F462953

General Info

Members Datasets Scaffolds Average Seq Length
554 198 1108 228

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100406710|Ga0070675_1004067101
Length 256
Sequence MAPGRALRQNDSKGTTGMKTPFLGALALAALAWTAPADAQQASITQTIAGTRLDVTATGEVTRVPDVAIISAGVVSRAPTATAALQDSANRMGQVLAALKRAGVEDRDIQTSNVSLNPEYRYVENQPPQLVGYTASNTVTVRFRDVRNSGKILDALVAQGSNQINGPTLSVDKPESALDEARNKAIAIGRARAELYARSLGLRVVRVVSVNESGGSYPVPPPMPMYARADMAQAKTSIEPGEQKLQVNLAMTFELQ

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
183 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
184 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
189 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
190 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 4.15
Rhizosphere 94.04
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100406710 3300005354 Bacteria 1215
2 JGI24740J21852_10027473 3300001979 Bacteria 1893
3 JGI24739J22299_10009989 3300001989 Bacteria 3528
4 JGI24737J22298_10000256 3300001990 Bacteria 17649
5 JGI24737J22298_10033148 3300001990 Bacteria 1606
6 JGI24737J22298_10037377 3300001990 Bacteria 1497
7 JGI24743J22301_10028966 3300001991 Bacteria 1085
8 JGI24738J21930_10002409 3300002075 Bacteria 4899
9 rootH2_10255869 3300003320 Bacteria 1506
10 Ga0070658_10000117 3300005327 Bacteria 71263
11 Ga0070658_10052786 3300005327 Bacteria 3298
12 Ga0070676_10011013 3300005328 Bacteria 4914
13 Ga0070676_10023528 3300005328 Bacteria 3463
14 Ga0070670_100012210 3300005331 Bacteria 7346
15 Ga0070670_100033493 3300005331 Bacteria 4424
16 Ga0070670_100056804 3300005331 Bacteria 3360
17 Ga0070670_100106430 3300005331 Bacteria 2417
18 Ga0070666_10026669 3300005335 Bacteria 3778
19 Ga0068868_100000162 3300005338 Bacteria 43570
20 Ga0068868_100015735 3300005338 Bacteria 5603
21 Ga0070660_100000530 3300005339 Bacteria 25464
22 Ga0070660_100001623 3300005339 Bacteria 15463
23 Ga0070660_100014349 3300005339 Bacteria 5704
24 Ga0070660_100026115 3300005339 Bacteria 4347
25 Ga0070660_100040861 3300005339 Bacteria 3532
26 Ga0070660_100275997 3300005339 Bacteria 1375
27 Ga0070660_100484157 3300005339 Bacteria 1028
28 Ga0070661_100000079 3300005344 Bacteria 77180
29 Ga0070661_100009904 3300005344 Bacteria 6611
30 Ga0070661_100385882 3300005344 Bacteria 1105
31 Ga0070661_100570173 3300005344 Bacteria 913
32 Ga0070692_10008314 3300005345 Bacteria 4624
33 Ga0070668_100001009 3300005347 Bacteria 19720
34 Ga0070668_100002740 3300005347 Bacteria 12969
35 Ga0070668_100071947 3300005347 Bacteria 2694
36 Ga0070668_100190974 3300005347 Bacteria 1677
37 Ga0070668_100485138 3300005347 Bacteria 1068
38 Ga0070668_100486860 3300005347 Unclassified 1066
39 Ga0070669_100001654 3300005353 Bacteria 16124
40 Ga0070669_100009212 3300005353 Bacteria 7036
41 Ga0070669_100056458 3300005353 Bacteria 2879
42 Ga0070669_100098144 3300005353 Bacteria 2206
43 Ga0070669_100376135 3300005353 Bacteria 1158
44 Ga0070675_100022837 3300005354 Bacteria 4998
45 Ga0070675_100026972 3300005354 Bacteria 4613
46 Ga0070675_100266017 3300005354 Bacteria 1503
47 Ga0070671_100003139 3300005355 Bacteria 12874
48 Ga0070671_100052141 3300005355 Bacteria 3402
49 Ga0070671_100159000 3300005355 Bacteria 1910
50 Ga0070671_100159090 3300005355 Bacteria 1909
51 Ga0070671_100401022 3300005355 Bacteria 1173
52 Ga0070674_100002759 3300005356 Bacteria 9710
53 Ga0070674_100004206 3300005356 Bacteria 8177
54 Ga0070674_100035066 3300005356 Bacteria 3357
55 Ga0070673_100006081 3300005364 Bacteria 7820
56 Ga0070673_100006764 3300005364 Bacteria 7482
57 Ga0070673_100018247 3300005364 Bacteria 5009
58 Ga0070673_100027595 3300005364 Bacteria 4210
59 Ga0070673_100073244 3300005364 Bacteria 2757
60 Ga0070673_100292353 3300005364 Bacteria 1432
61 Ga0070659_100000022 3300005366 Bacteria 154091
62 Ga0070659_100000165 3300005366 Bacteria 51041
63 Ga0070659_100006492 3300005366 Bacteria 8441
64 Ga0070659_100012310 3300005366 Bacteria 6340
65 Ga0070659_100031373 3300005366 Bacteria 4115
66 Ga0070659_100035346 3300005366 Bacteria 3891
67 Ga0070659_100056110 3300005366 Bacteria 3105
68 Ga0070659_100058704 3300005366 Bacteria 3037
69 Ga0070659_100079764 3300005366 Bacteria 2613
70 Ga0070659_100154391 3300005366 Bacteria 1874
71 Ga0070667_100008550 3300005367 Bacteria 8485
72 Ga0070667_100026477 3300005367 Bacteria 4825
73 Ga0070667_100067292 3300005367 Bacteria 3045
74 Ga0070667_100152850 3300005367 Bacteria 2028
75 Ga0070667_100212684 3300005367 Bacteria 1719
76 Ga0070714_100182264 3300005435 Bacteria 1911
77 Ga0070700_100053791 3300005441 Bacteria 2514
78 Ga0070694_100090006 3300005444 Bacteria 2151
79 Ga0070663_100007461 3300005455 Bacteria 6655
80 Ga0070663_100018050 3300005455 Bacteria 4617
81 Ga0070663_100031644 3300005455 Bacteria 3638
82 Ga0070663_100041378 3300005455 Bacteria 3231
83 Ga0070678_100868490 3300005456 Bacteria 823
84 Ga0070662_100000171 3300005457 Bacteria 37981
85 Ga0070662_100000253 3300005457 Bacteria 31619
86 Ga0070662_100006704 3300005457 Bacteria 7440
87 Ga0070662_100013068 3300005457 Bacteria 5518
88 Ga0070662_100028638 3300005457 Bacteria 3878
