F462913

General Info

Members Datasets Scaffolds Average Seq Length
553 234 1106 455

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0044365|Ga0496112_0044365_1129_2595
Length 488
Sequence VACLRRANRLDRALTKHVALIGFMGAGKTTLGEETARRLNWLLKDVDQVVEASQSRSIPELFAEGESVFRDVELRVVRGLLAHPRPSVIALGGGAVTTPEVRGLLHDHAVTVWIDEDVDTCWERVRGTDRPLAQDEAEFRRLFDERHPLYAAAADAVVRDADDIVLAAAGVRVGRGALRRLGELVPGDGQVALVSDPNVAGIYGMDAQLALGGRLAQVHELPLGEDAKTISALDRLWQDLRLDRSGTVVALGGGCTTDAAGFAAATYLRGIPWVPVPTSLVAQVDAAIGGKTGIDLPQGKNLVGSFHWPVRTIIDPALLETLPPAQRLEGMAEVVKTGLLAGEPLWELPDDELVRRCASFKAALCLRDPEDNAERKMLNLGHTFAHALEAAAGYEGLSHGRAVALGLLAALRLSGGRLSGRDIGQVEEILRPKPVKVDRERAWQAMQRDKKNVGGELRLVLIGEDGPEWDVAVPAEDVRRELDALIAG

