F462979

General Info

Members Datasets Scaffolds Average Seq Length
554 236 1108 299

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10137005|Ga0105241_101370052
Length 323
Sequence MHNVFCSTTLFYIFVPTKKNKPMQQPTLLILAAGMASRYGSMKQIQSFGPGGETIMDYSIYDAIRAGFKKVVFIIRKEFAADFQEIFEPKLKGRVAIDYVYQDLHAFTDGFQVPADRTKPWGTAHAILCAKNAINEPFAVINADDFYGRDAFEKAYEFLTTDCGPKLYSIIGYELLKTLSDNGTVNRGVCQVDAKGNLTAIAERINLSMQKGKIMVDDNQEPKELPLETSVSMNFWCFAPSIFPYTEKLFHTFISKNLSNPKAEFFIPIVADEFISKGDGAIKVIPTSAQWFGVTYKEDAPGVKASLDELVKAGEYPARLWPS

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
164 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
186 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
187 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
188 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
189 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
204 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
207 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
211 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
212 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
213 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
214 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
217 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
227 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
228 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
229 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
230 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
233 2738541278 Niastella sp. CF465 Isolate Unclassified
234 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
235 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
236 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0
Rhizoplane 0.54
Rhizosphere 92.6
Stem 0
Stem Tuber 0
Unclassified 17.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10137005 3300009174 Bacteria 1989
2 JGI24740J21852_10000984 3300001979 Bacteria 12737
3 JGI24739J22299_10007020 3300001989 Bacteria 4241
4 JGI24739J22299_10018624 3300001989 Bacteria 2493
5 JGI24751J29686_10003924 3300002459 Bacteria 3004
6 rootH1_10098359 3300003316 Bacteria 2579
7 rootH1_10150810 3300003316 Bacteria 2899
8 rootL2_10058361 3300003322 Bacteria 4028
9 rootL2_10058370 3300003322 Bacteria 4139
10 rootH1_10005105 3300003323 Bacteria 17579
11 rootH1_10188737 3300003323 Bacteria 2065
12 Ga0065714_10070747 3300005288 Bacteria 3775
13 Ga0065712_10079131 3300005290 Bacteria 3255
14 Ga0070658_10077419 3300005327 Unclassified 2728
15 Ga0070658_10122562 3300005327 Bacteria 2161
16 Ga0070676_10021838 3300005328 Bacteria 3585
17 Ga0070676_10067586 3300005328 Bacteria 2137
18 Ga0070676_10115694 3300005328 Bacteria 1676
19 Ga0070676_10141338 3300005328 Unclassified 1533
20 Ga0070683_100000416 3300005329 Bacteria 29488
21 Ga0070683_100000862 3300005329 Bacteria 22425
22 Ga0070670_100034153 3300005331 Bacteria 4378
23 Ga0070670_100064158 3300005331 Bacteria 3152
24 Ga0070670_100077525 3300005331 Bacteria 2855
25 Ga0070670_100096076 3300005331 Bacteria 2549
26 Ga0070677_10014063 3300005333 Bacteria 2810
27 Ga0068869_100027065 3300005334 Bacteria 3995
28 Ga0068869_100027540 3300005334 Bacteria 3963
29 Ga0068869_100061722 3300005334 Unclassified 2750
30 Ga0068869_100061815 3300005334 Unclassified 2748
31 Ga0068869_100072233 3300005334 Unclassified 2557
32 Ga0068869_100310236 3300005334 Bacteria 1277
33 Ga0070666_10000028 3300005335 Bacteria 144796
34 Ga0070666_10008440 3300005335 Bacteria 6397
35 Ga0070666_10043338 3300005335 Unclassified 3013
36 Ga0070680_100015814 3300005336 Bacteria 5923
37 Ga0070680_100053596 3300005336 Bacteria 3293
38 Ga0070682_100016914 3300005337 Bacteria 4244
39 Ga0070682_100036556 3300005337 Bacteria 3003
40 Ga0068868_100001540 3300005338 Bacteria 15748
41 Ga0068868_100004208 3300005338 Bacteria 10068
42 Ga0068868_100027683 3300005338 Unclassified 4325
43 Ga0070660_100001251 3300005339 Bacteria 17279
44 Ga0070660_100027666 3300005339 Bacteria 4234
45 Ga0070660_100097607 3300005339 Bacteria 2324
46 Ga0070660_100176151 3300005339 Bacteria 1730
47 Ga0070689_100046302 3300005340 Unclassified 3351
48 Ga0070687_100168432 3300005343 Bacteria 1302
49 Ga0070661_100001691 3300005344 Bacteria 15284
50 Ga0070661_100041644 3300005344 Bacteria 3351
51 Ga0070661_100049918 3300005344 Bacteria 3063
52 Ga0070668_100046743 3300005347 Bacteria 3325
53 Ga0070668_100143155 3300005347 Bacteria 1928
54 Ga0070668_100144280 3300005347 Bacteria 1920
55 Ga0070669_100040444 3300005353 Unclassified 3389
56 Ga0070675_100027552 3300005354 Unclassified 4566
57 Ga0070675_100128955 3300005354 Bacteria 2154
58 Ga0070675_100229375 3300005354 Bacteria 1619
59 Ga0070675_100298551 3300005354 Unclassified 1419
60 Ga0070671_100041177 3300005355 Unclassified 3839
61 Ga0070671_100159034 3300005355 Unclassified 1909
62 Ga0070671_100197694 3300005355 Bacteria 1705
63 Ga0070671_100410165 3300005355 Unclassified 1160
64 Ga0070674_100003085 3300005356 Bacteria 9270
65 Ga0070674_100157030 3300005356 Bacteria 1722
66 Ga0070673_100018725 3300005364 Bacteria 4955
67 Ga0070673_100103867 3300005364 Bacteria 2345
68 Ga0070673_100197855 3300005364 Unclassified 1730
69 Ga0070688_100227275 3300005365 Unclassified 1318
70 Ga0070659_100025801 3300005366 Bacteria 4519
71 Ga0070659_100030941 3300005366 Bacteria 4143
72 Ga0070659_100210510 3300005366 Bacteria 1602
73 Ga0070667_100026896 3300005367 Bacteria 4787