89 Ga0070681_10600676 3300005458 Bacteria 1015
90 Ga0068867_100010384 3300005459 Bacteria 6570
91 Ga0068867_100014876 3300005459 Bacteria 5515
92 Ga0068867_100027600 3300005459 Bacteria 4082
93 Ga0068867_100141008 3300005459 Bacteria 1884
94 Ga0068867_100427773 3300005459 Bacteria 1123
95 Ga0068853_100001092 3300005539 Bacteria 19210
96 Ga0068853_100045965 3300005539 Bacteria 3742
97 Ga0068853_100130673 3300005539 Bacteria 2248
98 Ga0068853_100415315 3300005539 Bacteria 1261
99 Ga0070672_100031186 3300005543 Bacteria 4010
100 Ga0070672_100173161 3300005543 Bacteria 1796
101 Ga0070672_100260296 3300005543 Bacteria 1463
102 Ga0070693_100000327 3300005547 Bacteria 21813
103 Ga0070693_100405621 3300005547 Bacteria 946
104 Ga0070665_100015947 3300005548 Bacteria 7540
105 Ga0068855_100000447 3300005563 Bacteria 51000
106 Ga0068855_100267377 3300005563 Bacteria 1903
107 Ga0068855_100273311 3300005563 Bacteria 1879
108 Ga0070664_100000311 3300005564 Bacteria 35468
109 Ga0070664_100022241 3300005564 Bacteria 5229
110 Ga0070664_100113607 3300005564 Bacteria 2365
111 Ga0070664_100137627 3300005564 Bacteria 2148
112 Ga0068857_100004848 3300005577 Bacteria 11406
113 Ga0068857_100046399 3300005577 Bacteria 3856
114 Ga0068857_100644456 3300005577 Bacteria 1004
115 Ga0068854_100060863 3300005578 Bacteria 2733
116 Ga0068856_100000979 3300005614 Bacteria 30480
117 Ga0068856_100155548 3300005614 Bacteria 2296
118 Ga0068852_100014704 3300005616 Bacteria 6037
119 Ga0068852_100019975 3300005616 Bacteria 5318
120 Ga0068852_100081041 3300005616 Bacteria 2880
121 Ga0068859_100043189 3300005617 Bacteria 4530
122 Ga0068859_100060304 3300005617 Bacteria 3823
123 Ga0068859_101218123 3300005617 Unclassified 829
124 Ga0068864_100001149 3300005618 Bacteria 22090
125 Ga0068864_100053531 3300005618 Bacteria 3482
126 Ga0068864_100337337 3300005618 Bacteria 1419
127 Ga0068866_10143621 3300005718 Bacteria 1373
128 Ga0068851_10018904 3300005834 Bacteria 3326
129 Ga0068851_10047309 3300005834 Bacteria 2178
130 Ga0068870_10108321 3300005840 Bacteria 1582
131 Ga0068863_100014929 3300005841 Bacteria 7460
132 Ga0068863_100026693 3300005841 Bacteria 5507
133 Ga0068863_100027356 3300005841 Bacteria 5439
134 Ga0068863_100194035 3300005841 Bacteria 1952
135 Ga0068858_100135351 3300005842 Bacteria 2312
136 Ga0068858_100627391 3300005842 Bacteria 1044
137 Ga0068860_100035978 3300005843 Bacteria 4747
138 Ga0068860_100042969 3300005843 Bacteria 4313
139 Ga0068860_100047112 3300005843 Bacteria 4109
140 Ga0068860_100228579 3300005843 Bacteria 1808
141 Ga0068862_100007045 3300005844 Bacteria 9335
142 Ga0068862_100013194 3300005844 Bacteria 6834
143 Ga0068862_100042851 3300005844 Bacteria 3857
144 Ga0068862_100058923 3300005844 Bacteria 3295
145 Ga0068862_100210524 3300005844 Bacteria 1756
146 Ga0068862_100229165 3300005844 Bacteria 1685
147 Ga0068862_100278795 3300005844 Bacteria 1531
148 Ga0075364_10296469 3300006051 Bacteria 1100
149 Ga0070712_100005180 3300006175 Bacteria 8066
150 Ga0068871_100006414 3300006358 Bacteria 8323
151 Ga0068871_100025963 3300006358 Bacteria 4565
152 Ga0075431_100009192 3300006847 Bacteria 9912
153 Ga0068865_100025294 3300006881 Bacteria 3903
154 Ga0068865_100201117 3300006881 Bacteria 1546
155 Ga0075436_100300782 3300006914 Bacteria 1150
156 Ga0097620_100043189 3300006931 Bacteria 4530
157 Ga0097620_100060305 3300006931 Bacteria 3823
158 Ga0097620_101218017 3300006931 Unclassified 829
159 Ga0105240_10384092 3300009093 Bacteria 1585
160 Ga0111539_10069019 3300009094 Bacteria 4174
161 Ga0111539_10145385 3300009094 Bacteria 2776
162 Ga0105243_10166104 3300009148 Bacteria 1907
163 Ga0105248_10000117 3300009177 Bacteria 90169
164 Ga0105248_10000928 3300009177 Bacteria 32626
165 Ga0105248_10006712 3300009177 Bacteria 12623
166 Ga0105248_10125180 3300009177 Bacteria 2899
167 Ga0105248_10837797 3300009177 Bacteria 1038
168 Ga0105238_10015311 3300009551 Bacteria 7768
169 Ga0105238_10309523 3300009551 Bacteria 1564
170 Ga0105238_10539521 3300009551 Bacteria 1170
171 Ga0105249_10032492 3300009553 Bacteria 4722
172 Ga0105249_10038321 3300009553 Bacteria 4349
173 Ga0105239_10017550 3300010375 Bacteria 7916
174 Ga0105246_10035537 3300011119 Bacteria 3331
175 Ga0105246_10088849 3300011119 Bacteria 2222
176 Ga0157373_10082994 3300013100 Bacteria 2259
177 Ga0157371_10004956 3300013102 Bacteria 11437
178 Ga0157369_10086797 3300013105 Bacteria 3341
179 Ga0157369_10452068 3300013105 Bacteria 1330
180 Ga0157374_10029106 3300013296 Bacteria 4997
181 Ga0163162_10087711 3300013306 Bacteria 3190
182 Ga0157372_10654130 3300013307 Bacteria 1224
183 Ga0157375_10101296 3300013308 Bacteria 2963
184 Ga0157375_10167626 3300013308 Bacteria 2342
185 Ga0163163_10000380 3300014325 Bacteria 42243
186 Ga0163163_10014693 3300014325 Bacteria 7200
187 Ga0163163_10030233 3300014325 Bacteria 5216
188 Ga0157380_10002494 3300014326 Bacteria 12406
189 Ga0157380_10029210 3300014326 Bacteria 4213
190 Ga0157380_10057165 3300014326 Bacteria 3105
191 Ga0157376_10007563 3300014969 Bacteria 7768
192 Ga0206354_10716655 3300020081 Bacteria 958