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
110 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 14.1
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0044365 3300048915 Bacteria 4356
2 Ga0070658_10147574 3300005327 Bacteria 1968
3 Ga0070683_100002787 3300005329 Bacteria 13976
4 Ga0070683_100092238 3300005329 Bacteria 2845
5 Ga0070690_100103245 3300005330 Bacteria 1893
6 Ga0070680_100026368 3300005336 Bacteria 4648
7 Ga0070680_100097872 3300005336 Bacteria 2433
8 Ga0070680_100243614 3300005336 Bacteria 1520
9 Ga0070682_100019819 3300005337 Bacteria 3950
10 Ga0070682_100042246 3300005337 Bacteria 2813
11 Ga0068868_100038305 3300005338 Bacteria 3721
12 Ga0070660_100008515 3300005339 Bacteria 7179
13 Ga0070660_100022105 3300005339 Bacteria 4699
14 Ga0070691_10027327 3300005341 Bacteria 2662
15 Ga0070714_100021353 3300005435 Bacteria 5298
16 Ga0070714_100130249 3300005435 Bacteria 2248
17 Ga0070714_100163274 3300005435 Bacteria 2017
18 Ga0070713_100045051 3300005436 Bacteria 3613
19 Ga0070713_100055254 3300005436 Bacteria 3298
20 Ga0070713_100190735 3300005436 Bacteria 1846
21 Ga0070710_10001590 3300005437 Bacteria 10722
22 Ga0070710_10020109 3300005437 Bacteria 3459
23 Ga0070711_100005385 3300005439 Bacteria 7655
24 Ga0070711_100009007 3300005439 Bacteria 6127
25 Ga0070711_100163962 3300005439 Bacteria 1687
26 Ga0070705_100055551 3300005440 Bacteria 2328
27 Ga0070700_100013906 3300005441 Bacteria 4531
28 Ga0070708_100020147 3300005445 Bacteria 5618
29 Ga0070708_100025940 3300005445 Bacteria 5012
30 Ga0070663_100018013 3300005455 Bacteria 4621
31 Ga0070678_100027748 3300005456 Bacteria 3849
32 Ga0070681_10046805 3300005458 Bacteria 4324
33 Ga0070706_100002089 3300005467 Bacteria 20346
34 Ga0070706_100054927 3300005467 Bacteria 3676
35 Ga0070706_100169990 3300005467 Bacteria 2035
36 Ga0070707_100000736 3300005468 Bacteria 32520
37 Ga0070707_100001273 3300005468 Bacteria 24807
38 Ga0070707_100018978 3300005468 Bacteria 6477
39 Ga0070707_100225462 3300005468 Bacteria 1825
40 Ga0070707_100296720 3300005468 Bacteria 1570
41 Ga0070698_100010276 3300005471 Bacteria 9999
42 Ga0070698_100016163 3300005471 Bacteria 7880
43 Ga0070698_100024678 3300005471 Bacteria 6271
44 Ga0070698_100088976 3300005471 Bacteria 3072
45 Ga0070698_100162872 3300005471 Bacteria 2174
46 Ga0070699_100028631 3300005518 Bacteria 4804
47 Ga0070699_100085700 3300005518 Bacteria 2749
48 Ga0070679_100086916 3300005530 Bacteria 3113
49 Ga0070679_100098170 3300005530 Bacteria 2917
50 Ga0070679_100161104 3300005530 Bacteria 2218
51 Ga0070679_100293685 3300005530 Bacteria 1576
52 Ga0070684_100021195 3300005535 Bacteria 5402
53 Ga0070684_100047821 3300005535 Bacteria 3709
54 Ga0070684_100151272 3300005535 Bacteria 2103
55 Ga0070684_100179417 3300005535 Bacteria 1925
56 Ga0070686_100041358 3300005544 Bacteria 2881
57 Ga0070686_100048181 3300005544 Bacteria 2699
58 Ga0070695_100000023 3300005545 Bacteria 60293
59 Ga0070696_100097446 3300005546 Bacteria 2103
60 Ga0068855_100039573 3300005563 Bacteria 5598
61 Ga0068855_100076760 3300005563 Bacteria 3876
62 Ga0068856_100004494 3300005614 Bacteria 13869
63 Ga0070702_100018393 3300005615 Bacteria 3626
64 Ga0068864_100058340 3300005618 Bacteria 3335
65 Ga0068861_100049503 3300005719 Bacteria 3182
66 Ga0081455_10027516 3300005937 Bacteria 5211
67 Ga0081538_10014854 3300005981 Bacteria 6068
68 Ga0081540_1001884 3300005983 Bacteria 17556
69 Ga0081539_10002903 3300005985 Bacteria 22670
70 Ga0070717_10003907 3300006028 Bacteria 10721
71 Ga0070717_10018851 3300006028 Bacteria 5397
72 Ga0070717_10022558 3300006028 Bacteria 4975
73 Ga0070717_10030392 3300006028 Bacteria 4340
74 Ga0070717_10040702 3300006028 Bacteria 3786
75 Ga0075432_10010379 3300006058 Bacteria 3159
76 Ga0070715_10007105 3300006163 Bacteria 3840
77 Ga0070712_100052940 3300006175 Bacteria 2833
78 Ga0075428_100200927 3300006844 Bacteria 2155
79 Ga0075433_10007908 3300006852 Bacteria 8457
80 Ga0075433_10020701 3300006852 Bacteria 5506
81 Ga0075433_10074172 3300006852 Bacteria 2994
82 Ga0075434_100013194 3300006871 Bacteria 7851
83 Ga0075434_100035968 3300006871 Bacteria 4897
84 Ga0075429_100052446 3300006880 Bacteria 3549
85 Ga0075436_100002736 3300006914 Bacteria 12126
86 Ga0075436_100041892 3300006914 Bacteria 3158
87 Ga0075436_100044442 3300006914 Bacteria 3063
88 Ga0075435_100000579 3300007076 Bacteria 22387
89 Ga0075435_100001676 3300007076 Bacteria 14382
90 Ga0075435_100036783 3300007076 Bacteria 3893
91 Ga0111539_10001928 3300009094 Bacteria 27646
92 Ga0111539_10219406 3300009094 Bacteria 2215
93 Ga0111539_10356086 3300009094 Bacteria 1703
94 Ga0105245_10005774 3300009098 Bacteria 10857
95 Ga0105245_10014739 3300009098 Bacteria 6808
96 Ga0105245_10085538 3300009098 Bacteria 2890
97 Ga0105245_10110840 3300009098 Bacteria 2552
98 Ga0105245_10159705 3300009098 Bacteria 2138
99 Ga0114129_10002630 3300009147 Bacteria 24990
100 Ga0114129_10044266 3300009147 Bacteria 6262
101 Ga0114129_10171551 3300009147 Bacteria 2957
102 Ga0114129_10179373 3300009147 Bacteria 2883
103 Ga0105242_10038235 3300009176 Bacteria 3859
104 Ga0105242_10087126 3300009176 Bacteria 2622
105 Ga0105237_10101443 3300009545 Bacteria 2870
106 Ga0157370_10005484 3300013104 Bacteria 14227
107 Ga0157370_10010689 3300013104 Bacteria 9656
108 Ga0157369_10008456 3300013105 Bacteria 11805
109 Ga0157369_10038348 3300013105 Bacteria 5240
110 Ga0157375_10003176 3300013308 Bacteria 14277
111 Ga0182008_10002973 3300014497 Bacteria 10433
112 Ga0157379_10071265 3300014968 Bacteria 3109
113 Ga0157376_10017745 3300014969 Bacteria 5438
114 Ga0182006_1043204 3300015261 Bacteria 1762
115 Ga0206354_10286303 3300020081 Bacteria 3867
116 Ga0206353_11257401 3300020082 Bacteria 17170
117 Ga0207653_10007342 3300025885 Bacteria 3435
118 Ga0207692_10018241 3300025898 Bacteria 3146
119 Ga0207699_10059306 3300025906 Bacteria 2293
120 Ga0207684_10004837 3300025910 Bacteria 12604
121 Ga0207684_10102878 3300025910 Bacteria 2442
122 Ga0207707_10100991 3300025912 Bacteria 2521
123 Ga0207707_10195325 3300025912 Bacteria 1765
124 Ga0207671_10068278 3300025914 Bacteria 2648
125 Ga0207693_10000198 3300025915 Bacteria 54576
126 Ga0207693_10007712 3300025915 Bacteria 8836
127 Ga0207693_10008363 3300025915 Bacteria 8468
128 Ga0207693_10009671 3300025915 Bacteria 7850
129 Ga0207693_10059093 3300025915 Bacteria 3003
130 Ga0207660_10041793 3300025917 Bacteria 3214
131 Ga0207657_10016396 3300025919 Bacteria 7147
132 Ga0207657_10024716 3300025919 Bacteria 5555
133 Ga0207652_10223975 3300025921 Bacteria 1695