74 Ga0070667_100329277 3300005367 Bacteria 1380
75 Ga0070667_100553192 3300005367 Bacteria 1058
76 Ga0070713_100059780 3300005436 Bacteria 3184
77 Ga0070700_100062674 3300005441 Bacteria 2350
78 Ga0070663_100133295 3300005455 Bacteria 1889
79 Ga0070678_100008598 3300005456 Bacteria 6121
80 Ga0070662_100205919 3300005457 Unclassified 1563
81 Ga0070681_10293253 3300005458 Bacteria 1536
82 Ga0070681_10293747 3300005458 Bacteria 1535
83 Ga0068867_100066710 3300005459 Bacteria 2681
84 Ga0068867_100120995 3300005459 Unclassified 2023
85 Ga0068867_100137042 3300005459 Unclassified 1909
86 Ga0068867_100211317 3300005459 Bacteria 1558
87 Ga0068867_100343155 3300005459 Bacteria 1244
88 Ga0070679_100003166 3300005530 Bacteria 15042
89 Ga0070679_100008640 3300005530 Bacteria 9598
90 Ga0070679_100036542 3300005530 Bacteria 4874
91 Ga0070679_100233318 3300005530 Unclassified 1799
92 Ga0070679_100321481 3300005530 Bacteria 1497
93 Ga0070684_100010866 3300005535 Bacteria 7235
94 Ga0070684_100060025 3300005535 Bacteria 3325
95 Ga0070684_100132101 3300005535 Unclassified 2252
96 Ga0068853_100001585 3300005539 Bacteria 16590
97 Ga0068853_100005622 3300005539 Bacteria 9849
98 Ga0068853_100031135 3300005539 Bacteria 4512
99 Ga0068853_100079362 3300005539 Bacteria 2870
100 Ga0068853_100089002 3300005539 Unclassified 2711
101 Ga0068853_100209830 3300005539 Bacteria 1775
102 Ga0068853_100311404 3300005539 Bacteria 1457
103 Ga0070672_100018931 3300005543 Bacteria 4988
104 Ga0070672_100102005 3300005543 Unclassified 2328
105 Ga0070672_100269417 3300005543 Bacteria 1437
106 Ga0070665_100229958 3300005548 Bacteria 1854
107 Ga0068855_100000630 3300005563 Bacteria 43230
108 Ga0068855_100008628 3300005563 Bacteria 12313
109 Ga0068855_100024867 3300005563 Bacteria 7166
110 Ga0068855_100038643 3300005563 Bacteria 5670
111 Ga0068855_100077197 3300005563 Bacteria 3864
112 Ga0068855_100114206 3300005563 Bacteria 3096
113 Ga0068855_100227602 3300005563 Bacteria 2089
114 Ga0068855_100748844 3300005563 Bacteria 1042
115 Ga0070664_100009504 3300005564 Bacteria 7883
116 Ga0070664_100024924 3300005564 Bacteria 4956
117 Ga0070664_100164031 3300005564 Bacteria 1968
118 Ga0070664_100263006 3300005564 Bacteria 1553
119 Ga0068857_100029919 3300005577 Bacteria 4806
120 Ga0068857_100052605 3300005577 Bacteria 3613
121 Ga0068857_100266087 3300005577 Bacteria 1575
122 Ga0068854_100032094 3300005578 Bacteria 3652
123 Ga0068856_100027858 3300005614 Bacteria 5512
124 Ga0068856_100094037 3300005614 Bacteria 2984
125 Ga0068856_100351643 3300005614 Bacteria 1492
126 Ga0068852_100004122 3300005616 Bacteria 10232
127 Ga0068852_100004976 3300005616 Bacteria 9451
128 Ga0068852_100019025 3300005616 Bacteria 5426
129 Ga0068852_100030690 3300005616 Bacteria 4428
130 Ga0068852_100096705 3300005616 Bacteria 2655
131 Ga0068852_100124030 3300005616 Bacteria 2369
132 Ga0068852_100164427 3300005616 Bacteria 2075
133 Ga0068852_100358872 3300005616 Bacteria 1425
134 Ga0068859_100000012 3300005617 Bacteria 300376
135 Ga0068859_100008213 3300005617 Bacteria 10591
136 Ga0068859_100020133 3300005617 Bacteria 6699
137 Ga0068859_100041535 3300005617 Unclassified 4619
138 Ga0068859_100057135 3300005617 Bacteria 3931
139 Ga0068859_100280449 3300005617 Unclassified 1759
140 Ga0068859_100854078 3300005617 Unclassified 996
141 Ga0068864_100007973 3300005618 Bacteria 8728
142 Ga0068864_100012297 3300005618 Bacteria 7074
143 Ga0068864_100044037 3300005618 Bacteria 3823
144 Ga0068864_100071732 3300005618 Bacteria 3017
145 Ga0068864_100307092 3300005618 Bacteria 1486
146 Ga0068866_10010641 3300005718 Bacteria 3951
147 Ga0068861_100010694 3300005719 Bacteria 6376
148 Ga0068861_100081735 3300005719 Bacteria 2530
149 Ga0068851_10046804 3300005834 Bacteria 2189
150 Ga0068863_100002125 3300005841 Bacteria 19657
151 Ga0068863_100009422 3300005841 Bacteria 9532
152 Ga0068863_100436971 3300005841 Bacteria 1283
153 Ga0068863_100621024 3300005841 Bacteria 1071
154 Ga0068858_100004702 3300005842 Bacteria 13379
155 Ga0068858_100324300 3300005842 Bacteria 1472
156 Ga0068860_100000046 3300005843 Bacteria 214800
157 Ga0068860_100007815 3300005843 Bacteria 10678
158 Ga0068860_100012479 3300005843 Bacteria 8368
159 Ga0068860_100020187 3300005843 Bacteria 6457
160 Ga0068860_100063896 3300005843 Bacteria 3496
161 Ga0068862_100008092 3300005844 Bacteria 8701
162 Ga0068862_100378411 3300005844 Unclassified 1320
163 Ga0068862_100683976 3300005844 Unclassified 992
164 Ga0075366_10044041 3300006195 Bacteria 2645
165 Ga0075366_10044467 3300006195 Bacteria 2632
166 Ga0075366_10044732 3300006195 Bacteria 2624
167 Ga0097621_100005734 3300006237 Bacteria 8764
168 Ga0097621_100020920 3300006237 Bacteria 5049
169 Ga0097621_100058596 3300006237 Bacteria 3150
170 Ga0097621_100120499 3300006237 Unclassified 2225
171 Ga0097621_100179577 3300006237 Bacteria 1828
172 Ga0068871_100001400 3300006358 Bacteria 16139
173 Ga0068871_100003922 3300006358 Bacteria 10260
174 Ga0068871_100132921 3300006358 Unclassified 2111
175 Ga0075431_100089555 3300006847 Unclassified 3176
176 Ga0068865_100115537 3300006881 Bacteria 1986
177 Ga0068865_100210844 3300006881 Unclassified 1514
178 Ga0068865_100358562 3300006881 Bacteria 1183
179 Ga0075436_100191241 3300006914 Bacteria 1448
180 Ga0097620_100000012 3300006931 Bacteria 300376
181 Ga0097620_100008213 3300006931 Bacteria 10591
182 Ga0097620_100020133 3300006931 Bacteria 6699