193 Ga0206353_10924924 3300020082 Bacteria 1299
194 Ga0213875_10013162 3300021388 Bacteria 4067
195 Ga0207697_10002570 3300025315 Bacteria 9339
196 Ga0207656_10009797 3300025321 Bacteria 3564
197 Ga0207682_10004776 3300025893 Bacteria 5615
198 Ga0207688_10041625 3300025901 Bacteria 2556
199 Ga0207680_10016496 3300025903 Bacteria 3879
200 Ga0207680_10026175 3300025903 Bacteria 3230
201 Ga0207647_10000181 3300025904 Bacteria 50570
202 Ga0207647_10026057 3300025904 Bacteria 3829
203 Ga0207647_10092346 3300025904 Bacteria 1805
204 Ga0207645_10006348 3300025907 Bacteria 8500
205 Ga0207645_10018567 3300025907 Bacteria 4571
206 Ga0207705_10000222 3300025909 Bacteria 56707
207 Ga0207705_10035082 3300025909 Bacteria 3588
208 Ga0207705_10035559 3300025909 Bacteria 3564
209 Ga0207695_10334209 3300025913 Bacteria 1403
210 Ga0207693_10011907 3300025915 Bacteria 7031
211 Ga0207657_10000378 3300025919 Bacteria 47118
212 Ga0207657_10000790 3300025919 Bacteria 33637
213 Ga0207657_10004380 3300025919 Bacteria 14945
214 Ga0207657_10018581 3300025919 Bacteria 6626
215 Ga0207657_10057392 3300025919 Bacteria 3355
216 Ga0207657_10525522 3300025919 Bacteria 926
217 Ga0207649_10000135 3300025920 Bacteria 63197
218 Ga0207649_10106955 3300025920 Bacteria 1862
219 Ga0207649_10329268 3300025920 Bacteria 1124
220 Ga0207649_10331455 3300025920 Bacteria 1121
221 Ga0207681_10003715 3300025923 Bacteria 9486
222 Ga0207681_10044392 3300025923 Bacteria 2978
223 Ga0207681_10078045 3300025923 Bacteria 2330
224 Ga0207681_10089373 3300025923 Bacteria 2196
225 Ga0207681_10209039 3300025923 Bacteria 1503
226 Ga0207681_10257677 3300025923 Bacteria 1364
227 Ga0207681_10316489 3300025923 Bacteria 1239
228 Ga0207650_10000907 3300025925 Bacteria 22318
229 Ga0207650_10016481 3300025925 Bacteria 5166
230 Ga0207650_10075443 3300025925 Bacteria 2545
231 Ga0207659_10026580 3300025926 Bacteria 3906
232 Ga0207664_10017539 3300025929 Bacteria 5252
233 Ga0207664_10041554 3300025929 Bacteria 3582
234 Ga0207644_10000166 3300025931 Bacteria 47729
235 Ga0207644_10000514 3300025931 Bacteria 25001
236 Ga0207644_10042812 3300025931 Bacteria 3211
237 Ga0207644_10045670 3300025931 Bacteria 3117
238 Ga0207644_10091273 3300025931 Bacteria 2271
239 Ga0207644_10239006 3300025931 Bacteria 1445
240 Ga0207690_10000003 3300025932 Bacteria 783011
241 Ga0207690_10000559 3300025932 Bacteria 24291
242 Ga0207690_10002755 3300025932 Bacteria 10616
243 Ga0207690_10013123 3300025932 Bacteria 4971
244 Ga0207690_10027445 3300025932 Bacteria 3598
245 Ga0207690_10106829 3300025932 Bacteria 2009
246 Ga0207690_10112499 3300025932 Bacteria 1963
247 Ga0207690_10215684 3300025932 Bacteria 1465
248 Ga0207690_10456123 3300025932 Bacteria 1028
249 Ga0207706_10000513 3300025933 Bacteria 41181
250 Ga0207706_10001038 3300025933 Bacteria 28181
251 Ga0207706_10003711 3300025933 Bacteria 14568
252 Ga0207706_10009897 3300025933 Bacteria 8742
253 Ga0207706_10011763 3300025933 Bacteria 7968
254 Ga0207706_10119580 3300025933 Bacteria 2316
255 Ga0207706_10192418 3300025933 Bacteria 1790
256 Ga0207686_10369322 3300025934 Bacteria 1085
257 Ga0207709_10398004 3300025935 Bacteria 1052
258 Ga0207669_10003132 3300025937 Bacteria 7129
259 Ga0207669_10006194 3300025937 Bacteria 5446
260 Ga0207669_10059624 3300025937 Bacteria 2335
261 Ga0207669_10240389 3300025937 Bacteria 1342
262 Ga0207704_10042031 3300025938 Bacteria 2687
263 Ga0207704_10054235 3300025938 Bacteria 2443
264 Ga0207704_10326324 3300025938 Bacteria 1186
265 Ga0207691_10017883 3300025940 Bacteria 6718
266 Ga0207691_10053931 3300025940 Bacteria 3669
267 Ga0207691_10128306 3300025940 Bacteria 2242
268 Ga0207691_10198305 3300025940 Bacteria 1748
269 Ga0207711_10000243 3300025941 Bacteria 58447
270 Ga0207711_10000558 3300025941 Bacteria 37953
271 Ga0207711_10080899 3300025941 Bacteria 2838
272 Ga0207711_10085477 3300025941 Bacteria 2764
273 Ga0207711_10416116 3300025941 Bacteria 1250
274 Ga0207711_10727484 3300025941 Bacteria 925
275 Ga0207689_10114597 3300025942 Bacteria 2216
276 Ga0207679_10001067 3300025945 Bacteria 17441
277 Ga0207679_10169041 3300025945 Bacteria 1798
278 Ga0207667_10001204 3300025949 Bacteria 32354
279 Ga0207667_10007180 3300025949 Bacteria 13438
280 Ga0207667_10033020 3300025949 Bacteria 5569
281 Ga0207651_10005049 3300025960 Bacteria 6731
282 Ga0207651_10054333 3300025960 Bacteria 2744
283 Ga0207651_10144519 3300025960 Bacteria 1842
284 Ga0207712_10003124 3300025961 Bacteria 10557
285 Ga0207712_10030694 3300025961 Bacteria 3615
286 Ga0207668_10000252 3300025972 Bacteria 35699
287 Ga0207668_10014035 3300025972 Bacteria 4952
288 Ga0207668_10072511 3300025972 Bacteria 2464
289 Ga0207668_10073396 3300025972 Bacteria 2452
290 Ga0207640_10048196 3300025981 Bacteria 2753
291 Ga0207640_10090864 3300025981 Bacteria 2114
292 Ga0207640_10114619 3300025981 Unclassified 1918
293 Ga0207658_10042391 3300025986 Bacteria 3301
294 Ga0207658_10043335 3300025986 Bacteria 3271
295 Ga0207658_10058609 3300025986 Bacteria 2866
296 Ga0207658_10128921 3300025986 Bacteria 2029
297 Ga0207658_10163980 3300025986 Bacteria 1824
