F462995

General Info

Members Datasets Scaffolds Average Seq Length
554 303 554 164

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10507250|Ga0207664_105072501
Length 197
Sequence MSISVARFIGAAPSGGLRARAITHLNGVPNVVLGTARMTRILELVLNGRRRVDAVPDNLLLLDYLREVVGLTGTKTGCDGGECGACTVLVDDQPRLSCLTLAATVNGQRVDTVESLGHDGRLSAVQRGFHEKLGAQCGYCTPGFIMASAGLLRRNPHPSEDDIRAALGSNICRCTGYVKIIEAVKYAAELHASGVAP

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 11.37
Rhizosphere 84.66
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003822 3300001977 Bacteria 2378
2 JGI24737J22298_10041117 3300001990 Bacteria 1418
3 JGI24743J22301_10000566 3300001991 Bacteria 4434
4 JGI24750J21931_1001645 3300002070 Bacteria 2742
5 JGI24745J21846_1001606 3300002073 Bacteria 2217
6 JGI24744J21845_10007865 3300002077 Bacteria 2202
7 JGI24033J26618_1009974 3300002155 Bacteria 1113
8 JGI24034J26672_10010530 3300002239 Bacteria 1376
9 JGI24742J22300_10001659 3300002244 Bacteria 3543
10 JGI24751J29686_10006542 3300002459 Bacteria 2375
11 Ga0070683_100414667 3300005329 Bacteria 1284
12 Ga0070690_100028954 3300005330 Bacteria 3433
13 Ga0070670_100047454 3300005331 Bacteria 3695
14 Ga0070670_100057256 3300005331 Bacteria 3347
15 Ga0070670_101074107 3300005331 Bacteria 733
16 Ga0070666_10051697 3300005335 Bacteria 2768
17 Ga0070682_100248191 3300005337 Bacteria 1282
18 Ga0068868_100002061 3300005338 Bacteria 13818
19 Ga0068868_100545661 3300005338 Bacteria 1021
20 Ga0070660_100307966 3300005339 Bacteria 1299
21 Ga0070689_100011043 3300005340 Bacteria 6456
22 Ga0070689_100150680 3300005340 Bacteria 1875
23 Ga0070689_101089065 3300005340 Bacteria 714
24 Ga0070691_10010824 3300005341 Bacteria 4162
25 Ga0070691_10062938 3300005341 Bacteria 1787
26 Ga0070687_100040738 3300005343 Bacteria 2342
27 Ga0070692_10026449 3300005345 Bacteria 2868
28 Ga0070668_100015764 3300005347 Bacteria 5654
29 Ga0070669_100037777 3300005353 Bacteria 3503
30 Ga0070675_100118630 3300005354 Bacteria 2246
31 Ga0070671_100021615 3300005355 Bacteria 5256
32 Ga0070674_100240015 3300005356 Bacteria 1418
33 Ga0070674_100313514 3300005356 Bacteria 1255
34 Ga0070673_100335467 3300005364 Bacteria 1338
35 Ga0070659_100078632 3300005366 Bacteria 2631
36 Ga0070667_100015732 3300005367 Bacteria 6255
37 Ga0070709_10031167 3300005434 Bacteria 3206
38 Ga0070714_100010663 3300005435 Bacteria 7271
39 Ga0070714_100028935 3300005435 Bacteria 4602
40 Ga0070714_100781935 3300005435 Bacteria 924
41 Ga0070713_100073884 3300005436 Bacteria 2887
42 Ga0070713_100317312 3300005436 Bacteria 1438
43 Ga0070713_100450472 3300005436 Bacteria 1209
44 Ga0070713_101123391 3300005436 Bacteria 760
45 Ga0070710_10011836 3300005437 Bacteria 4320
46 Ga0070710_10092912 3300005437 Bacteria 1783
47 Ga0070701_10029660 3300005438 Bacteria 2700
48 Ga0070711_100027455 3300005439 Bacteria 3737
49 Ga0070711_100055898 3300005439 Bacteria 2728
50 Ga0070711_100426560 3300005439 Bacteria 1081
51 Ga0070705_100463116 3300005440 Bacteria 954
52 Ga0070700_100002511 3300005441 Bacteria 9350
53 Ga0070700_100372754 3300005441 Bacteria 1065
54 Ga0070694_100005533 3300005444 Bacteria 7648
55 Ga0070708_100071584 3300005445 Bacteria 3122
56 Ga0070708_100601574 3300005445 Bacteria 1037
57 Ga0070708_100644944 3300005445 Bacteria 998
58 Ga0070663_100035302 3300005455 Bacteria 3468
59 Ga0070663_100719042 3300005455 Bacteria 850
60 Ga0070662_100200370 3300005457 Bacteria 1583
61 Ga0070685_10047425 3300005466 Bacteria 2470
62 Ga0070698_100157339 3300005471 Bacteria 2218
63 Ga0070698_100363408 3300005471 Bacteria 1379
64 Ga0070698_100367145 3300005471 Bacteria 1371
65 Ga0070699_100003596 3300005518 Bacteria 13702