134 Ga0207646_10002219 3300025922 Bacteria 23119
135 Ga0207646_10004655 3300025922 Bacteria 14797
136 Ga0207681_10126008 3300025923 Bacteria 1886
137 Ga0207687_10139227 3300025927 Bacteria 1839
138 Ga0207700_10038025 3300025928 Bacteria 3490
139 Ga0207700_10162115 3300025928 Bacteria 1858
140 Ga0207664_10005271 3300025929 Bacteria 8832
141 Ga0207664_10032010 3300025929 Bacteria 4028
142 Ga0207664_10037991 3300025929 Bacteria 3730
143 Ga0207706_10011285 3300025933 Bacteria 8142
144 Ga0207706_10178576 3300025933 Bacteria 1865
145 Ga0207665_10000197 3300025939 Bacteria 40246
146 Ga0207665_10005170 3300025939 Bacteria 8713
147 Ga0207691_10181656 3300025940 Bacteria 1838
148 Ga0207711_10135444 3300025941 Unclassified 2212
149 Ga0207661_10016534 3300025944 Bacteria 5445
150 Ga0207661_10017872 3300025944 Bacteria 5258
151 Ga0207661_10125382 3300025944 Bacteria 2192
152 Ga0207668_10029028 3300025972 Bacteria 3623
153 Ga0207678_10027462 3300026067 Bacteria 4965
154 Ga0207678_10220475 3300026067 Bacteria 1623
155 Ga0207708_10009298 3300026075 Bacteria 7276
156 Ga0207702_10006207 3300026078 Bacteria 10334
157 Ga0207648_10002132 3300026089 Bacteria 21520
158 Ga0207675_100004186 3300026118 Bacteria 13960
159 Ga0207675_100181309 3300026118 Bacteria 2016
160 Ga0207683_10029845 3300026121 Bacteria 4722
161 Ga0207683_10098762 3300026121 Bacteria 2605
162 Ga0207698_10150922 3300026142 Bacteria 2017
163 Ga0207428_10013176 3300027907 Bacteria 7239
164 Ga0265319_1001059 3300028563 Bacteria 17170
165 Ga0265334_10007596 3300028573 Bacteria 4645
166 Ga0265318_10001637 3300028577 Bacteria 12919
167 Ga0265318_10003407 3300028577 Bacteria 7986
168 Ga0265338_10004619 3300028800 Bacteria 18512
169 Ga0265338_10005076 3300028800 Bacteria 17375
170 Ga0265338_10125573 3300028800 Bacteria 2036
171 Ga0265330_10016974 3300031235 Bacteria 3356
172 Ga0265330_10047333 3300031235 Bacteria 1893
173 Ga0265328_10010907 3300031239 Bacteria 3647
174 Ga0265320_10017712 3300031240 Bacteria 3947
175 Ga0265320_10040777 3300031240 Bacteria 2312
176 Ga0265325_10018259 3300031241 Bacteria 3889
177 Ga0265325_10028698 3300031241 Bacteria 2996
178 Ga0265340_10059216 3300031247 Bacteria 1838
179 Ga0265339_10004983 3300031249 Bacteria 8940
180 Ga0265331_10023049 3300031250 Bacteria 3168
181 Ga0265327_10023772 3300031251 Bacteria 3618
182 Ga0265327_10025765 3300031251 Bacteria 3421
183 Ga0265316_10025321 3300031344 Bacteria 4953
184 Ga0265316_10053801 3300031344 Bacteria 3153
185 Ga0265313_10016189 3300031595 Bacteria 4298
186 Ga0265314_10005893 3300031711 Bacteria 10961
187 Ga0265342_10025222 3300031712 Bacteria 3741
188 Ga0265342_10038371 3300031712 Bacteria 2917
189 Ga0373926_0018619 3300035083 Bacteria 2390
190 Ga0373936_0043462 3300035113 Bacteria 1806
191 Ga0373941_0015705 3300035115 Bacteria 2047
192 Ga0373960_0016274 3300035121 Bacteria 1911
193 Ga0373943_0003173 3300035170 Bacteria 7463
194 Ga0373943_0013462 3300035170 Bacteria 3695
195 Ga0373943_0031502 3300035170 Bacteria 2516
196 Ga0373927_0028600 3300035695 Bacteria 3636
197 Ga0373947_0001279 3300035725 Bacteria 15509
198 Ga0373947_0010190 3300035725 Bacteria 5396
199 Ga0373947_0038701 3300035725 Bacteria 2835
200 Ga0373937_0060417 3300036401 Bacteria 3483
201 Ga0373925_0001456 3300037068 Bacteria 20442
202 Ga0395899_0004144 3300037312 Bacteria 11391
203 Ga0395899_0007114 3300037312 Bacteria 8657
204 Ga0395899_0028568 3300037312 Bacteria 4198
205 Ga0395899_0030874 3300037312 Bacteria 4028
206 Ga0395899_0044205 3300037312 Bacteria 3320
207 Ga0395899_0079820 3300037312 Bacteria 2383
208 Ga0395899_0149461 3300037312 Bacteria 1656
209 Ga0395900_0005056 3300037418 Bacteria 13836
210 Ga0395900_0008595 3300037418 Bacteria 10492
211 Ga0395900_0016527 3300037418 Bacteria 7527
212 Ga0395900_0024289 3300037418 Bacteria 6206
213 Ga0395900_0030925 3300037418 Bacteria 5498
214 Ga0395900_0043110 3300037418 Bacteria 4649
215 Ga0395900_0050166 3300037418 Bacteria 4299
216 Ga0395900_0054382 3300037418 Bacteria 4122
217 Ga0395900_0073531 3300037418 Bacteria 3515
218 Ga0395900_0126617 3300037418 Bacteria 2620
219 Ga0395900_0266910 3300037418 Bacteria 1707
220 Ga0395898_0006932 3300037466 Bacteria 12043
221 Ga0395898_0008878 3300037466 Bacteria 10587
222 Ga0395898_0010279 3300037466 Bacteria 9794
223 Ga0395898_0015998 3300037466 Bacteria 7684
224 Ga0395898_0019348 3300037466 Bacteria 6931
225 Ga0395898_0031845 3300037466 Bacteria 5267
226 Ga0395898_0041537 3300037466 Bacteria 4542
227 Ga0395898_0047572 3300037466 Bacteria 4209
228 Ga0395898_0177134 3300037466 Bacteria 2038
229 Ga0395898_0303662 3300037466 Bacteria 1522
230 Ga0395898_0351975 3300037466 Bacteria 1404
231 Ga0395905_0002930 3300037471 Bacteria 18574
232 Ga0395905_0006934 3300037471 Bacteria 11329
233 Ga0395905_0007022 3300037471 Bacteria 11255
234 Ga0395905_0011779 3300037471 Bacteria 8443
235 Ga0395905_0012413 3300037471 Bacteria 8200
236 Ga0395905_0022282 3300037471 Bacteria 5993
237 Ga0395905_0035578 3300037471 Bacteria 4677
238 Ga0395905_0069044 3300037471 Bacteria 3310
239 Ga0395901_0004146 3300038443 Bacteria 14623
240 Ga0395901_0009150 3300038443 Bacteria 10032
241 Ga0395901_0020678 3300038443 Bacteria 6737
242 Ga0395901_0026455 3300038443 Bacteria 5956
243 Ga0395901_0033046 3300038443 Bacteria 5338
244 Ga0395901_0034280 3300038443 Bacteria 5242
245 Ga0395901_0067732 3300038443 Bacteria 3718
246 Ga0395901_0075445 3300038443 Bacteria 3517
247 Ga0395901_0150034 3300038443 Bacteria 2450
248 Ga0395901_0175745 3300038443 Bacteria 2246
249 Ga0436360_1320551 3300039438 Bacteria 1929
250 Ga0439433_0003796 3300041999 Bacteria 3248
251 Ga0439441_003139 3300042001 Bacteria 2403
252 Ga0439446_0004144 3300042156 Bacteria 3655
253 Ga0466969_0001820 3300044656 Bacteria 11388
254 Ga0466961_0021458 3300044693 Bacteria 4156
255 Ga0466961_0059646 3300044693 Bacteria 2426
256 Ga0466961_0117836 3300044693 Bacteria 1668
257 Ga0466963_0000518 3300044694 Bacteria 18034
258 Ga0466963_0003462 3300044694 Bacteria 9043
259 Ga0466963_0009739 3300044694 Bacteria 5797
260 Ga0466963_0011497 3300044694 Bacteria 5391
261 Ga0466963_0012038 3300044694 Bacteria 5284
262 Ga0466963_0015702 3300044694 Bacteria 4696
263 Ga0466963_0016045 3300044694 Bacteria 4651
264 Ga0466963_0018541 3300044694 Bacteria 4353
265 Ga0466963_0052155 3300044694 Bacteria 2713
266 Ga0466963_0053911 3300044694 Bacteria 2671
267 Ga0466963_0059039 3300044694 Bacteria 2559
268 Ga0466963_0065364 3300044694 Bacteria 2438
269 Ga0466963_0163594 3300044694 Bacteria 1549
270 Ga0466964_0001008 3300044706 Bacteria 9347