298 Ga0207677_10000154 3300026023 Bacteria 54637
299 Ga0207703_10189765 3300026035 Bacteria 1819
300 Ga0207703_10495847 3300026035 Bacteria 1146
301 Ga0207639_10000412 3300026041 Bacteria 29612
302 Ga0207639_10097991 3300026041 Bacteria 2362
303 Ga0207639_10236145 3300026041 Bacteria 1587
304 Ga0207639_10239065 3300026041 Bacteria 1578
305 Ga0207639_10444629 3300026041 Bacteria 1176
306 Ga0207678_10001952 3300026067 Bacteria 18797
307 Ga0207678_10017289 3300026067 Bacteria 6331
308 Ga0207678_10087193 3300026067 Bacteria 2667
309 Ga0207678_10218774 3300026067 Bacteria 1630
310 Ga0207678_10816270 3300026067 Bacteria 824
311 Ga0207708_10107898 3300026075 Bacteria 2159
312 Ga0207702_10002993 3300026078 Bacteria 15727
313 Ga0207702_10044398 3300026078 Bacteria 3736
314 Ga0207641_10006216 3300026088 Bacteria 10102
315 Ga0207641_10048397 3300026088 Bacteria 3588
316 Ga0207641_10064413 3300026088 Bacteria 3133
317 Ga0207648_10003551 3300026089 Bacteria 16308
318 Ga0207648_10009982 3300026089 Bacteria 9036
319 Ga0207648_10012736 3300026089 Bacteria 7859
320 Ga0207648_10102788 3300026089 Bacteria 2505
321 Ga0207676_10028386 3300026095 Bacteria 4179
322 Ga0207676_10113963 3300026095 Bacteria 2267
323 Ga0207676_10171129 3300026095 Bacteria 1893
324 Ga0207674_10000082 3300026116 Bacteria 101650
325 Ga0207674_10028418 3300026116 Bacteria 5903
326 Ga0207674_10070455 3300026116 Bacteria 3515
327 Ga0207674_10125739 3300026116 Bacteria 2530
328 Ga0207674_10253174 3300026116 Bacteria 1708
329 Ga0207683_10013498 3300026121 Bacteria 6970
330 Ga0207683_10122851 3300026121 Bacteria 2332
331 Ga0207683_10608435 3300026121 Bacteria 1012
332 Ga0207683_10833346 3300026121 Bacteria 856
333 Ga0207698_10028377 3300026142 Bacteria 3990
334 Ga0207698_10030784 3300026142 Bacteria 3864
335 Ga0209974_10019008 3300027876 Bacteria 2278
336 Ga0209974_10035024 3300027876 Unclassified 1667
337 Ga0268266_10006447 3300028379 Bacteria 10746
338 Ga0268265_10003198 3300028380 Bacteria 11897
339 Ga0268265_10006550 3300028380 Bacteria 7882
340 Ga0268265_10007068 3300028380 Bacteria 7590
341 Ga0268265_10018945 3300028380 Bacteria 4779
342 Ga0268265_10074342 3300028380 Bacteria 2658
343 Ga0268265_10127552 3300028380 Bacteria 2108
344 Ga0268265_10131669 3300028380 Bacteria 2079
345 Ga0268264_10001868 3300028381 Bacteria 19146
346 Ga0268264_10016505 3300028381 Bacteria 6045
347 Ga0268264_10146195 3300028381 Bacteria 2114
348 Ga0268264_10174044 3300028381 Bacteria 1949
349 Ga0316182_1296768 3300030745 Bacteria 1186
350 Ga0307408_100014066 3300031548 Bacteria 5315
351 Ga0307408_100020009 3300031548 Bacteria 4511
352 Ga0307408_100112937 3300031548 Bacteria 2090
353 Ga0307408_100295187 3300031548 Bacteria 1355
354 Ga0307405_10005612 3300031731 Bacteria 6068
355 Ga0307405_10428953 3300031731 Unclassified 1042
356 Ga0307413_10000961 3300031824 Bacteria 10325
357 Ga0307413_10008900 3300031824 Bacteria 4770
358 Ga0307413_10013753 3300031824 Bacteria 4083
359 Ga0307413_10036927 3300031824 Bacteria 2817
360 Ga0307413_10173859 3300031824 Bacteria 1527
361 Ga0307410_10001040 3300031852 Bacteria 12033
362 Ga0307410_10010829 3300031852 Bacteria 5189
363 Ga0307410_10040338 3300031852 Bacteria 3072
364 Ga0307410_10139777 3300031852 Bacteria 1790
365 Ga0307410_10314471 3300031852 Bacteria 1240
366 Ga0307410_10385251 3300031852 Bacteria 1129
367 Ga0307410_10716673 3300031852 Bacteria 844
368 Ga0307406_10011848 3300031901 Bacteria 4955
369 Ga0307406_10022885 3300031901 Bacteria 3712
370 Ga0307406_10121627 3300031901 Bacteria 1816
371 Ga0307406_10158536 3300031901 Bacteria 1624
372 Ga0307406_10279028 3300031901 Bacteria 1273
373 Ga0307407_10000729 3300031903 Bacteria 10732
374 Ga0307407_10027575 3300031903 Bacteria 3025
375 Ga0307407_10094647 3300031903 Bacteria 1839
376 Ga0307407_10207631 3300031903 Bacteria 1316
377 Ga0307412_10008969 3300031911 Bacteria 5728
378 Ga0307412_10049232 3300031911 Bacteria 2775
379 Ga0307412_10073634 3300031911 Bacteria 2337
380 Ga0307412_10154507 3300031911 Bacteria 1697
381 Ga0307412_10230614 3300031911 Bacteria 1425
382 Ga0307412_10815321 3300031911 Bacteria 811
383 Ga0307409_100009982 3300031995 Bacteria 5867
384 Ga0307409_100011022 3300031995 Bacteria 5668
385 Ga0307409_100012781 3300031995 Bacteria 5366
386 Ga0307409_100074952 3300031995 Bacteria 2706
387 Ga0307409_100256496 3300031995 Bacteria 1602
388 Ga0307409_100297297 3300031995 Bacteria 1500
389 Ga0307409_100610903 3300031995 Bacteria 1079
390 Ga0307409_101007069 3300031995 Bacteria 851
391 Ga0307416_100011077 3300032002 Bacteria 5993
392 Ga0307416_100019447 3300032002 Bacteria 4815
393 Ga0307416_100064507 3300032002 Bacteria 3005
394 Ga0307416_100158962 3300032002 Bacteria 2085
395 Ga0307416_100360262 3300032002 Bacteria 1476
396 Ga0307416_100702613 3300032002 Bacteria 1100
397 Ga0307416_101113428 3300032002 Bacteria 894
398 Ga0307414_10001136 3300032004 Bacteria 13614
399 Ga0307414_10007306 3300032004 Bacteria 6206
400 Ga0307414_10041628 3300032004 Bacteria 3114
401 Ga0307414_10044350 3300032004 Bacteria 3036
402 Ga0307414_10280543 3300032004 Bacteria 1400