66 Ga0070679_101219027 3300005530 Bacteria 698
67 Ga0070684_100150888 3300005535 Bacteria 2105
68 Ga0070697_100224989 3300005536 Bacteria 1599
69 Ga0070697_100452588 3300005536 Bacteria 1118
70 Ga0068853_100158346 3300005539 Bacteria 2041
71 Ga0070672_100086369 3300005543 Bacteria 2523
72 Ga0070695_100036074 3300005545 Bacteria 3110
73 Ga0070696_100738048 3300005546 Bacteria 806
74 Ga0070693_100128278 3300005547 Bacteria 1582
75 Ga0070665_100299988 3300005548 Bacteria 1609
76 Ga0070665_100700410 3300005548 Bacteria 1026
77 Ga0070704_100349515 3300005549 Bacteria 1248
78 Ga0070664_100122991 3300005564 Bacteria 2273
79 Ga0068857_101717072 3300005577 Bacteria 614
80 Ga0068854_100041784 3300005578 Bacteria 3241
81 Ga0068856_100202442 3300005614 Bacteria 2000
82 Ga0070702_100075722 3300005615 Bacteria 2001
83 Ga0070702_100082177 3300005615 Bacteria 1932
84 Ga0068852_100143228 3300005616 Bacteria 2214
85 Ga0068864_100014519 3300005618 Bacteria 6543
86 Ga0068864_100641314 3300005618 Bacteria 1034
87 Ga0068866_10155508 3300005718 Bacteria 1328
88 Ga0068861_100217549 3300005719 Bacteria 1612
89 Ga0068861_100218303 3300005719 Bacteria 1610
90 Ga0068870_10001098 3300005840 Bacteria 10755
91 Ga0068863_100034678 3300005841 Bacteria 4806
92 Ga0068858_100128046 3300005842 Bacteria 2379
93 Ga0081455_10000833 3300005937 Bacteria 39733
94 Ga0081455_10001744 3300005937 Bacteria 26280
95 Ga0081455_10015715 3300005937 Bacteria 7338
96 Ga0081455_10048929 3300005937 Bacteria 3648
97 Ga0081455_10068809 3300005937 Bacteria 2946
98 Ga0081455_10093440 3300005937 Bacteria 2432
99 Ga0081455_10670284 3300005937 Bacteria 665
100 Ga0081538_10000477 3300005981 Bacteria 45047
101 Ga0081538_10006000 3300005981 Bacteria 10813
102 Ga0081538_10040352 3300005981 Bacteria 2979
103 Ga0081540_1000066 3300005983 Bacteria 115420
104 Ga0081540_1006683 3300005983 Bacteria 8342
105 Ga0081540_1075323 3300005983 Bacteria 1543
106 Ga0081540_1089050 3300005983 Bacteria 1363
107 Ga0081540_1089689 3300005983 Bacteria 1356
108 Ga0081540_1301956 3300005983 Bacteria 550
109 Ga0081539_10027262 3300005985 Bacteria 3622
110 Ga0081539_10114855 3300005985 Bacteria 1348
111 Ga0070717_10011195 3300006028 Bacteria 6801
112 Ga0070717_10078478 3300006028 Bacteria 2767
113 Ga0070717_10128913 3300006028 Bacteria 2174
114 Ga0070717_10151321 3300006028 Bacteria 2008
115 Ga0070717_11338330 3300006028 Bacteria 651
116 Ga0075365_10197931 3300006038 Bacteria 1407
117 Ga0075365_10235572 3300006038 Bacteria 1285
118 Ga0075363_100234484 3300006048 Bacteria 1054
119 Ga0075363_100313666 3300006048 Bacteria 912
120 Ga0070715_10016789 3300006163 Bacteria 2758
121 Ga0070715_10046392 3300006163 Bacteria 1847
122 Ga0070716_100026220 3300006173 Bacteria 3119
123 Ga0070712_100001496 3300006175 Bacteria 14258
124 Ga0070712_100093273 3300006175 Bacteria 2210
125 Ga0070712_100102950 3300006175 Bacteria 2116
126 Ga0070712_100130303 3300006175 Bacteria 1905
127 Ga0070712_100209924 3300006175 Bacteria 1535
128 Ga0070712_100413975 3300006175 Bacteria 1116
129 Ga0070712_100720213 3300006175 Bacteria 852
130 Ga0075362_10340198 3300006177 Bacteria 750
131 Ga0097621_100291073 3300006237 Bacteria 1440
132 Ga0068871_100066837 3300006358 Bacteria 2948
133 Ga0068871_100584459 3300006358 Bacteria 1014
134 Ga0075428_100012713 3300006844 Bacteria 9362
135 Ga0075428_100061160 3300006844 Bacteria 4124
136 Ga0075428_100343160 3300006844 Bacteria 1603
137 Ga0075428_100344656 3300006844 Bacteria 1599
138 Ga0075428_100654118 3300006844 Bacteria 1121
139 Ga0075430_100036944 3300006846 Bacteria 4140
140 Ga0075430_100507158 3300006846 Bacteria 996