183 Ga0097620_100041533 3300006931 Unclassified 4619
184 Ga0097620_100057136 3300006931 Bacteria 3931
185 Ga0097620_100280441 3300006931 Unclassified 1759
186 Ga0097620_100854109 3300006931 Unclassified 996
187 Ga0105240_10001517 3300009093 Bacteria 39516
188 Ga0105240_10002716 3300009093 Bacteria 28079
189 Ga0105240_10002823 3300009093 Bacteria 27474
190 Ga0105240_10092646 3300009093 Bacteria 3689
191 Ga0105240_10112572 3300009093 Unclassified 3290
192 Ga0105240_10293984 3300009093 Bacteria 1861
193 Ga0105240_10327078 3300009093 Bacteria 1745
194 Ga0105240_10601691 3300009093 Bacteria 1210
195 Ga0111539_10027898 3300009094 Bacteria 6894
196 Ga0111539_10032122 3300009094 Bacteria 6377
197 Ga0105245_10825443 3300009098 Bacteria 966
198 Ga0105247_10089800 3300009101 Unclassified 1949
199 Ga0105247_10229417 3300009101 Unclassified 1260
200 Ga0114129_10022075 3300009147 Bacteria 9032
201 Ga0105241_10000619 3300009174 Bacteria 26737
202 Ga0105241_10007907 3300009174 Bacteria 7818
203 Ga0105242_10035863 3300009176 Bacteria 3977
204 Ga0105242_10081723 3300009176 Bacteria 2702
205 Ga0105242_10167480 3300009176 Unclassified 1928
206 Ga0105248_10434615 3300009177 Bacteria 1478
207 Ga0105237_10007560 3300009545 Bacteria 11876
208 Ga0105237_10020194 3300009545 Bacteria 6875
209 Ga0105237_10041432 3300009545 Bacteria 4644
210 Ga0105237_10052578 3300009545 Bacteria 4088
211 Ga0105237_10435858 3300009545 Unclassified 1316
212 Ga0105238_10136112 3300009551 Unclassified 2434
213 Ga0105249_10000336 3300009553 Bacteria 47472
214 Ga0105249_10002924 3300009553 Bacteria 14735
215 Ga0105249_10029128 3300009553 Bacteria 4986
216 Ga0105249_10062091 3300009553 Bacteria 3430
217 Ga0105249_10077375 3300009553 Bacteria 3085
218 Ga0105239_10008174 3300010375 Bacteria 11935
219 Ga0105239_10014733 3300010375 Bacteria 8672
220 Ga0105239_10035221 3300010375 Bacteria 5498
221 Ga0105239_10203614 3300010375 Bacteria 2217
222 Ga0105239_10728352 3300010375 Unclassified 1135
223 Ga0105246_10046348 3300011119 Bacteria 2965
224 Ga0105246_10096961 3300011119 Bacteria 2138
225 Ga0105246_10241185 3300011119 Bacteria 1429
226 Ga0157373_10001885 3300013100 Bacteria 15908
227 Ga0157373_10022711 3300013100 Bacteria 4550
228 Ga0157373_10188601 3300013100 Bacteria 1453
229 Ga0157373_10411245 3300013100 Unclassified 970
230 Ga0157371_10001002 3300013102 Bacteria 31205
231 Ga0157371_10002977 3300013102 Bacteria 15723
232 Ga0157371_10004296 3300013102 Bacteria 12506
233 Ga0157371_10006866 3300013102 Bacteria 9293
234 Ga0157371_10006988 3300013102 Bacteria 9187
235 Ga0157371_10014226 3300013102 Bacteria 6016
236 Ga0157371_10014774 3300013102 Bacteria 5878
237 Ga0157371_10029414 3300013102 Bacteria 3974
238 Ga0157371_10047724 3300013102 Bacteria 3045
239 Ga0157371_10086943 3300013102 Bacteria 2214
240 Ga0157371_10197804 3300013102 Unclassified 1440
241 Ga0157370_10004047 3300013104 Bacteria 17017
242 Ga0157370_10054899 3300013104 Bacteria 3797
243 Ga0157370_10231376 3300013104 Bacteria 1711
244 Ga0157369_10009715 3300013105 Bacteria 11003
245 Ga0157369_10018160 3300013105 Bacteria 7889
246 Ga0157369_10080099 3300013105 Bacteria 3497
247 Ga0157369_10095435 3300013105 Bacteria 3173
248 Ga0157369_10214197 3300013105 Bacteria 2018
249 Ga0157374_10031789 3300013296 Bacteria 4801
250 Ga0157374_10040796 3300013296 Bacteria 4276
251 Ga0157374_10261725 3300013296 Bacteria 1704
252 Ga0157374_10390963 3300013296 Bacteria 1386
253 Ga0157374_10497550 3300013296 Bacteria 1223
254 Ga0157378_10002969 3300013297 Bacteria 15088
255 Ga0157378_10025960 3300013297 Bacteria 5162
256 Ga0157378_10033991 3300013297 Bacteria 4509
257 Ga0157378_10041279 3300013297 Bacteria 4092
258 Ga0157378_10083364 3300013297 Bacteria 2893
259 Ga0157378_10202627 3300013297 Bacteria 1877
260 Ga0157378_10293679 3300013297 Unclassified 1571
261 Ga0163162_10002326 3300013306 Bacteria 17832
262 Ga0163162_10017671 3300013306 Bacteria 6978
263 Ga0163162_10050840 3300013306 Bacteria 4157
264 Ga0163162_10353766 3300013306 Bacteria 1601
265 Ga0163162_10540856 3300013306 Unclassified 1293
266 Ga0157372_10054066 3300013307 Bacteria 4477
267 Ga0157372_10080094 3300013307 Bacteria 3695
268 Ga0157372_10110017 3300013307 Bacteria 3156
269 Ga0157372_10139008 3300013307 Bacteria 2797
270 Ga0157372_10227461 3300013307 Bacteria 2162
271 Ga0157372_10307524 3300013307 Unclassified 1845
272 Ga0157372_10778967 3300013307 Bacteria 1112
273 Ga0157375_10399131 3300013308 Bacteria 1542
274 Ga0163163_10035920 3300014325 Bacteria 4811
275 Ga0163163_10112099 3300014325 Bacteria 2757
276 Ga0163163_10338101 3300014325 Unclassified 1561
277 Ga0157380_10107218 3300014326 Bacteria 2339
278 Ga0157380_10194326 3300014326 Bacteria 1794
279 Ga0157377_10010450 3300014745 Bacteria 4592
280 Ga0157379_10030191 3300014968 Unclassified 4823
281 Ga0157379_10054417 3300014968 Bacteria 3575
282 Ga0157379_10188186 3300014968 Bacteria 1866
283 Ga0157379_10220949 3300014968 Bacteria 1717
284 Ga0157379_10279260 3300014968 Unclassified 1520
285 Ga0182006_1005135 3300015261 Bacteria 6289
286 Ga0163161_10028064 3300017792 Bacteria 3995
287 Ga0163161_10203979 3300017792 Bacteria 1525
288 Ga0209646_1001411 3300025246 Bacteria 6524
289 Ga0207697_10072834 3300025315 Bacteria 1441
290 Ga0207710_10086013 3300025900 Bacteria 1465
291 Ga0207688_10010428 3300025901 Bacteria 5058
292 Ga0207688_10010984 3300025901 Bacteria 4926
293 Ga0207680_10003326 3300025903 Bacteria 7574