403 Ga0307414_10796496 3300032004 Bacteria 861
404 Ga0307411_10000914 3300032005 Bacteria 11223
405 Ga0307411_10006086 3300032005 Bacteria 5998
406 Ga0307411_10009911 3300032005 Bacteria 5044
407 Ga0307411_10014900 3300032005 Bacteria 4345
408 Ga0307411_10045427 3300032005 Bacteria 2825
409 Ga0307411_10069460 3300032005 Bacteria 2379
410 Ga0307411_10104871 3300032005 Bacteria 2008
411 Ga0307411_10229980 3300032005 Bacteria 1445
412 Ga0307411_10618728 3300032005 Bacteria 933
413 Ga0307415_100008679 3300032126 Bacteria 5651
414 Ga0307415_100014202 3300032126 Bacteria 4673
415 Ga0307415_100018963 3300032126 Bacteria 4167
416 Ga0307415_100026442 3300032126 Bacteria 3661
417 Ga0307415_100148924 3300032126 Bacteria 1798
418 Ga0307415_100176295 3300032126 Bacteria 1673
419 Ga0307415_100569803 3300032126 Bacteria 1002
420 Ga0373931_0012374 3300035691 Bacteria 4133
421 Ga0395899_0010126 3300037312 Bacteria 7229
422 Ga0395899_0022418 3300037312 Bacteria 4789
423 Ga0395899_0048521 3300037312 Bacteria 3160
424 Ga0395899_0059933 3300037312 Bacteria 2805
425 Ga0395899_0118776 3300037312 Bacteria 1896
426 Ga0395899_0290096 3300037312 Bacteria 1110
427 Ga0395900_0001090 3300037418 Bacteria 34516
428 Ga0395900_0004128 3300037418 Bacteria 15465
429 Ga0395900_0025406 3300037418 Bacteria 6064
430 Ga0395900_0027249 3300037418 Bacteria 5851
431 Ga0395900_0126487 3300037418 Bacteria 2621
432 Ga0395900_0148964 3300037418 Bacteria 2391
433 Ga0395900_0244643 3300037418 Bacteria 1798
434 Ga0395900_0341624 3300037418 Bacteria 1472
435 Ga0395900_0424685 3300037418 Bacteria 1289
436 Ga0395900_0485561 3300037418 Bacteria 1187
437 Ga0395898_0022960 3300037466 Bacteria 6307
438 Ga0395898_0039903 3300037466 Bacteria 4645
439 Ga0395898_0072124 3300037466 Bacteria 3336
440 Ga0395898_0078705 3300037466 Bacteria 3181
441 Ga0395898_0222727 3300037466 Bacteria 1799
442 Ga0395898_0320765 3300037466 Bacteria 1478
443 Ga0395905_0001328 3300037471 Bacteria 30188
444 Ga0395905_0001412 3300037471 Bacteria 29029
445 Ga0395905_0001650 3300037471 Bacteria 26378
446 Ga0395905_0003967 3300037471 Bacteria 15569
447 Ga0395905_0004150 3300037471 Bacteria 15150
448 Ga0395905_0009388 3300037471 Bacteria 9568
449 Ga0395905_0021349 3300037471 Bacteria 6124
450 Ga0395905_0025368 3300037471 Bacteria 5590
451 Ga0395905_0039058 3300037471 Bacteria 4453
452 Ga0395905_0042935 3300037471 Bacteria 4242
453 Ga0395905_0065300 3300037471 Bacteria 3407
454 Ga0395905_0081447 3300037471 Bacteria 3034
455 Ga0395905_0130207 3300037471 Bacteria 2366
456 Ga0395905_0141641 3300037471 Bacteria 2261
457 Ga0395905_0148208 3300037471 Bacteria 2208
458 Ga0395905_0160519 3300037471 Unclassified 2113
459 Ga0395905_0174940 3300037471 Bacteria 2015
460 Ga0395905_0222927 3300037471 Bacteria 1764
461 Ga0395905_0237501 3300037471 Bacteria 1703
462 Ga0395905_0293647 3300037471 Bacteria 1512
463 Ga0395905_0325718 3300037471 Bacteria 1426
464 Ga0395905_0356328 3300037471 Bacteria 1356
465 Ga0395905_0394398 3300037471 Bacteria 1279
466 Ga0395905_0404240 3300037471 Bacteria 1261
467 Ga0395905_0523070 3300037471 Bacteria 1087
468 Ga0436364_0792321 3300037853 Bacteria 31271
469 Ga0395901_0028350 3300038443 Bacteria 5757
470 Ga0395901_0031697 3300038443 Bacteria 5450
471 Ga0395901_0037553 3300038443 Bacteria 5010
472 Ga0395901_0057438 3300038443 Bacteria 4047
473 Ga0395901_0163680 3300038443 Bacteria 2336
474 Ga0395901_0178722 3300038443 Bacteria 2225
475 Ga0395901_0342522 3300038443 Bacteria 1544
476 Ga0395901_0381047 3300038443 Bacteria 1451
477 Ga0395901_0444136 3300038443 Unclassified 1327
478 Ga0395901_0493448 3300038443 Bacteria 1247
479 Ga0436365_0414380 3300039437 Bacteria 12800
480 Ga0439445_0000339 3300042004 Bacteria 9216
481 Ga0439432_009869 3300042006 Bacteria 3321
482 Ga0439449_0010608 3300042007 Bacteria 3480
483 Ga0439452_043194 3300042010 Bacteria 1055
484 Ga0439458_0000025 3300042157 Bacteria 23156
485 Ga0439458_0001657 3300042157 Bacteria 5558
486 Ga0451577_0476009 3300042876 Bacteria 1134
487 Ga0466969_0227059 3300044656 Unclassified 848
488 Ga0466965_0041054 3300044683 Bacteria 2279
489 Ga0466961_0084884 3300044693 Bacteria 2002
490 Ga0466961_0176968 3300044693 Bacteria 1325
491 Ga0466963_0013361 3300044694 Bacteria 5040
492 Ga0453684_0833012 3300044712 Bacteria 993
493 Ga0466971_0041121 3300044719 Bacteria 2076
494 Ga0466957_0002232 3300044842 Bacteria 10386
495 Ga0466957_0123834 3300044842 Bacteria 1650
496 Ga0466958_0034431 3300045836 Bacteria 3021
497 Ga0466958_0239378 3300045836 Bacteria 1159
498 Ga0466958_0404641 3300045836 Unclassified 881
499 Ga0466967_0186730 3300045976 Bacteria 1957
500 Ga0466967_0552401 3300045976 Bacteria 1133
501 Ga0495596_0022459 3300046500 Bacteria 2569
502 Ga0495663_0006439 3300046525 Bacteria 3244
503 Ga0495663_0015883 3300046525 Bacteria 2125
504 Ga0495621_0000121 3300046539 Bacteria 16597
505 Ga0495621_0010523 3300046539 Bacteria 2833
506 Ga0495621_0033975 3300046539 Bacteria 1760
507 Ga0495621_0037482 3300046539 Bacteria 1686
508 Ga0495633_0014199 3300046558 Bacteria 4173
509 Ga0495659_0072825 3300046664 Bacteria 1290