271 Ga0466964_0003578 3300044706 Bacteria 5676
272 Ga0466964_0012047 3300044706 Bacteria 3271
273 Ga0466964_0044427 3300044706 Bacteria 1805
274 Ga0466971_0011727 3300044719 Bacteria 3839
275 Ga0466971_0047373 3300044719 Bacteria 1932
276 Ga0466968_0000984 3300044735 Bacteria 10030
277 Ga0466968_0003485 3300044735 Bacteria 5819
278 Ga0466968_0008612 3300044735 Bacteria 3910
279 Ga0466968_0036833 3300044735 Bacteria 2050
280 Ga0466968_0066912 3300044735 Bacteria 1557
281 Ga0466957_0005617 3300044842 Bacteria 7050
282 Ga0466957_0018705 3300044842 Bacteria 4070
283 Ga0466957_0023144 3300044842 Bacteria 3670
284 Ga0466957_0031556 3300044842 Bacteria 3167
285 Ga0466957_0102279 3300044842 Bacteria 1807
286 Ga0466959_0013448 3300045049 Bacteria 5931
287 Ga0466959_0031281 3300045049 Bacteria 3938
288 Ga0451576_0163520 3300045051 Bacteria 2323
289 Ga0466958_0001119 3300045836 Bacteria 12370
290 Ga0466958_0010910 3300045836 Bacteria 5103
291 Ga0466958_0011491 3300045836 Bacteria 4986
292 Ga0466958_0013018 3300045836 Bacteria 4726
293 Ga0466958_0023697 3300045836 Bacteria 3606
294 Ga0466958_0035521 3300045836 Bacteria 2978
295 Ga0466958_0075408 3300045836 Bacteria 2069
296 Ga0466967_0000215 3300045976 Bacteria 24572
297 Ga0466967_0002633 3300045976 Bacteria 11303
298 Ga0466967_0004694 3300045976 Bacteria 9282
299 Ga0466967_0008665 3300045976 Bacteria 7481
300 Ga0466967_0010632 3300045976 Bacteria 6915
301 Ga0466967_0011472 3300045976 Bacteria 6715
302 Ga0466967_0012538 3300045976 Bacteria 6490
303 Ga0466967_0021924 3300045976 Bacteria 5199
304 Ga0466967_0044730 3300045976 Bacteria 3842
305 Ga0466967_0052580 3300045976 Bacteria 3576
306 Ga0466967_0056012 3300045976 Bacteria 3475
307 Ga0466967_0114388 3300045976 Bacteria 2484
308 Ga0466967_0117806 3300045976 Bacteria 2449
309 Ga0466967_0129048 3300045976 Bacteria 2345
310 Ga0466967_0148982 3300045976 Bacteria 2185
311 Ga0466967_0168275 3300045976 Bacteria 2060
312 Ga0495592_0000597 3300046454 Bacteria 25448
313 Ga0495592_0003845 3300046454 Bacteria 10858
314 Ga0495592_0086273 3300046454 Bacteria 2261
315 Ga0495603_0000450 3300046455 Bacteria 22609
316 Ga0495629_0001473 3300046459 Bacteria 18571
317 Ga0495629_0007112 3300046459 Bacteria 8244
318 Ga0495629_0034375 3300046459 Bacteria 3584
319 Ga0495641_0001513 3300046461 Bacteria 19794
320 Ga0495641_0013562 3300046461 Bacteria 4466
321 Ga0495651_0000008 3300046462 Bacteria 156989
322 Ga0495651_0086787 3300046462 Bacteria 2353
323 Ga0495653_0000725 3300046463 Bacteria 25130
324 Ga0495653_0032755 3300046463 Bacteria 4124
325 Ga0495653_0052434 3300046463 Bacteria 3126
326 Ga0495653_0061380 3300046463 Bacteria 2845
327 Ga0495580_0006863 3300046472 Bacteria 9209
328 Ga0495580_0040667 3300046472 Bacteria 3320
329 Ga0495582_0000711 3300046473 Bacteria 18383
330 Ga0495582_0008066 3300046473 Bacteria 5812
331 Ga0495582_0052075 3300046473 Bacteria 2258
332 Ga0495639_0000520 3300046475 Bacteria 18060
333 Ga0495639_0024573 3300046475 Bacteria 2653
334 Ga0495664_0016797 3300046477 Bacteria 4176
335 Ga0495664_0053361 3300046477 Bacteria 2404
336 Ga0495664_0074459 3300046477 Bacteria 2031
337 Ga0495594_0001436 3300046499 Bacteria 12355
338 Ga0495594_0056014 3300046499 Bacteria 2175
339 Ga0495607_0023628 3300046501 Bacteria 3845
340 Ga0495608_0000957 3300046511 Bacteria 20357
341 Ga0495608_0074310 3300046511 Bacteria 2215
342 Ga0495608_0127465 3300046511 Bacteria 1630
343 Ga0495618_0002854 3300046514 Bacteria 10943
344 Ga0495618_0019968 3300046514 Bacteria 4123
345 Ga0495628_0000105 3300046516 Bacteria 68159
346 Ga0495628_0177868 3300046516 Bacteria 1611
347 Ga0495630_0001692 3300046517 Bacteria 15385
348 Ga0495630_0010267 3300046517 Bacteria 6756
349 Ga0495630_0068616 3300046517 Bacteria 2667
350 Ga0495666_0000272 3300046526 Bacteria 22361
351 Ga0495666_0011671 3300046526 Bacteria 4380
352 Ga0495652_0001221 3300046529 Bacteria 28813
353 Ga0495652_0008764 3300046529 Bacteria 9205
354 Ga0495652_0032894 3300046529 Bacteria 4532
355 Ga0495652_0185802 3300046529 Bacteria 1590
356 Ga0495665_0001436 3300046531 Bacteria 12777
357 Ga0495665_0039270 3300046531 Bacteria 2522
358 Ga0495640_0026292 3300046533 Bacteria 4207
359 Ga0495640_0158659 3300046533 Bacteria 1451
360 Ga0495586_0031982 3300046535 Bacteria 2820
361 Ga0495587_0000048 3300046536 Bacteria 105358
362 Ga0495645_0000029 3300046543 Bacteria 113119
363 Ga0495667_0044697 3300046559 Bacteria 2933
364 Ga0495667_0088446 3300046559 Bacteria 2008
365 Ga0495634_0021950 3300046642 Bacteria 4503
366 Ga0495634_0025274 3300046642 Bacteria 4158
367 Ga0495634_0045959 3300046642 Bacteria 2948
368 Ga0495635_0028500 3300046663 Bacteria 3882
369 Ga0495635_0057167 3300046663 Bacteria 2684
370 Ga0495635_0076700 3300046663 Bacteria 2290
371 Ga0495588_0000857 3300046674 Bacteria 13453
372 Ga0495657_0007940 3300046675 Bacteria 8137
373 Ga0495657_0047066 3300046675 Bacteria 2918
374 Ga0495599_0000110 3300046678 Bacteria 55240
375 Ga0495623_0000379 3300046679 Bacteria 29118
376 Ga0495623_0137413 3300046679 Unclassified 1457
377 Ga0495646_0002891 3300046680 Bacteria 10637
378 Ga0495646_0038682 3300046680 Bacteria 2944
379 Ga0495646_0061681 3300046680 Bacteria 2232
380 Ga0495647_0000245 3300046681 Bacteria 14888
381 Ga0495658_0000675 3300046683 Bacteria 18488
382 Ga0495658_0064418 3300046683 Bacteria 2112
383 Ga0495613_0006283 3300046689 Bacteria 8885
384 Ga0495613_0057824 3300046689 Bacteria 2847
385 Ga0495613_0079252 3300046689 Bacteria 2388
386 Ga0495624_0018866 3300046690 Bacteria 4609
387 Ga0495624_0044760 3300046690 Bacteria 2820
388 Ga0495624_0060654 3300046690 Bacteria 2371
389 Ga0495581_0019156 3300047315 Bacteria 3972
390 Ga0495604_0000687 3300047317 Bacteria 28670
391 Ga0495674_0026681 3300047319 Bacteria 5284
392 Ga0495676_0000602 3300047321 Bacteria 29783
393 Ga0495676_0019704 3300047321 Bacteria 5930
394 Ga0495680_0011528 3300047322 Bacteria 7819
395 Ga0495680_0053256 3300047322 Bacteria 3150
396 Ga0495675_0000419 3300047444 Bacteria 28791
397 Ga0495684_0013033 3300047471 Bacteria 6417
398 Ga0495684_0068032 3300047471 Bacteria 2708
399 Ga0495684_0135856 3300047471 Bacteria 1845
400 Ga0495593_0000863 3300047673 Bacteria 17564
401 Ga0495602_0001409 3300048088 Bacteria 23791
402 Ga0495602_0052498 3300048088 Bacteria 3620
403 Ga0495614_0000132 3300048089 Bacteria 26286
404 Ga0496100_0064186 3300048903 Bacteria 2429
405 Ga0496101_0111629 3300048904 Bacteria 2058
406 Ga0496102_0005223 3300048905 Bacteria 11027
407 Ga0496102_0031576 3300048905 Bacteria 4752
408 Ga0496102_0107343 3300048905 Bacteria 2599