294 Ga0207680_10090125 3300025903 Bacteria 1948
295 Ga0207680_10127486 3300025903 Unclassified 1673
296 Ga0207680_10258231 3300025903 Unclassified 1205
297 Ga0207647_10006531 3300025904 Bacteria 8473
298 Ga0207647_10022060 3300025904 Bacteria 4236
299 Ga0207647_10041934 3300025904 Bacteria 2874
300 Ga0207645_10000354 3300025907 Bacteria 38157
301 Ga0207645_10007158 3300025907 Bacteria 7912
302 Ga0207645_10160915 3300025907 Unclassified 1469
303 Ga0207645_10212118 3300025907 Bacteria 1276
304 Ga0207643_10003608 3300025908 Bacteria 8342
305 Ga0207705_10002745 3300025909 Bacteria 13489
306 Ga0207705_10131875 3300025909 Bacteria 1860
307 Ga0207654_10000479 3300025911 Bacteria 22913
308 Ga0207654_10015243 3300025911 Bacteria 3985
309 Ga0207654_10240283 3300025911 Bacteria 1210
310 Ga0207707_10108169 3300025912 Bacteria 2431
311 Ga0207707_10251310 3300025912 Bacteria 1536
312 Ga0207695_10000023 3300025913 Bacteria 657903
313 Ga0207695_10000110 3300025913 Bacteria 250079
314 Ga0207695_10000229 3300025913 Bacteria 149313
315 Ga0207695_10009361 3300025913 Bacteria 12113
316 Ga0207695_10016531 3300025913 Bacteria 8626
317 Ga0207695_10267368 3300025913 Bacteria 1606
318 Ga0207671_10005924 3300025914 Bacteria 11082
319 Ga0207671_10048967 3300025914 Unclassified 3127
320 Ga0207671_10225275 3300025914 Bacteria 1470
321 Ga0207671_10406374 3300025914 Bacteria 1083
322 Ga0207660_10006958 3300025917 Bacteria 7325
323 Ga0207660_10036076 3300025917 Unclassified 3436
324 Ga0207657_10022885 3300025919 Bacteria 5832
325 Ga0207657_10032463 3300025919 Bacteria 4717
326 Ga0207657_10042465 3300025919 Unclassified 4012
327 Ga0207657_10092792 3300025919 Bacteria 2516
328 Ga0207657_10343784 3300025919 Bacteria 1177
329 Ga0207649_10024736 3300025920 Bacteria 3494
330 Ga0207649_10130932 3300025920 Bacteria 1703
331 Ga0207652_10000181 3300025921 Bacteria 66711
332 Ga0207652_10004884 3300025921 Bacteria 10845
333 Ga0207652_10009180 3300025921 Bacteria 7960
334 Ga0207681_10174592 3300025923 Bacteria 1632
335 Ga0207681_10382595 3300025923 Unclassified 1133
336 Ga0207650_10003002 3300025925 Bacteria 11627
337 Ga0207650_10196085 3300025925 Bacteria 1615
338 Ga0207659_10127291 3300025926 Bacteria 1961
339 Ga0207659_10263654 3300025926 Unclassified 1403
340 Ga0207664_10201931 3300025929 Bacteria 1716
341 Ga0207644_10021217 3300025931 Bacteria 4422
342 Ga0207644_10111448 3300025931 Unclassified 2070
343 Ga0207644_10129579 3300025931 Unclassified 1930
344 Ga0207690_10071566 3300025932 Bacteria 2392
345 Ga0207690_10255171 3300025932 Bacteria 1356
346 Ga0207706_10306261 3300025933 Bacteria 1384
347 Ga0207706_10386944 3300025933 Unclassified 1213
348 Ga0207686_10278279 3300025934 Bacteria 1234
349 Ga0207670_10040599 3300025936 Bacteria 3054
350 Ga0207669_10188217 3300025937 Bacteria 1486
351 Ga0207704_10090892 3300025938 Bacteria 2005
352 Ga0207691_10003925 3300025940 Bacteria 14448
353 Ga0207691_10008243 3300025940 Bacteria 10005
354 Ga0207691_10037067 3300025940 Bacteria 4516
355 Ga0207691_10063145 3300025940 Unclassified 3360
356 Ga0207691_10089598 3300025940 Unclassified 2758
357 Ga0207689_10001630 3300025942 Bacteria 21256
358 Ga0207689_10003402 3300025942 Bacteria 14529
359 Ga0207689_10010556 3300025942 Bacteria 7952
360 Ga0207689_10028309 3300025942 Bacteria 4688
361 Ga0207689_10039159 3300025942 Unclassified 3925
362 Ga0207689_10095066 3300025942 Bacteria 2447
363 Ga0207661_10000927 3300025944 Bacteria 19231
364 Ga0207661_10017050 3300025944 Bacteria 5366
365 Ga0207679_10012298 3300025945 Bacteria 5577
366 Ga0207679_10048992 3300025945 Bacteria 3079
367 Ga0207679_10174640 3300025945 Unclassified 1772
368 Ga0207679_10355117 3300025945 Bacteria 1279
369 Ga0207667_10000700 3300025949 Bacteria 43461
370 Ga0207667_10002784 3300025949 Bacteria 21649
371 Ga0207667_10021765 3300025949 Bacteria 7101
372 Ga0207667_10024649 3300025949 Bacteria 6601
373 Ga0207651_10029346 3300025960 Bacteria 3484
374 Ga0207651_10383278 3300025960 Bacteria 1192
375 Ga0207712_10011962 3300025961 Bacteria 5537
376 Ga0207712_10030807 3300025961 Bacteria 3608
377 Ga0207712_10031978 3300025961 Bacteria 3548
378 Ga0207712_10044454 3300025961 Bacteria 3070
379 Ga0207712_10128949 3300025961 Bacteria 1924
380 Ga0207668_10206746 3300025972 Bacteria 1567
381 Ga0207668_10493100 3300025972 Bacteria 1052
382 Ga0207640_10093442 3300025981 Bacteria 2090
383 Ga0207640_10350103 3300025981 Bacteria 1187
384 Ga0207640_10503965 3300025981 Bacteria 1009
385 Ga0207658_10072894 3300025986 Unclassified 2605
386 Ga0207658_10112399 3300025986 Bacteria 2156
387 Ga0207658_10227509 3300025986 Bacteria 1572
388 Ga0207658_10243111 3300025986 Unclassified 1526
389 Ga0207658_10267122 3300025986 Unclassified 1460
390 Ga0207677_10010001 3300026023 Bacteria 5353
391 Ga0207677_10035021 3300026023 Bacteria 3256
392 Ga0207677_10119562 3300026023 Unclassified 1979
393 Ga0207677_10165535 3300026023 Unclassified 1723
394 Ga0207703_10004584 3300026035 Bacteria 11320
395 Ga0207703_10342658 3300026035 Unclassified 1374
396 Ga0207703_10404726 3300026035 Unclassified 1267
397 Ga0207639_10010461 3300026041 Bacteria 6427
398 Ga0207639_10043200 3300026041 Unclassified 3382
399 Ga0207639_10051489 3300026041 Bacteria 3132
400 Ga0207639_10159449 3300026041 Unclassified 1900
401 Ga0207708_10115057 3300026075 Bacteria 2091
402 Ga0207702_10078915 3300026078 Bacteria 2851
403 Ga0207702_10093862 3300026078 Bacteria 2632