510 Ga0495670_0021115 3300046691 Bacteria 3211
511 Ga0495670_0024112 3300046691 Bacteria 3005
512 Ga0495677_0014366 3300047445 Bacteria 2884
513 Ga0496102_0784094 3300048905 Bacteria 875
514 Ga0496103_0230774 3300048906 Bacteria 1191
515 Ga0496104_0144473 3300048907 Bacteria 2285
516 Ga0496106_0029090 3300048909 Bacteria 4117
517 Ga0496107_0000181 3300048910 Bacteria 32803
518 Ga0496108_0020241 3300048911 Bacteria 5468
519 Ga0496108_0455884 3300048911 Bacteria 1117
520 Ga0496109_0013551 3300048912 Bacteria 7078
521 Ga0496109_0021711 3300048912 Bacteria 5681
522 Ga0496109_0052339 3300048912 Bacteria 3721
523 Ga0496109_0112670 3300048912 Bacteria 2530
524 Ga0496110_0000647 3300048913 Bacteria 23828
525 Ga0496110_0001880 3300048913 Bacteria 15501
526 Ga0496110_0057924 3300048913 Bacteria 3412
527 Ga0496111_0002948 3300048914 Bacteria 10412
528 Ga0496112_0025113 3300048915 Bacteria 5717
529 Ga0496112_0059671 3300048915 Bacteria 3759
530 Ga0496112_0079830 3300048915 Bacteria 3236
531 Ga0496112_0162893 3300048915 Bacteria 2196
532 Ga0496112_0581968 3300048915 Bacteria 1052
533 Ga0496113_0000485 3300048916 Bacteria 19549
534 Ga0496113_0011581 3300048916 Bacteria 5893
535 Ga0496113_0130066 3300048916 Bacteria 1975
536 Ga0501071_0156854 3300049587 Bacteria 1700
537 Ga0501202_003892 3300049652 Bacteria 2582
538 Ga0501209_006101 3300049656 Bacteria 2225
539 Ga0501224_007049 3300049664 Bacteria 1635
540 Ga0501249_009132 3300049679 Bacteria 2061
541 Ga0501253_024278 3300049683 Bacteria 1099
542 Ga0501080_0025769 3300049742 Bacteria 5462
543 Ga0501263_002763 3300049760 Bacteria 1823
544 Ga0501268_006751 3300049765 Bacteria 1694
545 Ga0501273_004637 3300049770 Bacteria 1518
546 Ga0501044_0378050 3300049823 Bacteria 1332
547 nmdc:mga00v17_116410_c1 3300050491 Bacteria 1699
548 nmdc:mga0yw44_326918_c1 3300050492 Bacteria 1030
549 nmdc:mga08y16_220675_c1 3300050511 Bacteria 1963
550 nmdc:mga08y16_48195_c1 3300050511 Bacteria 4458
551 nmdc:mga0n895_186287_c1 3300050512 Bacteria 2106
552 Ga0500658_0000022 3300053134 Bacteria 129341
553 Ga0500616_0000375 3300053153 Bacteria 62773
554 Ga0500587_013204 3300053739 Bacteria 1043
555 Ga0070675_100406710
556 JGI24740J21852_10027473
557 JGI24739J22299_10009989
558 JGI24737J22298_10000256
559 JGI24737J22298_10033148
560 JGI24737J22298_10037377
561 JGI24743J22301_10028966
562 JGI24738J21930_10002409
563 rootH2_10255869
564 Ga0070658_10000117
565 Ga0070658_10052786
566 Ga0070676_10011013
567 Ga0070676_10023528
568 Ga0070670_100012210
569 Ga0070670_100033493
570 Ga0070670_100056804
571 Ga0070670_100106430
572 Ga0070666_10026669
573 Ga0068868_100000162
574 Ga0068868_100015735
575 Ga0070660_100000530
576 Ga0070660_100001623
577 Ga0070660_100014349
578 Ga0070660_100026115
579 Ga0070660_100040861
580 Ga0070660_100275997
581 Ga0070660_100484157
582 Ga0070661_100000079
583 Ga0070661_100009904
584 Ga0070661_100385882
585 Ga0070661_100570173
586 Ga0070692_10008314
587 Ga0070668_100001009
588 Ga0070668_100002740
589 Ga0070668_100071947
590 Ga0070668_100190974
591 Ga0070668_100485138
592 Ga0070668_100486860
593 Ga0070669_100001654
594 Ga0070669_100009212
595 Ga0070669_100056458
596 Ga0070669_100098144
597 Ga0070669_100376135
598 Ga0070675_100022837
599 Ga0070675_100026972
600 Ga0070675_100266017
601 Ga0070671_100003139
602 Ga0070671_100052141
603 Ga0070671_100159000
604 Ga0070671_100159090
605 Ga0070671_100401022
606 Ga0070674_100002759
607 Ga0070674_100004206
608 Ga0070674_100035066
609 Ga0070673_100006081
610 Ga0070673_100006764
611 Ga0070673_100018247
612 Ga0070673_100027595
613 Ga0070673_100073244
614 Ga0070673_100292353
615 Ga0070659_100000022
616 Ga0070659_100000165
617 Ga0070659_100006492
618 Ga0070659_100012310
619 Ga0070659_100031373
620 Ga0070659_100035346
621 Ga0070659_100056110
622 Ga0070659_100058704
623 Ga0070659_100079764
624 Ga0070659_100154391
625 Ga0070667_100008550
626 Ga0070667_100026477
627 Ga0070667_100067292
628 Ga0070667_100152850
629 Ga0070667_100212684
630 Ga0070714_100182264
631 Ga0070700_100053791
632 Ga0070694_100090006
633 Ga0070663_100007461
634 Ga0070663_100018050
635 Ga0070663_100031644
636 Ga0070663_100041378
637 Ga0070678_100868490
638 Ga0070662_100000171
639 Ga0070662_100000253
640 Ga0070662_100006704
641 Ga0070662_100013068
642 Ga0070662_100028638
643 Ga0070681_10600676
644 Ga0068867_100010384
645 Ga0068867_100014876
646 Ga0068867_100027600
647 Ga0068867_100141008
648 Ga0068867_100427773
649 Ga0068853_100001092
650 Ga0068853_100045965
651 Ga0068853_100130673
652 Ga0068853_100415315
653 Ga0070672_100031186
654 Ga0070672_100173161
655 Ga0070672_100260296
656 Ga0070693_100000327
657 Ga0070693_100405621
658 Ga0070665_100015947
659 Ga0068855_100000447
660 Ga0068855_100267377
661 Ga0068855_100273311
662 Ga0070664_100000311
663 Ga0070664_100022241
664 Ga0070664_100113607
665 Ga0070664_100137627
666 Ga0068857_100004848
667 Ga0068857_100046399
668 Ga0068857_100644456
669 Ga0068854_100060863
670 Ga0068856_100000979
671 Ga0068856_100155548
672 Ga0068852_100014704
673 Ga0068852_100019975
674 Ga0068852_100081041
675 Ga0068859_100043189