409 Ga0496102_0120253 3300048905 Bacteria 2453
410 Ga0496102_0194329 3300048905 Bacteria 1912
411 Ga0496102_0203938 3300048905 Bacteria 1864
412 Ga0496103_0040604 3300048906 Bacteria 2859
413 Ga0496103_0044226 3300048906 Bacteria 2743
414 Ga0496104_0000977 3300048907 Bacteria 24462
415 Ga0496104_0001337 3300048907 Bacteria 21325
416 Ga0496104_0006401 3300048907 Bacteria 10356
417 Ga0496104_0027991 3300048907 Bacteria 5220
418 Ga0496104_0037468 3300048907 Bacteria 4535
419 Ga0496104_0074386 3300048907 Bacteria 3234
420 Ga0496104_0116472 3300048907 Bacteria 2564
421 Ga0496105_0002654 3300048908 Bacteria 13026
422 Ga0496105_0006474 3300048908 Bacteria 9001
423 Ga0496105_0027308 3300048908 Bacteria 4661
424 Ga0496105_0030208 3300048908 Bacteria 4440
425 Ga0496105_0055423 3300048908 Bacteria 3273
426 Ga0496105_0060729 3300048908 Bacteria 3119
427 Ga0496105_0068146 3300048908 Bacteria 2939
428 Ga0496105_0185920 3300048908 Bacteria 1700
429 Ga0496106_0016435 3300048909 Bacteria 5475
430 Ga0496106_0046647 3300048909 Bacteria 3258
431 Ga0496106_0071848 3300048909 Bacteria 2645
432 Ga0496107_0002059 3300048910 Bacteria 12861
433 Ga0496107_0145618 3300048910 Bacteria 1752
434 Ga0496108_0000272 3300048911 Bacteria 44414
435 Ga0496108_0000473 3300048911 Bacteria 32225
436 Ga0496108_0009090 3300048911 Bacteria 8046
437 Ga0496108_0014268 3300048911 Bacteria 6483
438 Ga0496108_0026913 3300048911 Bacteria 4746
439 Ga0496108_0031484 3300048911 Bacteria 4402
440 Ga0496108_0059181 3300048911 Bacteria 3221
441 Ga0496109_0000857 3300048912 Bacteria 25402
442 Ga0496109_0001789 3300048912 Bacteria 17869
443 Ga0496109_0001891 3300048912 Bacteria 17380
444 Ga0496109_0007450 3300048912 Bacteria 9265
445 Ga0496109_0045880 3300048912 Bacteria 3967
446 Ga0496109_0063963 3300048912 Bacteria 3365
447 Ga0496109_0214523 3300048912 Bacteria 1810
448 Ga0496110_0001277 3300048913 Bacteria 18022
449 Ga0496110_0001545 3300048913 Bacteria 16749
450 Ga0496110_0019310 3300048913 Bacteria 5733
451 Ga0496110_0111175 3300048913 Bacteria 2462
452 Ga0496110_0182078 3300048913 Unclassified 1908
453 Ga0496110_0246090 3300048913 Bacteria 1627
454 Ga0496111_0001182 3300048914 Bacteria 14531
455 Ga0496111_0002257 3300048914 Bacteria 11581
456 Ga0496111_0005116 3300048914 Bacteria 8350
457 Ga0496111_0013548 3300048914 Bacteria 5554
458 Ga0496111_0075944 3300048914 Bacteria 2449
459 Ga0496111_0118303 3300048914 Bacteria 1956
460 Ga0496112_0001515 3300048915 Bacteria 17883
461 Ga0496112_0013792 3300048915 Bacteria 7475
462 Ga0496112_0014155 3300048915 Bacteria 7390
463 Ga0496112_0026349 3300048915 Bacteria 5591
464 Ga0496112_0077189 3300048915 Bacteria 3294
465 Ga0496112_0096162 3300048915 Bacteria 2932
466 Ga0496112_0112909 3300048915 Bacteria 2688
467 Ga0496113_0000040 3300048916 Bacteria 55517
468 Ga0496113_0025600 3300048916 Bacteria 4208
469 Ga0496113_0078575 3300048916 Bacteria 2525
470 Ga0496113_0089839 3300048916 Unclassified 2365
471 Ga0496113_0102117 3300048916 Bacteria 2223
472 Ga0496113_0166368 3300048916 Bacteria 1745
473 Ga0496114_0019761 3300048917 Bacteria 5460
474 Ga0496114_0024418 3300048917 Bacteria 4934
475 Ga0496114_0041623 3300048917 Bacteria 3808
476 Ga0496114_0163796 3300048917 Bacteria 1935
477 Ga0496115_0003551 3300048918 Bacteria 11223
478 Ga0496115_0031760 3300048918 Bacteria 4163
479 Ga0496115_0049895 3300048918 Bacteria 3351
480 Ga0496115_0068958 3300048918 Bacteria 2863
481 Ga0501031_0005441 3300049568 Bacteria 8289
482 Ga0501031_0054773 3300049568 Bacteria 2598
483 Ga0501032_0033753 3300049569 Bacteria 3506
484 Ga0501033_0042923 3300049570 Bacteria 3370
485 Ga0501034_0047696 3300049571 Bacteria 4324
486 Ga0501036_0004334 3300049572 Bacteria 11454
487 Ga0501038_0079630 3300049574 Bacteria 2762
488 Ga0501039_0001308 3300049575 Bacteria 18206
489 Ga0501039_0066739 3300049575 Bacteria 2793
490 Ga0501040_0020791 3300049576 Bacteria 4376
491 Ga0501040_0025343 3300049576 Bacteria 3987
492 Ga0501040_0101227 3300049576 Bacteria 2010
493 Ga0501041_0003653 3300049577 Bacteria 8853
494 Ga0501042_0003274 3300049578 Bacteria 10134
495 Ga0501046_0054257 3300049580 Bacteria 3154
496 Ga0501048_0047132 3300049582 Bacteria 3075
497 Ga0501067_0002463 3300049583 Bacteria 10212
498 Ga0501067_0023056 3300049583 Bacteria 3448
499 Ga0501068_0007776 3300049584 Bacteria 5938
500 Ga0501069_0081322 3300049585 Bacteria 1825
501 Ga0501070_0005438 3300049586 Bacteria 10873
502 Ga0501070_0007027 3300049586 Bacteria 9576
503 Ga0501070_0011769 3300049586 Bacteria 7390
504 Ga0501070_0106192 3300049586 Bacteria 2321
505 Ga0501071_0004653 3300049587 Bacteria 8718
506 Ga0501072_0007897 3300049588 Bacteria 8079
507 Ga0501074_0014194 3300049590 Bacteria 5794
508 Ga0501074_0022361 3300049590 Bacteria 4593
509 Ga0501075_0024524 3300049591 Bacteria 4424
510 Ga0501077_0013661 3300049593 Bacteria 5089
511 Ga0501077_0041231 3300049593 Bacteria 2940
512 Ga0501079_0003331 3300049741 Bacteria 11787
513 Ga0501079_0167427 3300049741 Bacteria 1714
514 Ga0501080_0119901 3300049742 Bacteria 2438
515 Ga0501080_0252351 3300049742 Bacteria 1608
516 Ga0501083_0005190 3300049744 Bacteria 9216
517 Ga0501035_0076668 3300049822 Bacteria 2956
518 Ga0501045_0001410 3300049824 Bacteria 16040
519 Ga0501045_0003106 3300049824 Bacteria 11356
520 nmdc:mga05p37_20642_c1 3300050507 Bacteria 7970
521 nmdc:mga05p37_2406_c1 3300050507 Bacteria 21776
522 nmdc:mga05p37_73426_c1 3300050507 Bacteria 4210
523 nmdc:mga08y16_186314_c1 3300050511 Bacteria 2153
524 nmdc:mga08y16_249655_c1 3300050511 Bacteria 1834
525 nmdc:mga08y16_46181_c1 3300050511 Bacteria 4560
526 nmdc:mga0n895_66523_c1 3300050512 Bacteria 3569
527 nmdc:mga0rr50_172478_c1 3300050513 Bacteria 1764
528 nmdc:mga0rr50_19021_c1 3300050513 Bacteria 4626
529 nmdc:mga0a205_117780_c1 3300050515 Bacteria 2554
530 nmdc:mga0a205_148100_c1 3300050515 Bacteria 2248
531 nmdc:mga0a205_5953_c1 3300050515 Bacteria 10994
532 Ga0495601_0000340 3300053077 Bacteria 24567
533 Ga0495601_0020585 3300053077 Bacteria 4030
534 Ga0495601_0040461 3300053077 Bacteria 2918
535 Ga0495601_0043183 3300053077 Bacteria 2831
536 Ga0495601_0098497 3300053077 Bacteria 1887
537 Ga0495612_0021355 3300053078 Bacteria 2597
538 Ga0495612_0037794 3300053078 Bacteria 1961
539 Ga0495612_0051693 3300053078 Bacteria 1689
540 Ga0495595_0001185 3300053084 Bacteria 10134
541 Ga0495595_0021365 3300053084 Bacteria 2827
542 Ga0495595_0057566 3300053084 Bacteria 1813
543 Ga0495619_0001752 3300053085 Bacteria 14426
544 Ga0495619_0049831 3300053085 Bacteria 2763
545 Ga0495619_0080627 3300053085 Bacteria 2190