404 Ga0207702_10111484 3300026078 Bacteria 2433
405 Ga0207702_10567416 3300026078 Bacteria 1111
406 Ga0207641_10000152 3300026088 Bacteria 98311
407 Ga0207641_10160035 3300026088 Unclassified 2046
408 Ga0207641_10282834 3300026088 Bacteria 1561
409 Ga0207648_10000404 3300026089 Bacteria 48036
410 Ga0207648_10006809 3300026089 Bacteria 11325
411 Ga0207648_10210907 3300026089 Unclassified 1724
412 Ga0207676_10022185 3300026095 Bacteria 4668
413 Ga0207676_10042904 3300026095 Bacteria 3479
414 Ga0207676_10203869 3300026095 Unclassified 1749
415 Ga0207674_10002719 3300026116 Bacteria 22062
416 Ga0207674_10048243 3300026116 Bacteria 4359
417 Ga0207674_10055019 3300026116 Bacteria 4049
418 Ga0207674_10396486 3300026116 Bacteria 1334
419 Ga0207675_100136473 3300026118 Bacteria 2328
420 Ga0207675_100637145 3300026118 Unclassified 1071
421 Ga0207683_10021738 3300026121 Bacteria 5499
422 Ga0207698_10012749 3300026142 Bacteria 5517
423 Ga0207698_10031580 3300026142 Bacteria 3825
424 Ga0207698_10090996 3300026142 Bacteria 2496
425 Ga0207698_10332943 3300026142 Bacteria 1427
426 Ga0207428_10374460 3300027907 Bacteria 1045
427 Ga0268266_10115106 3300028379 Unclassified 2387
428 Ga0268266_10220049 3300028379 Bacteria 1745
429 Ga0268265_10073544 3300028380 Bacteria 2670
430 Ga0268265_10312303 3300028380 Bacteria 1420
431 Ga0268264_10000041 3300028381 Bacteria 372501
432 Ga0268264_10003143 3300028381 Bacteria 14302
433 Ga0268264_10010550 3300028381 Bacteria 7639
434 Ga0268264_10018981 3300028381 Bacteria 5622
435 Ga0307515_10000039 3300028794 Bacteria 323229
436 Ga0265327_10085600 3300031251 Bacteria 1548
437 Ga0307513_10033861 3300031456 Bacteria 5738
438 Ga0307513_10035308 3300031456 Bacteria 5595
439 Ga0307513_10280517 3300031456 Bacteria 1444
440 Ga0307509_10116319 3300031507 Bacteria 2664
441 Ga0307509_10121713 3300031507 Bacteria 2586
442 Ga0307516_10000577 3300031730 Bacteria 49482
443 Ga0307516_10048490 3300031730 Bacteria 4179
444 Ga0307410_10079004 3300031852 Bacteria 2304
445 Ga0307407_10114337 3300031903 Unclassified 1700
446 Ga0307510_10000805 3300033180 Bacteria 32598
447 Ga0395899_0023691 3300037312 Bacteria 4646
448 Ga0395899_0033036 3300037312 Bacteria 3887
449 Ga0395899_0059292 3300037312 Bacteria 2821
450 Ga0395900_0007567 3300037418 Bacteria 11217
451 Ga0395900_0017877 3300037418 Bacteria 7237
452 Ga0395900_0040292 3300037418 Bacteria 4813
453 Ga0395900_0082623 3300037418 Bacteria 3300
454 Ga0395900_0268260 3300037418 Bacteria 1702
455 Ga0395898_0001381 3300037466 Bacteria 34756
456 Ga0395898_0003360 3300037466 Bacteria 17943
457 Ga0395898_0042155 3300037466 Bacteria 4505
458 Ga0395898_0154572 3300037466 Bacteria 2194
459 Ga0395905_0103398 3300037471 Bacteria 2674
460 Ga0395901_0012942 3300038443 Bacteria 8465
461 Ga0395901_0041303 3300038443 Bacteria 4779
462 Ga0439436_0009107 3300041404 Bacteria 3045
463 Ga0439439_0013442 3300041406 Bacteria 1984
464 Ga0439439_0026591 3300041406 Bacteria 1459
465 Ga0451795_0953208 3300041456 Bacteria 1861
466 Ga0451843_0685672 3300041509 Bacteria 1507
467 Ga0451853_2186550 3300041512 Bacteria 961
468 Ga0439449_0017974 3300042007 Bacteria 2654
469 Ga0439457_000707 3300042014 Bacteria 9880
470 Ga0439457_014159 3300042014 Bacteria 1787
471 Ga0451577_0311814 3300042876 Unclassified 1426
472 Ga0466969_0000182 3300044656 Bacteria 33828
473 Ga0466972_0003013 3300044658 Bacteria 8349
474 Ga0466972_0020761 3300044658 Bacteria 3280
475 Ga0466972_0028475 3300044658 Unclassified 2755
476 Ga0466965_0176656 3300044683 Bacteria 1125
477 Ga0466966_0002356 3300044684 Bacteria 12337
478 Ga0453684_0190650 3300044712 Bacteria 2398
479 Ga0466971_0083026 3300044719 Bacteria 1463
480 Ga0466968_0021860 3300044735 Bacteria 2594
481 Ga0466968_0159273 3300044735 Bacteria 1041
482 Ga0466957_0012368 3300044842 Bacteria 4941
483 Ga0466957_0033803 3300044842 Bacteria 3068
484 Ga0466959_0000056 3300045049 Bacteria 78465
485 Ga0495638_0023198 3300046460 Bacteria 4063
486 Ga0495650_0033545 3300046471 Bacteria 2284
487 Ga0495632_0074992 3300046519 Bacteria 1620
488 Ga0495632_0117974 3300046519 Unclassified 1242
489 Ga0495648_0001994 3300046524 Bacteria 19331
490 Ga0495668_0001941 3300046616 Bacteria 18402
491 Ga0495668_0076915 3300046616 Bacteria 1832
492 Ga0495686_0000004 3300047472 Bacteria 869019
493 Ga0496110_0039739 3300048913 Bacteria 4097
494 Ga0496110_0514358 3300048913 Unclassified 1089
495 Ga0501290_002692 3300049513 Unclassified 2278
496 Ga0501296_000745 3300049519 Unclassified 3230
497 Ga0501297_001875 3300049520 Unclassified 1987
498 Ga0501298_001632 3300049521 Unclassified 3322
499 Ga0501299_000376 3300049522 Bacteria 5270
500 Ga0501031_0003126 3300049568 Bacteria 10612
501 Ga0501033_0209318 3300049570 Bacteria 1391
502 Ga0501034_0168910 3300049571 Unclassified 2155
503 Ga0501036_0018517 3300049572 Bacteria 5837
504 Ga0501037_0187002 3300049573 Unclassified 1467
505 Ga0501038_0006153 3300049574 Bacteria 11107
506 Ga0501043_0238588 3300049579 Bacteria 1403
507 Ga0501047_0056300 3300049581 Bacteria 3802
508 Ga0501048_0151809 3300049582 Bacteria 1639
509 Ga0501068_0403905 3300049584 Unclassified 881
510 Ga0501070_0033866 3300049586 Bacteria 4274
511 Ga0501072_0154018 3300049588 Bacteria 1833
512 Ga0501073_0351667 3300049589 Unclassified 1017
513 Ga0501198_000760 3300049649 Unclassified 4029
514 Ga0501201_000177 3300049651 Bacteria 5604
515 Ga0501202_000044 3300049652 Bacteria 12530