676 Ga0068859_100060304
677 Ga0068859_101218123
678 Ga0068864_100001149
679 Ga0068864_100053531
680 Ga0068864_100337337
681 Ga0068866_10143621
682 Ga0068851_10018904
683 Ga0068851_10047309
684 Ga0068870_10108321
685 Ga0068863_100014929
686 Ga0068863_100026693
687 Ga0068863_100027356
688 Ga0068863_100194035
689 Ga0068858_100135351
690 Ga0068858_100627391
691 Ga0068860_100035978
692 Ga0068860_100042969
693 Ga0068860_100047112
694 Ga0068860_100228579
695 Ga0068862_100007045
696 Ga0068862_100013194
697 Ga0068862_100042851
698 Ga0068862_100058923
699 Ga0068862_100210524
700 Ga0068862_100229165
701 Ga0068862_100278795
702 Ga0075364_10296469
703 Ga0070712_100005180
704 Ga0068871_100006414
705 Ga0068871_100025963
706 Ga0075431_100009192
707 Ga0068865_100025294
708 Ga0068865_100201117
709 Ga0075436_100300782
710 Ga0097620_100043189
711 Ga0097620_100060305
712 Ga0097620_101218017
713 Ga0105240_10384092
714 Ga0111539_10069019
715 Ga0111539_10145385
716 Ga0105243_10166104
717 Ga0105248_10000117
718 Ga0105248_10000928
719 Ga0105248_10006712
720 Ga0105248_10125180
721 Ga0105248_10837797
722 Ga0105238_10015311
723 Ga0105238_10309523
724 Ga0105238_10539521
725 Ga0105249_10032492
726 Ga0105249_10038321
727 Ga0105239_10017550
728 Ga0105246_10035537
729 Ga0105246_10088849
730 Ga0157373_10082994
731 Ga0157371_10004956
732 Ga0157369_10086797
733 Ga0157369_10452068
734 Ga0157374_10029106
735 Ga0163162_10087711
736 Ga0157372_10654130
737 Ga0157375_10101296
738 Ga0157375_10167626
739 Ga0163163_10000380
740 Ga0163163_10014693
741 Ga0163163_10030233
742 Ga0157380_10002494
743 Ga0157380_10029210
744 Ga0157380_10057165
745 Ga0157376_10007563
746 Ga0206354_10716655
747 Ga0206353_10924924
748 Ga0213875_10013162
749 Ga0207697_10002570
750 Ga0207656_10009797
751 Ga0207682_10004776
752 Ga0207688_10041625
753 Ga0207680_10016496
754 Ga0207680_10026175
755 Ga0207647_10000181
756 Ga0207647_10026057
757 Ga0207647_10092346
758 Ga0207645_10006348
759 Ga0207645_10018567
760 Ga0207705_10000222
761 Ga0207705_10035082
762 Ga0207705_10035559
763 Ga0207695_10334209
764 Ga0207693_10011907
765 Ga0207657_10000378
766 Ga0207657_10000790
767 Ga0207657_10004380
768 Ga0207657_10018581
769 Ga0207657_10057392
770 Ga0207657_10525522
771 Ga0207649_10000135
772 Ga0207649_10106955
773 Ga0207649_10329268
774 Ga0207649_10331455
775 Ga0207681_10003715
776 Ga0207681_10044392
777 Ga0207681_10078045
778 Ga0207681_10089373
779 Ga0207681_10209039
780 Ga0207681_10257677
781 Ga0207681_10316489
782 Ga0207650_10000907
783 Ga0207650_10016481
784 Ga0207650_10075443
785 Ga0207659_10026580
786 Ga0207664_10017539
787 Ga0207664_10041554
788 Ga0207644_10000166
789 Ga0207644_10000514
790 Ga0207644_10042812
791 Ga0207644_10045670
792 Ga0207644_10091273
793 Ga0207644_10239006
794 Ga0207690_10000003
795 Ga0207690_10000559
796 Ga0207690_10002755
797 Ga0207690_10013123
798 Ga0207690_10027445
799 Ga0207690_10106829
800 Ga0207690_10112499
801 Ga0207690_10215684
802 Ga0207690_10456123
803 Ga0207706_10000513
804 Ga0207706_10001038
805 Ga0207706_10003711
806 Ga0207706_10009897
807 Ga0207706_10011763
808 Ga0207706_10119580
809 Ga0207706_10192418
810 Ga0207686_10369322
811 Ga0207709_10398004
812 Ga0207669_10003132
813 Ga0207669_10006194
814 Ga0207669_10059624
815 Ga0207669_10240389
816 Ga0207704_10042031
817 Ga0207704_10054235
818 Ga0207704_10326324
819 Ga0207691_10017883
820 Ga0207691_10053931
821 Ga0207691_10128306
822 Ga0207691_10198305
823 Ga0207711_10000243
824 Ga0207711_10000558
825 Ga0207711_10080899
826 Ga0207711_10085477
827 Ga0207711_10416116
828 Ga0207711_10727484
829 Ga0207689_10114597
830 Ga0207679_10001067
831 Ga0207679_10169041
832 Ga0207667_10001204
833 Ga0207667_10007180
834 Ga0207667_10033020
835 Ga0207651_10005049
836 Ga0207651_10054333
837 Ga0207651_10144519
838 Ga0207712_10003124
839 Ga0207712_10030694
840 Ga0207668_10000252
841 Ga0207668_10014035
842 Ga0207668_10072511
843 Ga0207668_10073396
844 Ga0207640_10048196
845 Ga0207640_10090864
846 Ga0207640_10114619
847 Ga0207658_10042391
848 Ga0207658_10043335
849 Ga0207658_10058609
850 Ga0207658_10128921
851 Ga0207658_10163980
852 Ga0207677_10000154
853 Ga0207703_10189765
854 Ga0207703_10495847
855 Ga0207639_10000412
856 Ga0207639_10097991
857 Ga0207639_10236145
858 Ga0207639_10239065
859 Ga0207639_10444629
860 Ga0207678_10001952
861 Ga0207678_10017289
862 Ga0207678_10087193
863 Ga0207678_10218774
864 Ga0207678_10816270
865 Ga0207708_10107898
866 Ga0207702_10002993
867 Ga0207702_10044398
868 Ga0207641_10006216
869 Ga0207641_10048397
870 Ga0207641_10064413
871 Ga0207648_10003551
872 Ga0207648_10009982
873 Ga0207648_10012736
874 Ga0207648_10102788
875 Ga0207676_10028386
876 Ga0207676_10113963
877 Ga0207676_10171129
878 Ga0207674_10000082
879 Ga0207674_10028418
880 Ga0207674_10070455
881 Ga0207674_10125739
882 Ga0207674_10253174
883 Ga0207683_10013498
884 Ga0207683_10122851
885 Ga0207683_10608435
886 Ga0207683_10833346
887 Ga0207698_10028377
888 Ga0207698_10030784
889 Ga0209974_10019008
890 Ga0209974_10035024
891 Ga0268266_10006447
892 Ga0268265_10003198
893 Ga0268265_10006550
894 Ga0268265_10007068
