 1054 | Ga0501070_0005438 | |||
| 1055 | Ga0501070_0007027 | |||
| 1056 | Ga0501070_0011769 | |||
| 1057 | Ga0501070_0106192 | |||
| 1058 | Ga0501071_0004653 | |||
| 1059 | Ga0501072_0007897 | |||
| 1060 | Ga0501074_0014194 | |||
| 1061 | Ga0501074_0022361 | |||
| 1062 | Ga0501075_0024524 | |||
| 1063 | Ga0501077_0013661 | |||
| 1064 | Ga0501077_0041231 | |||
| 1065 | Ga0501079_0003331 | |||
| 1066 | Ga0501079_0167427 | |||
| 1067 | Ga0501080_0119901 | |||
| 1068 | Ga0501080_0252351 | |||
| 1069 | Ga0501083_0005190 | |||
| 1070 | Ga0501035_0076668 | |||
| 1071 | Ga0501045_0001410 | |||
| 1072 | Ga0501045_0003106 | |||
| 1073 | nmdc:mga05p37_20642_c1 | |||
| 1074 | nmdc:mga05p37_2406_c1 | |||
| 1075 | nmdc:mga05p37_73426_c1 | |||
| 1076 | nmdc:mga08y16_186314_c1 | |||
| 1077 | nmdc:mga08y16_249655_c1 | |||
| 1078 | nmdc:mga08y16_46181_c1 | |||
| 1079 | nmdc:mga0n895_66523_c1 | |||
| 1080 | nmdc:mga0rr50_172478_c1 | |||
| 1081 | nmdc:mga0rr50_19021_c1 | |||
| 1082 | nmdc:mga0a205_117780_c1 | |||
| 1083 | nmdc:mga0a205_148100_c1 | |||
| 1084 | nmdc:mga0a205_5953_c1 | |||
| 1085 | Ga0495601_0000340 | |||
| 1086 | Ga0495601_0020585 | |||
| 1087 | Ga0495601_0040461 | |||
| 1088 | Ga0495601_0043183 | |||
| 1089 | Ga0495601_0098497 | |||
| 1090 | Ga0495612_0021355 | |||
| 1091 | Ga0495612_0037794 | |||
| 1092 | Ga0495612_0051693 | |||
| 1093 | Ga0495595_0001185 | |||
| 1094 | Ga0495595_0021365 | |||
| 1095 | Ga0495595_0057566 | |||
| 1096 | Ga0495619_0001752 | |||
| 1097 | Ga0495619_0049831 | |||
| 1098 | Ga0495619_0080627 | |||
| 1099 | Ga0495619_0088496 | |||
| 1100 | Ga0500566_0098407 | |||
| 1101 | Ga0501084_0027489 | |||
| 1102 | Ga0501084_0079059 | |||
| 1103 | Ga0466962_0001837 | |||
| 1104 | Ga0466962_0009133 | |||
| 1105 | Ga0466962_0019961 | |||
| 1106 | Ga0530510_0005142 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zok-assembly2.cif.gz_C | structure of 3-dehydroquinate synthase from actinidia chinensis in complex with nad | 0.9148 | 132 | 442 |
| 6hqv-assembly1.cif.gz_A | pentafunctional arom complex from chaetomium thermophilum | 0.8987 | 131 | 431 |
| 1xai-assembly2.cif.gz_B | crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, nad+ and carbaphosphonate | 0.8973 | 132 | 441 |
| 6hqv-assembly1.cif.gz_B | pentafunctional arom complex from chaetomium thermophilum | 0.8864 | 131 | 431 |
| 1nvd-assembly1.cif.gz_A | crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate | 0.8858 | 131 | 438 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0HLZ4_60_246_3.40.50.1970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9309 | 132 | 282 | 3.40.50.1970 |
| 5hvnA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.916 | 132 | 282 | 3.40.50.1970 |
| 1xahB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.912 | 132 | 282 | 3.40.50.1970 |
| 3qbdA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9089 | 132 | 282 | 3.40.50.1970 |
| af_P08566_1_177_3.40.50.1970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.902 | 132 | 282 | 3.40.50.1970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y1MIS5-F1-model_v4 | 3-dehydroquinate synthase domain-containing protein | 0.9868 | 182 | 276 |
GO:0003856
GO:0009073 |
| AF-A0A7S1KI02-F1-model_v4 | 3-dehydroquinate synthase domain-containing protein | 0.9791 | 190 | 300 |
GO:0003856
GO:0009073 GO:0016020 |
| AF-A0A3N4IYI6-F1-model_v4 | Dehydroquinate synthase-like protein | 0.9714 | 184 | 302 |
GO:0003856
GO:0009073 |
| AF-A0A2X1PI66-F1-model_v4 | 3-dehydroquinate synthase (EC 4.2.3.4) | 0.9578 | 200 | 299 |
GO:0003856
GO:0009073 |
| AF-A0A3B9DMR7-F1-model_v4 | 3-dehydroquinate synthase | 0.956 | 132 | 299 |
GO:0003856
GO:0009073 |