516 Ga0501206_003258 3300049653 Unclassified 2061
517 Ga0501209_051941 3300049656 Unclassified 1121
518 Ga0501217_000584 3300049661 Bacteria 6142
519 Ga0501223_001942 3300049663 Bacteria 4646
520 Ga0501224_001879 3300049664 Unclassified 2835
521 Ga0501242_002238 3300049674 Unclassified 2022
522 Ga0501259_000788 3300049688 Bacteria 5184
523 Ga0501261_000428 3300049690 Bacteria 5494
524 Ga0501219_000074 3300049703 Bacteria 17135
525 Ga0501225_0003441 3300049705 Bacteria 4795
526 Ga0501225_0004929 3300049705 Bacteria 3944
527 Ga0501245_000377 3300049708 Bacteria 5341
528 Ga0501279_003545 3300049775 Unclassified 2035
529 Ga0501035_0028141 3300049822 Bacteria 5133
530 Ga0501044_0008339 3300049823 Bacteria 11357
531 Ga0501044_0037968 3300049823 Bacteria 5032
532 Ga0501044_0063747 3300049823 Bacteria 3764
533 Ga0501044_0264558 3300049823 Unclassified 1657
534 Ga0501284_00052 3300050005 Bacteria 43054
535 nmdc:mga0k408_4024_c1 3300050493 Bacteria 7803
536 nmdc:mga0k408_73834_c1 3300050493 Bacteria 1992
537 nmdc:mga05p37_16027_c1 3300050507 Bacteria 7915
538 Ga0500578_0000150 3300053086 Bacteria 83541
539 Ga0500578_0184274 3300053086 Bacteria 1285
540 Ga0500646_0070504 3300053090 Bacteria 1047
541 Ga0500583_0009104 3300053092 Bacteria 3609
542 Ga0500583_0015169 3300053092 Bacteria 3040
543 Ga0500650_0099596 3300053098 Bacteria 1360
544 Ga0500642_0002202 3300053130 Bacteria 5668
545 Ga0500577_0089424 3300053142 Bacteria 1242
546 Ga0500588_0025343 3300053146 Bacteria 1648
547 Ga0500589_040460 3300053147 Bacteria 2176
548 Ga0500622_0000900 3300053156 Bacteria 25309
549 Ga0500611_000028 3300053727 Bacteria 93696
550 Ga0500611_016148 3300053727 Bacteria 1336
551 2738726452 2738541278 Bacteria 9755573
552 2883072673 2883068021 Bacteria 6192739
553 2896087836 2896085136 Bacteria 6129793
554 2896112440 2896109856 Bacteria 7140722
555 Ga0105241_10137005
556 JGI24740J21852_10000984
557 JGI24739J22299_10007020
558 JGI24739J22299_10018624
559 JGI24751J29686_10003924
560 rootH1_10098359
561 rootH1_10150810
562 rootL2_10058361
563 rootL2_10058370
564 rootH1_10005105
565 rootH1_10188737
566 Ga0065714_10070747
567 Ga0065712_10079131
568 Ga0070658_10077419
569 Ga0070658_10122562
570 Ga0070676_10021838
571 Ga0070676_10067586
572 Ga0070676_10115694
573 Ga0070676_10141338
574 Ga0070683_100000416
575 Ga0070683_100000862
576 Ga0070670_100034153
577 Ga0070670_100064158
578 Ga0070670_100077525
579 Ga0070670_100096076
580 Ga0070677_10014063
581 Ga0068869_100027065
582 Ga0068869_100027540
583 Ga0068869_100061722
584 Ga0068869_100061815
585 Ga0068869_100072233
586 Ga0068869_100310236
587 Ga0070666_10000028
588 Ga0070666_10008440
589 Ga0070666_10043338
590 Ga0070680_100015814
591 Ga0070680_100053596
592 Ga0070682_100016914
593 Ga0070682_100036556
594 Ga0068868_100001540
595 Ga0068868_100004208
596 Ga0068868_100027683
597 Ga0070660_100001251
598 Ga0070660_100027666
599 Ga0070660_100097607
600 Ga0070660_100176151
601 Ga0070689_100046302
602 Ga0070687_100168432
603 Ga0070661_100001691
604 Ga0070661_100041644
605 Ga0070661_100049918
606 Ga0070668_100046743
607 Ga0070668_100143155
608 Ga0070668_100144280
609 Ga0070669_100040444
610 Ga0070675_100027552
611 Ga0070675_100128955
612 Ga0070675_100229375
613 Ga0070675_100298551
614 Ga0070671_100041177
615 Ga0070671_100159034
616 Ga0070671_100197694
617 Ga0070671_100410165
618 Ga0070674_100003085
619 Ga0070674_100157030
620 Ga0070673_100018725
621 Ga0070673_100103867
622 Ga0070673_100197855
623 Ga0070688_100227275
624 Ga0070659_100025801
625 Ga0070659_100030941
626 Ga0070659_100210510
627 Ga0070667_100026896
628 Ga0070667_100329277
629 Ga0070667_100553192
630 Ga0070713_100059780
631 Ga0070700_100062674
632 Ga0070663_100133295
633 Ga0070678_100008598
634 Ga0070662_100205919
635 Ga0070681_10293253
636 Ga0070681_10293747
637 Ga0068867_100066710
638 Ga0068867_100120995
639 Ga0068867_100137042
640 Ga0068867_100211317
641 Ga0068867_100343155
642 Ga0070679_100003166
643 Ga0070679_100008640
644 Ga0070679_100036542
645 Ga0070679_100233318
646 Ga0070679_100321481
647 Ga0070684_100010866
648 Ga0070684_100060025
649 Ga0070684_100132101
650 Ga0068853_100001585
651 Ga0068853_100005622
652 Ga0068853_100031135
653 Ga0068853_100079362
654 Ga0068853_100089002
655 Ga0068853_100209830
656 Ga0068853_100311404
657 Ga0070672_100018931
658 Ga0070672_100102005
659 Ga0070672_100269417
660 Ga0070665_100229958
661 Ga0068855_100000630
662 Ga0068855_100008628
663 Ga0068855_100024867
664 Ga0068855_100038643
665 Ga0068855_100077197
666 Ga0068855_100114206
667 Ga0068855_100227602
668 Ga0068855_100748844
669 Ga0070664_100009504
670 Ga0070664_100024924
671 Ga0070664_100164031
672 Ga0070664_100263006
673 Ga0068857_100029919
674 Ga0068857_100052605
675 Ga0068857_100266087
676 Ga0068854_100032094
677 Ga0068856_100027858
678 Ga0068856_100094037
679 Ga0068856_100351643
680 Ga0068852_100004122
681 Ga0068852_100004976
682 Ga0068852_100019025
683 Ga0068852_100030690
684 Ga0068852_100096705
685 Ga0068852_100124030
686 Ga0068852_100164427
687 Ga0068852_100358872
688 Ga0068859_100000012
689 Ga0068859_100008213
690 Ga0068859_100020133
691 Ga0068859_100041535
692 Ga0068859_100057135
693 Ga0068859_100280449
694 Ga0068859_100854078
695 Ga0068864_100007973
696 Ga0068864_100012297
697 Ga0068864_100044037
698 Ga0068864_100071732
699 Ga0068864_100307092
700 Ga0068866_10010641
701 Ga0068861_100010694
702 Ga0068861_100081735
703 Ga0068851_10046804
704 Ga0068863_100002125