895 Ga0268265_10018945
896 Ga0268265_10074342
897 Ga0268265_10127552
898 Ga0268265_10131669
899 Ga0268264_10001868
900 Ga0268264_10016505
901 Ga0268264_10146195
902 Ga0268264_10174044
903 Ga0316182_1296768
904 Ga0307408_100014066
905 Ga0307408_100020009
906 Ga0307408_100112937
907 Ga0307408_100295187
908 Ga0307405_10005612
909 Ga0307405_10428953
910 Ga0307413_10000961
911 Ga0307413_10008900
912 Ga0307413_10013753
913 Ga0307413_10036927
914 Ga0307413_10173859
915 Ga0307410_10001040
916 Ga0307410_10010829
917 Ga0307410_10040338
918 Ga0307410_10139777
919 Ga0307410_10314471
920 Ga0307410_10385251
921 Ga0307410_10716673
922 Ga0307406_10011848
923 Ga0307406_10022885
924 Ga0307406_10121627
925 Ga0307406_10158536
926 Ga0307406_10279028
927 Ga0307407_10000729
928 Ga0307407_10027575
929 Ga0307407_10094647
930 Ga0307407_10207631
931 Ga0307412_10008969
932 Ga0307412_10049232
933 Ga0307412_10073634
934 Ga0307412_10154507
935 Ga0307412_10230614
936 Ga0307412_10815321
937 Ga0307409_100009982
938 Ga0307409_100011022
939 Ga0307409_100012781
940 Ga0307409_100074952
941 Ga0307409_100256496
942 Ga0307409_100297297
943 Ga0307409_100610903
944 Ga0307409_101007069
945 Ga0307416_100011077
946 Ga0307416_100019447
947 Ga0307416_100064507
948 Ga0307416_100158962
949 Ga0307416_100360262
950 Ga0307416_100702613
951 Ga0307416_101113428
952 Ga0307414_10001136
953 Ga0307414_10007306
954 Ga0307414_10041628
955 Ga0307414_10044350
956 Ga0307414_10280543
957 Ga0307414_10796496
958 Ga0307411_10000914
959 Ga0307411_10006086
960 Ga0307411_10009911
961 Ga0307411_10014900
962 Ga0307411_10045427
963 Ga0307411_10069460
964 Ga0307411_10104871
965 Ga0307411_10229980
966 Ga0307411_10618728
967 Ga0307415_100008679
968 Ga0307415_100014202
969 Ga0307415_100018963
970 Ga0307415_100026442
971 Ga0307415_100148924
972 Ga0307415_100176295
973 Ga0307415_100569803
974 Ga0373931_0012374
975 Ga0395899_0010126
976 Ga0395899_0022418
977 Ga0395899_0048521
978 Ga0395899_0059933
979 Ga0395899_0118776
980 Ga0395899_0290096
981 Ga0395900_0001090
982 Ga0395900_0004128
983 Ga0395900_0025406
984 Ga0395900_0027249
985 Ga0395900_0126487
986 Ga0395900_0148964
987 Ga0395900_0244643
988 Ga0395900_0341624
989 Ga0395900_0424685
990 Ga0395900_0485561
991 Ga0395898_0022960
992 Ga0395898_0039903
993 Ga0395898_0072124
994 Ga0395898_0078705
995 Ga0395898_0222727
996 Ga0395898_0320765
997 Ga0395905_0001328
998 Ga0395905_0001412
999 Ga0395905_0001650
1000 Ga0395905_0003967
1001 Ga0395905_0004150
1002 Ga0395905_0009388
1003 Ga0395905_0021349
1004 Ga0395905_0025368
1005 Ga0395905_0039058
1006 Ga0395905_0042935
1007 Ga0395905_0065300
1008 Ga0395905_0081447
1009 Ga0395905_0130207
1010 Ga0395905_0141641
1011 Ga0395905_0148208
1012 Ga0395905_0160519
1013 Ga0395905_0174940
1014 Ga0395905_0222927
1015 Ga0395905_0237501
1016 Ga0395905_0293647
1017 Ga0395905_0325718
1018 Ga0395905_0356328
1019 Ga0395905_0394398
1020 Ga0395905_0404240
1021 Ga0395905_0523070
1022 Ga0436364_0792321
1023 Ga0395901_0028350
1024 Ga0395901_0031697
1025 Ga0395901_0037553
1026 Ga0395901_0057438
1027 Ga0395901_0163680
1028 Ga0395901_0178722
1029 Ga0395901_0342522
1030 Ga0395901_0381047
1031 Ga0395901_0444136
1032 Ga0395901_0493448
1033 Ga0436365_0414380
1034 Ga0439445_0000339
1035 Ga0439432_009869
1036 Ga0439449_0010608
1037 Ga0439452_043194
1038 Ga0439458_0000025
1039 Ga0439458_0001657
1040 Ga0451577_0476009
1041 Ga0466969_0227059
1042 Ga0466965_0041054
1043 Ga0466961_0084884
1044 Ga0466961_0176968
1045 Ga0466963_0013361
1046 Ga0453684_0833012
1047 Ga0466971_0041121
1048 Ga0466957_0002232
1049 Ga0466957_0123834
1050 Ga0466958_0034431
1051 Ga0466958_0239378
1052 Ga0466958_0404641
1053 Ga0466967_0186730
1054 Ga0466967_0552401
1055 Ga0495596_0022459
1056 Ga0495663_0006439
1057 Ga0495663_0015883
1058 Ga0495621_0000121
1059 Ga0495621_0010523
1060 Ga0495621_0033975
1061 Ga0495621_0037482
1062 Ga0495633_0014199
1063 Ga0495659_0072825
1064 Ga0495670_0021115
1065 Ga0495670_0024112
1066 Ga0495677_0014366
1067 Ga0496102_0784094
1068 Ga0496103_0230774
1069 Ga0496104_0144473
1070 Ga0496106_0029090
1071 Ga0496107_0000181
1072 Ga0496108_0020241
1073 Ga0496108_0455884
1074 Ga0496109_0013551
1075 Ga0496109_0021711
1076 Ga0496109_0052339
1077 Ga0496109_0112670
1078 Ga0496110_0000647
1079 Ga0496110_0001880
1080 Ga0496110_0057924
1081 Ga0496111_0002948
1082 Ga0496112_0025113
1083 Ga0496112_0059671
1084 Ga0496112_0079830
1085 Ga0496112_0162893
1086 Ga0496112_0581968
1087 Ga0496113_0000485
1088 Ga0496113_0011581
1089 Ga0496113_0130066
1090 Ga0501071_0156854
1091 Ga0501202_003892
1092 Ga0501209_006101
1093 Ga0501224_007049
1094 Ga0501249_009132
1095 Ga0501253_024278
1096 Ga0501080_0025769
1097 Ga0501263_002763
1098 Ga0501268_006751
1099 Ga0501273_004637
1100 Ga0501044_0378050
1101 nmdc:mga00v17_116410_c1
1102 nmdc:mga0yw44_326918_c1
1103 nmdc:mga08y16_220675_c1
1104 nmdc:mga08y16_48195_c1
1105 nmdc:mga0n895_186287_c1
1106 Ga0500658_0000022
1107 Ga0500616_0000375
1108 Ga0500587_013204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04402

SIMPL

Protein of unknown function (DUF541)

53

253

0.93

Map