546 Ga0495619_0088496 3300053085 Bacteria 2094
547 Ga0500566_0098407 3300053094 Bacteria 1607
548 Ga0501084_0027489 3300054114 Bacteria 4752
549 Ga0501084_0079059 3300054114 Bacteria 2756
550 Ga0466962_0001837 3300061719 Bacteria 9996
551 Ga0466962_0009133 3300061719 Bacteria 4748
552 Ga0466962_0019961 3300061719 Bacteria 3221
553 Ga0530510_0005142 3300061734 Bacteria 9027
554 Ga0496112_0044365
555 Ga0070658_10147574
556 Ga0070683_100002787
557 Ga0070683_100092238
558 Ga0070690_100103245
559 Ga0070680_100026368
560 Ga0070680_100097872
561 Ga0070680_100243614
562 Ga0070682_100019819
563 Ga0070682_100042246
564 Ga0068868_100038305
565 Ga0070660_100008515
566 Ga0070660_100022105
567 Ga0070691_10027327
568 Ga0070714_100021353
569 Ga0070714_100130249
570 Ga0070714_100163274
571 Ga0070713_100045051
572 Ga0070713_100055254
573 Ga0070713_100190735
574 Ga0070710_10001590
575 Ga0070710_10020109
576 Ga0070711_100005385
577 Ga0070711_100009007
578 Ga0070711_100163962
579 Ga0070705_100055551
580 Ga0070700_100013906
581 Ga0070708_100020147
582 Ga0070708_100025940
583 Ga0070663_100018013
584 Ga0070678_100027748
585 Ga0070681_10046805
586 Ga0070706_100002089
587 Ga0070706_100054927
588 Ga0070706_100169990
589 Ga0070707_100000736
590 Ga0070707_100001273
591 Ga0070707_100018978
592 Ga0070707_100225462
593 Ga0070707_100296720
594 Ga0070698_100010276
595 Ga0070698_100016163
596 Ga0070698_100024678
597 Ga0070698_100088976
598 Ga0070698_100162872
599 Ga0070699_100028631
600 Ga0070699_100085700
601 Ga0070679_100086916
602 Ga0070679_100098170
603 Ga0070679_100161104
604 Ga0070679_100293685
605 Ga0070684_100021195
606 Ga0070684_100047821
607 Ga0070684_100151272
608 Ga0070684_100179417
609 Ga0070686_100041358
610 Ga0070686_100048181
611 Ga0070695_100000023
612 Ga0070696_100097446
613 Ga0068855_100039573
614 Ga0068855_100076760
615 Ga0068856_100004494
616 Ga0070702_100018393
617 Ga0068864_100058340
618 Ga0068861_100049503
619 Ga0081455_10027516
620 Ga0081538_10014854
621 Ga0081540_1001884
622 Ga0081539_10002903
623 Ga0070717_10003907
624 Ga0070717_10018851
625 Ga0070717_10022558
626 Ga0070717_10030392
627 Ga0070717_10040702
628 Ga0075432_10010379
629 Ga0070715_10007105
630 Ga0070712_100052940
631 Ga0075428_100200927
632 Ga0075433_10007908
633 Ga0075433_10020701
634 Ga0075433_10074172
635 Ga0075434_100013194
636 Ga0075434_100035968
637 Ga0075429_100052446
638 Ga0075436_100002736
639 Ga0075436_100041892
640 Ga0075436_100044442
641 Ga0075435_100000579
642 Ga0075435_100001676
643 Ga0075435_100036783
644 Ga0111539_10001928
645 Ga0111539_10219406
646 Ga0111539_10356086
647 Ga0105245_10005774
648 Ga0105245_10014739
649 Ga0105245_10085538
650 Ga0105245_10110840
651 Ga0105245_10159705
652 Ga0114129_10002630
653 Ga0114129_10044266
654 Ga0114129_10171551
655 Ga0114129_10179373
656 Ga0105242_10038235
657 Ga0105242_10087126
658 Ga0105237_10101443
659 Ga0157370_10005484
660 Ga0157370_10010689
661 Ga0157369_10008456
662 Ga0157369_10038348
663 Ga0157375_10003176
664 Ga0182008_10002973
665 Ga0157379_10071265
666 Ga0157376_10017745
667 Ga0182006_1043204
668 Ga0206354_10286303
669 Ga0206353_11257401
670 Ga0207653_10007342
671 Ga0207692_10018241
672 Ga0207699_10059306
673 Ga0207684_10004837
674 Ga0207684_10102878
675 Ga0207707_10100991
676 Ga0207707_10195325
677 Ga0207671_10068278
678 Ga0207693_10000198
679 Ga0207693_10007712
680 Ga0207693_10008363
681 Ga0207693_10009671
682 Ga0207693_10059093
683 Ga0207660_10041793
684 Ga0207657_10016396
685 Ga0207657_10024716
686 Ga0207652_10223975
687 Ga0207646_10002219
688 Ga0207646_10004655
689 Ga0207681_10126008
690 Ga0207687_10139227
691 Ga0207700_10038025
692 Ga0207700_10162115
693 Ga0207664_10005271
694 Ga0207664_10032010
695 Ga0207664_10037991
696 Ga0207706_10011285
697 Ga0207706_10178576
698 Ga0207665_10000197
699 Ga0207665_10005170
700 Ga0207691_10181656
701 Ga0207711_10135444
702 Ga0207661_10016534
703 Ga0207661_10017872
704 Ga0207661_10125382
705 Ga0207668_10029028
706 Ga0207678_10027462
707 Ga0207678_10220475
708 Ga0207708_10009298
709 Ga0207702_10006207
710 Ga0207648_10002132
711 Ga0207675_100004186
712 Ga0207675_100181309
713 Ga0207683_10029845
714 Ga0207683_10098762
715 Ga0207698_10150922
716 Ga0207428_10013176
717 Ga0265319_1001059
718 Ga0265334_10007596
719 Ga0265318_10001637
720 Ga0265318_10003407
721 Ga0265338_10004619
722 Ga0265338_10005076
723 Ga0265338_10125573
724 Ga0265330_10016974
725 Ga0265330_10047333
726 Ga0265328_10010907
727 Ga0265320_10017712
728 Ga0265320_10040777
729 Ga0265325_10018259
730 Ga0265325_10028698
731 Ga0265340_10059216
732 Ga0265339_10004983
733 Ga0265331_10023049
734 Ga0265327_10023772
735 Ga0265327_10025765
736 Ga0265316_10025321
737 Ga0265316_10053801
738 Ga0265313_10016189
739 Ga0265314_10005893
740 Ga0265342_10025222
741 Ga0265342_10038371
742 Ga0373926_0018619
743 Ga0373936_0043462
744 Ga0373941_0015705
745 Ga0373960_0016274
746 Ga0373943_0003173
747 Ga0373943_0013462
748 Ga0373943_0031502
749 Ga0373927_0028600
750 Ga0373947_0001279
751 Ga0373947_0010190
752 Ga0373947_0038701
753 Ga0373937_0060417
754 Ga0373925_0001456
755 Ga0395899_0004144
756 Ga0395899_0007114
757 Ga0395899_0028568
758 Ga0395899_0030874
759 Ga0395899_0044205
760 Ga0395899_0079820
761 Ga0395899_0149461
762 Ga0395900_0005056
763 Ga0395900_0008595
764 Ga0395900_0016527
765 Ga0395900_0024289
766 Ga0395900_0030925
767 Ga0395900_0043110
768 Ga0395900_0050166
769 Ga0395900_0054382
770 Ga0395900_0073531
771 Ga0395900_0126617
772 Ga0395900_0266910
773 Ga0395898_0006932
774 Ga0395898_0008878
775 Ga0395898_0010279
776 Ga0395898_0015998
777 Ga0395898_0019348
778 Ga0395898_0031845
779 Ga0395898_0041537
780 Ga0395898_0047572
781 Ga0395898_0177134
782 Ga0395898_0303662
783 Ga0395898_0351975
784 Ga0395905_0002930
785 Ga0395905_0006934
786 Ga0395905_0007022
787 Ga0395905_0011779
788 Ga0395905_0012413
789 Ga0395905_0022282
790 Ga0395905_0035578
791 Ga0395905_0069044
792 Ga0395901_0004146
793 Ga0395901_0009150
794 Ga0395901_0020678
795 Ga0395901_0026455
796 Ga0395901_0033046
797 Ga0395901_0034280
798 Ga0395901_0067732
799 Ga0395901_0075445
800 Ga0395901_0150034
801 Ga0395901_0175745
802 Ga0436360_1320551
803 Ga0439433_0003796
804 Ga0439441_003139
805 Ga0439446_0004144
806 Ga0466969_0001820
807 Ga0466961_0021458
808 Ga0466961_0059646
809 Ga0466961_0117836
810 Ga0466963_0000518
811 Ga0466963_0003462
812 Ga0466963_0009739
813 Ga0466963_0011497
814 Ga0466963_0012038
815 Ga0466963_0015702
816 Ga0466963_0016045
817 Ga0466963_0018541
818 Ga0466963_0052155
819 Ga0466963_0053911
820 Ga0466963_0059039