705 Ga0068863_100009422
706 Ga0068863_100436971
707 Ga0068863_100621024
708 Ga0068858_100004702
709 Ga0068858_100324300
710 Ga0068860_100000046
711 Ga0068860_100007815
712 Ga0068860_100012479
713 Ga0068860_100020187
714 Ga0068860_100063896
715 Ga0068862_100008092
716 Ga0068862_100378411
717 Ga0068862_100683976
718 Ga0075366_10044041
719 Ga0075366_10044467
720 Ga0075366_10044732
721 Ga0097621_100005734
722 Ga0097621_100020920
723 Ga0097621_100058596
724 Ga0097621_100120499
725 Ga0097621_100179577
726 Ga0068871_100001400
727 Ga0068871_100003922
728 Ga0068871_100132921
729 Ga0075431_100089555
730 Ga0068865_100115537
731 Ga0068865_100210844
732 Ga0068865_100358562
733 Ga0075436_100191241
734 Ga0097620_100000012
735 Ga0097620_100008213
736 Ga0097620_100020133
737 Ga0097620_100041533
738 Ga0097620_100057136
739 Ga0097620_100280441
740 Ga0097620_100854109
741 Ga0105240_10001517
742 Ga0105240_10002716
743 Ga0105240_10002823
744 Ga0105240_10092646
745 Ga0105240_10112572
746 Ga0105240_10293984
747 Ga0105240_10327078
748 Ga0105240_10601691
749 Ga0111539_10027898
750 Ga0111539_10032122
751 Ga0105245_10825443
752 Ga0105247_10089800
753 Ga0105247_10229417
754 Ga0114129_10022075
755 Ga0105241_10000619
756 Ga0105241_10007907
757 Ga0105242_10035863
758 Ga0105242_10081723
759 Ga0105242_10167480
760 Ga0105248_10434615
761 Ga0105237_10007560
762 Ga0105237_10020194
763 Ga0105237_10041432
764 Ga0105237_10052578
765 Ga0105237_10435858
766 Ga0105238_10136112
767 Ga0105249_10000336
768 Ga0105249_10002924
769 Ga0105249_10029128
770 Ga0105249_10062091
771 Ga0105249_10077375
772 Ga0105239_10008174
773 Ga0105239_10014733
774 Ga0105239_10035221
775 Ga0105239_10203614
776 Ga0105239_10728352
777 Ga0105246_10046348
778 Ga0105246_10096961
779 Ga0105246_10241185
780 Ga0157373_10001885
781 Ga0157373_10022711
782 Ga0157373_10188601
783 Ga0157373_10411245
784 Ga0157371_10001002
785 Ga0157371_10002977
786 Ga0157371_10004296
787 Ga0157371_10006866
788 Ga0157371_10006988
789 Ga0157371_10014226
790 Ga0157371_10014774
791 Ga0157371_10029414
792 Ga0157371_10047724
793 Ga0157371_10086943
794 Ga0157371_10197804
795 Ga0157370_10004047
796 Ga0157370_10054899
797 Ga0157370_10231376
798 Ga0157369_10009715
799 Ga0157369_10018160
800 Ga0157369_10080099
801 Ga0157369_10095435
802 Ga0157369_10214197
803 Ga0157374_10031789
804 Ga0157374_10040796
805 Ga0157374_10261725
806 Ga0157374_10390963
807 Ga0157374_10497550
808 Ga0157378_10002969
809 Ga0157378_10025960
810 Ga0157378_10033991
811 Ga0157378_10041279
812 Ga0157378_10083364
813 Ga0157378_10202627
814 Ga0157378_10293679
815 Ga0163162_10002326
816 Ga0163162_10017671
817 Ga0163162_10050840
818 Ga0163162_10353766
819 Ga0163162_10540856
820 Ga0157372_10054066
821 Ga0157372_10080094
822 Ga0157372_10110017
823 Ga0157372_10139008
824 Ga0157372_10227461
825 Ga0157372_10307524
826 Ga0157372_10778967
827 Ga0157375_10399131
828 Ga0163163_10035920
829 Ga0163163_10112099
830 Ga0163163_10338101
831 Ga0157380_10107218
832 Ga0157380_10194326
833 Ga0157377_10010450
834 Ga0157379_10030191
835 Ga0157379_10054417
836 Ga0157379_10188186
837 Ga0157379_10220949
838 Ga0157379_10279260
839 Ga0182006_1005135
840 Ga0163161_10028064
841 Ga0163161_10203979
842 Ga0209646_1001411
843 Ga0207697_10072834
844 Ga0207710_10086013
845 Ga0207688_10010428
846 Ga0207688_10010984
847 Ga0207680_10003326
848 Ga0207680_10090125
849 Ga0207680_10127486
850 Ga0207680_10258231
851 Ga0207647_10006531
852 Ga0207647_10022060
853 Ga0207647_10041934
854 Ga0207645_10000354
855 Ga0207645_10007158
856 Ga0207645_10160915
857 Ga0207645_10212118
858 Ga0207643_10003608
859 Ga0207705_10002745
860 Ga0207705_10131875
861 Ga0207654_10000479
862 Ga0207654_10015243
863 Ga0207654_10240283
864 Ga0207707_10108169
865 Ga0207707_10251310
866 Ga0207695_10000023
867 Ga0207695_10000110
868 Ga0207695_10000229
869 Ga0207695_10009361
870 Ga0207695_10016531
871 Ga0207695_10267368
872 Ga0207671_10005924
873 Ga0207671_10048967
874 Ga0207671_10225275
875 Ga0207671_10406374
876 Ga0207660_10006958
877 Ga0207660_10036076
878 Ga0207657_10022885
879 Ga0207657_10032463
880 Ga0207657_10042465
881 Ga0207657_10092792
882 Ga0207657_10343784
883 Ga0207649_10024736
884 Ga0207649_10130932
885 Ga0207652_10000181
886 Ga0207652_10004884
887 Ga0207652_10009180
888 Ga0207681_10174592
889 Ga0207681_10382595
890 Ga0207650_10003002
891 Ga0207650_10196085
892 Ga0207659_10127291
893 Ga0207659_10263654
894 Ga0207664_10201931
895 Ga0207644_10021217
896 Ga0207644_10111448
897 Ga0207644_10129579
898 Ga0207690_10071566
899 Ga0207690_10255171
900 Ga0207706_10306261
901 Ga0207706_10386944
902 Ga0207686_10278279
903 Ga0207670_10040599
904 Ga0207669_10188217
905 Ga0207704_10090892
906 Ga0207691_10003925
907 Ga0207691_10008243
908 Ga0207691_10037067
909 Ga0207691_10063145
910 Ga0207691_10089598
911 Ga0207689_10001630
912 Ga0207689_10003402
913 Ga0207689_10010556
914 Ga0207689_10028309
915 Ga0207689_10039159
916 Ga0207689_10095066
917 Ga0207661_10000927
918 Ga0207661_10017050
919 Ga0207679_10012298
920 Ga0207679_10048992
921 Ga0207679_10174640
922 Ga0207679_10355117
923 Ga0207667_10000700
924 Ga0207667_10002784
925 Ga0207667_10021765
926 Ga0207667_10024649
927 Ga0207651_10029346
928 Ga0207651_10383278
929 Ga0207712_10011962
930 Ga0207712_10030807
931 Ga0207712_10031978
932 Ga0207712_10044454
933 Ga0207712_10128949
934 Ga0207668_10206746
935 Ga0207668_10493100
936 Ga0207640_10093442
937 Ga0207640_10350103
938 Ga0207640_10503965
939 Ga0207658_10072894
940 Ga0207658_10112399
941 Ga0207658_10227509
942 Ga0207658_10243111
943 Ga0207658_10267122
944 Ga0207677_10010001
945 Ga0207677_10035021
946 Ga0207677_10119562
947 Ga0207677_10165535
948 Ga0207703_10004584
949 Ga0207703_10342658
950 Ga0207703_10404726
951 Ga0207639_10010461
952 Ga0207639_10043200
953 Ga0207639_10051489
954 Ga0207639_10159449
955 Ga0207708_10115057
956 Ga0207702_10078915
957 Ga0207702_10093862
958 Ga0207702_10111484
959 Ga0207702_10567416
960 Ga0207641_10000152
961 Ga0207641_10160035
962 Ga0207641_10282834
963 Ga0207648_10000404
964 Ga0207648_10006809
965 Ga0207648_10210907
966 Ga0207676_10022185
967 Ga0207676_10042904
968 Ga0207676_10203869
969 Ga0207674_10002719
970 Ga0207674_10048243
971 Ga0207674_10055019
972 Ga0207674_10396486
973 Ga0207675_100136473
974 Ga0207675_100637145
975 Ga0207683_10021738
976 Ga0207698_10012749
977 Ga0207698_10031580
978 Ga0207698_10090996
979 Ga0207698_10332943
980 Ga0207428_10374460
981 Ga0268266_10115106
982 Ga0268266_10220049
983 Ga0268265_10073544
984 Ga0268265_10312303
985 Ga0268264_10000041
986 Ga0268264_10003143
987 Ga0268264_10010550
988 Ga0268264_10018981
989 Ga0307515_10000039
990 Ga0265327_10085600
991 Ga0307513_10033861
992 Ga0307513_10035308
993 Ga0307513_10280517
994 Ga0307509_10116319
995 Ga0307509_10121713
996 Ga0307516_10000577
997 Ga0307516_10048490
998 Ga0307410_10079004
999 Ga0307407_10114337
1000 Ga0307510_10000805
1001 Ga0395899_0023691
1002 Ga0395899_0033036
1003 Ga0395899_0059292
1004 Ga0395900_0007567
1005 Ga0395900_0017877
1006 Ga0395900_0040292
1007 Ga0395900_0082623
1008 Ga0395900_0268260
1009 Ga0395898_0001381
1010 Ga0395898_0003360
1011 Ga0395898_0042155
1012 Ga0395898_0154572
1013 Ga0395905_0103398
1014 Ga0395901_0012942
1015 Ga0395901_0041303
1016 Ga0439436_0009107
1017 Ga0439439_0013442
1018 Ga0439439_0026591
1019 Ga0451795_0953208
1020 Ga0451843_0685672
1021 Ga0451853_2186550
1022 Ga0439449_0017974
1023 Ga0439457_000707
1024 Ga0439457_014159
1025 Ga0451577_0311814
1026 Ga0466969_0000182
1027 Ga0466972_0003013
1028 Ga0466972_0020761
1029 Ga0466972_0028475
1030 Ga0466965_0176656
1031 Ga0466966_0002356
1032 Ga0453684_0190650
1033 Ga0466971_0083026
1034 Ga0466968_0021860
1035 Ga0466968_0159273
1036 Ga0466957_0012368
1037 Ga0466957_0033803
1038 Ga0466959_0000056
1039 Ga0495638_0023198
1040 Ga0495650_0033545
1041 Ga0495632_0074992
1042 Ga0495632_0117974
1043 Ga0495648_0001994
1044 Ga0495668_0001941
1045 Ga0495668_0076915
1046 Ga0495686_0000004
1047 Ga0496110_0039739
1048 Ga0496110_0514358
1049 Ga0501290_002692
1050 Ga0501296_000745
1051 Ga0501297_001875
1052 Ga0501298_001632
1053 Ga0501299_000376
1054 Ga0501031_0003126
1055 Ga0501033_0209318
1056 Ga0501034_0168910
1057 Ga0501036_0018517
1058 Ga0501037_0187002
1059 Ga0501038_0006153
1060 Ga0501043_0238588
1061 Ga0501047_0056300
1062 Ga0501048_0151809
1063 Ga0501068_0403905
1064 Ga0501070_0033866
1065 Ga0501072_0154018
1066 Ga0501073_0351667
1067 Ga0501198_000760
1068 Ga0501201_000177
1069 Ga0501202_000044
1070 Ga0501206_003258
1071 Ga0501209_051941
1072 Ga0501217_000584
1073 Ga0501223_001942
1074 Ga0501224_001879
1075 Ga0501242_002238
1076 Ga0501259_000788
1077 Ga0501261_000428
1078 Ga0501219_000074
1079 Ga0501225_0003441
1080 Ga0501225_0004929
1081 Ga0501245_000377
1082 Ga0501279_003545
1083 Ga0501035_0028141
1084 Ga0501044_0008339
1085 Ga0501044_0037968
1086 Ga0501044_0063747
1087 Ga0501044_0264558
1088 Ga0501284_00052
1089 nmdc:mga0k408_4024_c1
1090 nmdc:mga0k408_73834_c1
1091 nmdc:mga05p37_16027_c1
1092 Ga0500578_0000150
1093 Ga0500578_0184274
1094 Ga0500646_0070504
1095 Ga0500583_0009104
1096 Ga0500583_0015169
1097 Ga0500650_0099596
1098 Ga0500642_0002202
1099 Ga0500577_0089424
1100 Ga0500588_0025343
1101 Ga0500589_040460
1102 Ga0500622_0000900
1103 Ga0500611_000028
1104 Ga0500611_016148
1105 2738726452
1106 2883072673
1107 2896087836
1108 2896112440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

28

291

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pnn-assembly1.cif.gz_A the crystal structure of a glycosyltransferase from porphyromonas gingivalis w83 0.9484 1 298
3pnn-assembly1.cif.gz_A the crystal structure of a glycosyltransferase from porphyromonas gingivalis w83 0.9392 1 298
5z0a-assembly1.cif.gz_E-2 st0452(y97n)-glcnac binding form 0.8263 4 284
6t37-assembly2.cif.gz_C-3 pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.7947 2 293
6tqg-assembly1.cif.gz_D pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.7862 4 293
ID Description Score Start End Superfamily
3pnnA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9463 1 298 3.90.550.10
3pnnA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9401 1 298 3.90.550.10
5z0aE01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7984 4 272 3.90.550.10
4jd0A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7969 2 289 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.796 1 292 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7V5PCX8-F1-model_v4 Nucleotidyltransferase 0.9832 1 300
AF-A0A2T5C410-F1-model_v4 Nucleotidyltransferase-like protein 0.9831 1 299 GO:0009058
GO:0016779
AF-A0A6C0GHB8-F1-model_v4 Nucleotidyltransferase 0.9829 1 300 GO:0009058
GO:0016740
AF-A0A7X7Y0R1-F1-model_v4 Nucleotidyltransferase 0.9801 1 300 GO:0009058
GO:0016779
AF-A0A2T5C410-F1-model_v4 Nucleotidyltransferase-like protein 0.9799 1 299 GO:0009058
GO:0016779

Map