821 Ga0466963_0065364
822 Ga0466963_0163594
823 Ga0466964_0001008
824 Ga0466964_0003578
825 Ga0466964_0012047
826 Ga0466964_0044427
827 Ga0466971_0011727
828 Ga0466971_0047373
829 Ga0466968_0000984
830 Ga0466968_0003485
831 Ga0466968_0008612
832 Ga0466968_0036833
833 Ga0466968_0066912
834 Ga0466957_0005617
835 Ga0466957_0018705
836 Ga0466957_0023144
837 Ga0466957_0031556
838 Ga0466957_0102279
839 Ga0466959_0013448
840 Ga0466959_0031281
841 Ga0451576_0163520
842 Ga0466958_0001119
843 Ga0466958_0010910
844 Ga0466958_0011491
845 Ga0466958_0013018
846 Ga0466958_0023697
847 Ga0466958_0035521
848 Ga0466958_0075408
849 Ga0466967_0000215
850 Ga0466967_0002633
851 Ga0466967_0004694
852 Ga0466967_0008665
853 Ga0466967_0010632
854 Ga0466967_0011472
855 Ga0466967_0012538
856 Ga0466967_0021924
857 Ga0466967_0044730
858 Ga0466967_0052580
859 Ga0466967_0056012
860 Ga0466967_0114388
861 Ga0466967_0117806
862 Ga0466967_0129048
863 Ga0466967_0148982
864 Ga0466967_0168275
865 Ga0495592_0000597
866 Ga0495592_0003845
867 Ga0495592_0086273
868 Ga0495603_0000450
869 Ga0495629_0001473
870 Ga0495629_0007112
871 Ga0495629_0034375
872 Ga0495641_0001513
873 Ga0495641_0013562
874 Ga0495651_0000008
875 Ga0495651_0086787
876 Ga0495653_0000725
877 Ga0495653_0032755
878 Ga0495653_0052434
879 Ga0495653_0061380
880 Ga0495580_0006863
881 Ga0495580_0040667
882 Ga0495582_0000711
883 Ga0495582_0008066
884 Ga0495582_0052075
885 Ga0495639_0000520
886 Ga0495639_0024573
887 Ga0495664_0016797
888 Ga0495664_0053361
889 Ga0495664_0074459
890 Ga0495594_0001436
891 Ga0495594_0056014
892 Ga0495607_0023628
893 Ga0495608_0000957
894 Ga0495608_0074310
895 Ga0495608_0127465
896 Ga0495618_0002854
897 Ga0495618_0019968
898 Ga0495628_0000105
899 Ga0495628_0177868
900 Ga0495630_0001692
901 Ga0495630_0010267
902 Ga0495630_0068616
903 Ga0495666_0000272
904 Ga0495666_0011671
905 Ga0495652_0001221
906 Ga0495652_0008764
907 Ga0495652_0032894
908 Ga0495652_0185802
909 Ga0495665_0001436
910 Ga0495665_0039270
911 Ga0495640_0026292
912 Ga0495640_0158659
913 Ga0495586_0031982
914 Ga0495587_0000048
915 Ga0495645_0000029
916 Ga0495667_0044697
917 Ga0495667_0088446
918 Ga0495634_0021950
919 Ga0495634_0025274
920 Ga0495634_0045959
921 Ga0495635_0028500
922 Ga0495635_0057167
923 Ga0495635_0076700
924 Ga0495588_0000857
925 Ga0495657_0007940
926 Ga0495657_0047066
927 Ga0495599_0000110
928 Ga0495623_0000379
929 Ga0495623_0137413
930 Ga0495646_0002891
931 Ga0495646_0038682
932 Ga0495646_0061681
933 Ga0495647_0000245
934 Ga0495658_0000675
935 Ga0495658_0064418
936 Ga0495613_0006283
937 Ga0495613_0057824
938 Ga0495613_0079252
939 Ga0495624_0018866
940 Ga0495624_0044760
941 Ga0495624_0060654
942 Ga0495581_0019156
943 Ga0495604_0000687
944 Ga0495674_0026681
945 Ga0495676_0000602
946 Ga0495676_0019704
947 Ga0495680_0011528
948 Ga0495680_0053256
949 Ga0495675_0000419
950 Ga0495684_0013033
951 Ga0495684_0068032
952 Ga0495684_0135856
953 Ga0495593_0000863
954 Ga0495602_0001409
955 Ga0495602_0052498
956 Ga0495614_0000132
957 Ga0496100_0064186
958 Ga0496101_0111629
959 Ga0496102_0005223
960 Ga0496102_0031576
961 Ga0496102_0107343
962 Ga0496102_0120253
963 Ga0496102_0194329
964 Ga0496102_0203938
965 Ga0496103_0040604
966 Ga0496103_0044226
967 Ga0496104_0000977
968 Ga0496104_0001337
969 Ga0496104_0006401
970 Ga0496104_0027991
971 Ga0496104_0037468
972 Ga0496104_0074386
973 Ga0496104_0116472
974 Ga0496105_0002654
975 Ga0496105_0006474
976 Ga0496105_0027308
977 Ga0496105_0030208
978 Ga0496105_0055423
979 Ga0496105_0060729
980 Ga0496105_0068146
981 Ga0496105_0185920
982 Ga0496106_0016435
983 Ga0496106_0046647
984 Ga0496106_0071848
985 Ga0496107_0002059
986 Ga0496107_0145618
987 Ga0496108_0000272
988 Ga0496108_0000473
989 Ga0496108_0009090
990 Ga0496108_0014268
991 Ga0496108_0026913
992 Ga0496108_0031484
993 Ga0496108_0059181
994 Ga0496109_0000857
995 Ga0496109_0001789
996 Ga0496109_0001891
997 Ga0496109_0007450
998 Ga0496109_0045880
999 Ga0496109_0063963
1000 Ga0496109_0214523
1001 Ga0496110_0001277
1002 Ga0496110_0001545
1003 Ga0496110_0019310
1004 Ga0496110_0111175
1005 Ga0496110_0182078
1006 Ga0496110_0246090
1007 Ga0496111_0001182
1008 Ga0496111_0002257
1009 Ga0496111_0005116
1010 Ga0496111_0013548
1011 Ga0496111_0075944
1012 Ga0496111_0118303
1013 Ga0496112_0001515
1014 Ga0496112_0013792
1015 Ga0496112_0014155
1016 Ga0496112_0026349
1017 Ga0496112_0077189
1018 Ga0496112_0096162
1019 Ga0496112_0112909
1020 Ga0496113_0000040
1021 Ga0496113_0025600
1022 Ga0496113_0078575
1023 Ga0496113_0089839
1024 Ga0496113_0102117
1025 Ga0496113_0166368
1026 Ga0496114_0019761
1027 Ga0496114_0024418
1028 Ga0496114_0041623
1029 Ga0496114_0163796
1030 Ga0496115_0003551
1031 Ga0496115_0031760
1032 Ga0496115_0049895
1033 Ga0496115_0068958
1034 Ga0501031_0005441
1035 Ga0501031_0054773
1036 Ga0501032_0033753
1037 Ga0501033_0042923
1038 Ga0501034_0047696
1039 Ga0501036_0004334
1040 Ga0501038_0079630
1041 Ga0501039_0001308
1042 Ga0501039_0066739
1043 Ga0501040_0020791
1044 Ga0501040_0025343
1045 Ga0501040_0101227
1046 Ga0501041_0003653
1047 Ga0501042_0003274
1048 Ga0501046_0054257
1049 Ga0501048_0047132
1050 Ga0501067_0002463
1051 Ga0501067_0023056
1052 Ga0501068_0007776
1053 Ga0501069_0081322
1054 Ga0501070_0005438
1055 Ga0501070_0007027
1056 Ga0501070_0011769
1057 Ga0501070_0106192
1058 Ga0501071_0004653
1059 Ga0501072_0007897
1060 Ga0501074_0014194
1061 Ga0501074_0022361
1062 Ga0501075_0024524
1063 Ga0501077_0013661
1064 Ga0501077_0041231
1065 Ga0501079_0003331
1066 Ga0501079_0167427
1067 Ga0501080_0119901
1068 Ga0501080_0252351
1069 Ga0501083_0005190
1070 Ga0501035_0076668
1071 Ga0501045_0001410
1072 Ga0501045_0003106
1073 nmdc:mga05p37_20642_c1
1074 nmdc:mga05p37_2406_c1
1075 nmdc:mga05p37_73426_c1
1076 nmdc:mga08y16_186314_c1
1077 nmdc:mga08y16_249655_c1
1078 nmdc:mga08y16_46181_c1
1079 nmdc:mga0n895_66523_c1
1080 nmdc:mga0rr50_172478_c1
1081 nmdc:mga0rr50_19021_c1
1082 nmdc:mga0a205_117780_c1
1083 nmdc:mga0a205_148100_c1
1084 nmdc:mga0a205_5953_c1
1085 Ga0495601_0000340
1086 Ga0495601_0020585
1087 Ga0495601_0040461
1088 Ga0495601_0043183
1089 Ga0495601_0098497
1090 Ga0495612_0021355
1091 Ga0495612_0037794
1092 Ga0495612_0051693
1093 Ga0495595_0001185
1094 Ga0495595_0021365
1095 Ga0495595_0057566
1096 Ga0495619_0001752
1097 Ga0495619_0049831
1098 Ga0495619_0080627
1099 Ga0495619_0088496
1100 Ga0500566_0098407
1101 Ga0501084_0027489
1102 Ga0501084_0079059
1103 Ga0466962_0001837
1104 Ga0466962_0009133
1105 Ga0466962_0019961
1106 Ga0530510_0005142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01202

SKI

Shikimate kinase

24

169

0.95

PF01761

DHQ_synthase

3-dehydroquinate synthase

218

329

0.95

PF24621

330

452

0.94

PF13685

Fe-ADH_2

Iron-containing alcohol dehydrogenase

172

323

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zok-assembly2.cif.gz_C structure of 3-dehydroquinate synthase from actinidia chinensis in complex with nad 0.9148 132 442
6hqv-assembly1.cif.gz_A pentafunctional arom complex from chaetomium thermophilum 0.8987 131 431
1xai-assembly2.cif.gz_B crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, nad+ and carbaphosphonate 0.8973 132 441
6hqv-assembly1.cif.gz_B pentafunctional arom complex from chaetomium thermophilum 0.8864 131 431
1nvd-assembly1.cif.gz_A crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate 0.8858 131 438
ID Description Score Start End Superfamily
af_A0A0R0HLZ4_60_246_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9309 132 282 3.40.50.1970
5hvnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.916 132 282 3.40.50.1970
1xahB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.912 132 282 3.40.50.1970
3qbdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9089 132 282 3.40.50.1970
af_P08566_1_177_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.902 132 282 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A1Y1MIS5-F1-model_v4 3-dehydroquinate synthase domain-containing protein 0.9868 182 276 GO:0003856
GO:0009073
AF-A0A7S1KI02-F1-model_v4 3-dehydroquinate synthase domain-containing protein 0.9791 190 300 GO:0003856
GO:0009073
GO:0016020
AF-A0A3N4IYI6-F1-model_v4 Dehydroquinate synthase-like protein 0.9714 184 302 GO:0003856
GO:0009073
AF-A0A2X1PI66-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9578 200 299 GO:0003856
GO:0009073
AF-A0A3B9DMR7-F1-model_v4 3-dehydroquinate synthase 0.956 132 299 GO:0003856
GO:0009073

Map