141 Ga0075430_100830036 3300006846 Bacteria 762
142 Ga0075431_100043012 3300006847 Bacteria 4661
143 Ga0075431_100123672 3300006847 Bacteria 2669
144 Ga0075431_100236100 3300006847 Bacteria 1861
145 Ga0075431_100329203 3300006847 Bacteria 1539
146 Ga0075431_100708654 3300006847 Bacteria 984
147 Ga0075431_100939162 3300006847 Bacteria 833
148 Ga0075431_101644557 3300006847 Bacteria 599
149 Ga0075433_10016781 3300006852 Bacteria 6046
150 Ga0075433_10067174 3300006852 Bacteria 3147
151 Ga0075434_100003615 3300006871 Bacteria 13799
152 Ga0075434_100005126 3300006871 Bacteria 11898
153 Ga0075434_100033616 3300006871 Bacteria 5062
154 Ga0075434_100190414 3300006871 Bacteria 2072
155 Ga0075434_100196707 3300006871 Bacteria 2036
156 Ga0075434_100458733 3300006871 Bacteria 1295
157 Ga0075434_100799227 3300006871 Bacteria 959
158 Ga0075429_100052078 3300006880 Bacteria 3561
159 Ga0075429_100277424 3300006880 Bacteria 1468
160 Ga0075429_100321470 3300006880 Bacteria 1354
161 Ga0068865_100010707 3300006881 Bacteria 5715
162 Ga0068865_100286237 3300006881 Bacteria 1314
163 Ga0075435_100009708 3300007076 Bacteria 6992
164 Ga0075435_100079765 3300007076 Bacteria 2687
165 Ga0075435_100102085 3300007076 Bacteria 2377
166 Ga0075435_100809891 3300007076 Bacteria 816
167 Ga0075435_101254578 3300007076 Bacteria 649
168 Ga0099795_10130477 3300007788 Bacteria 1013
169 Ga0099795_10334364 3300007788 Bacteria 674
170 Ga0105250_10021342 3300009092 Bacteria 2615
171 Ga0111539_10012212 3300009094 Bacteria 10773
172 Ga0111539_10120071 3300009094 Bacteria 3080
173 Ga0111539_11822123 3300009094 Bacteria 706
174 Ga0105245_10084593 3300009098 Bacteria 2907
175 Ga0105245_10121568 3300009098 Bacteria 2440
176 Ga0114129_10005944 3300009147 Bacteria 17275
177 Ga0114129_10025593 3300009147 Bacteria 8361
178 Ga0114129_10088285 3300009147 Bacteria 4299
179 Ga0114129_10138418 3300009147 Bacteria 3339
180 Ga0114129_10911259 3300009147 Bacteria 1113
181 Ga0114129_10915290 3300009147 Bacteria 1110
182 Ga0105243_10014819 3300009148 Bacteria 5899
183 Ga0105241_10946426 3300009174 Bacteria 803
184 Ga0105242_10042996 3300009176 Bacteria 3652
185 Ga0105248_10007960 3300009177 Bacteria 11652
186 Ga0105248_11850695 3300009177 Bacteria 685
187 Ga0105237_10082617 3300009545 Bacteria 3203
188 Ga0105249_10060160 3300009553 Bacteria 3484
189 Ga0105249_10301413 3300009553 Bacteria 1607
190 Ga0099796_10031110 3300010159 Bacteria 1738
191 Ga0099796_10166528 3300010159 Bacteria 877
192 Ga0105246_10235470 3300011119 Bacteria 1444
193 Ga0105246_10753197 3300011119 Bacteria 859
194 Ga0157371_10176523 3300013102 Bacteria 1527
195 Ga0157374_10059435 3300013296 Bacteria 3574
196 Ga0163162_10151281 3300013306 Bacteria 2439
197 Ga0157372_10878927 3300013307 Bacteria 1040
198 Ga0157375_10184320 3300013308 Bacteria 2240
199 Ga0163163_10134042 3300014325 Bacteria 2517
200 Ga0163163_10139397 3300014325 Bacteria 2467
201 Ga0157380_10048109 3300014326 Bacteria 3357
202 Ga0157380_10049760 3300014326 Bacteria 3307
203 Ga0157377_10041804 3300014745 Bacteria 2544
204 Ga0157379_10009784 3300014968 Bacteria 8354
205 Ga0157376_10157545 3300014969 Bacteria 2055
206 Ga0157376_10259940 3300014969 Bacteria 1626
207 Ga0157376_10373530 3300014969 Bacteria 1371
208 Ga0163161_10015993 3300017792 Bacteria 5236
209 Ga0163161_10316198 3300017792 Bacteria 1233
210 Ga0213874_10164247 3300021377 Bacteria 782
211 Ga0213876_10276364 3300021384 Bacteria 893
212 Ga0213875_10000003 3300021388 Bacteria 719367
213 Ga0224572_1066899 3300024225 Bacteria 664
214 Ga0228598_1000419 3300024227 Bacteria 8618
215 Ga0207656_10191252 3300025321 Bacteria 985
216 Ga0207710_10035504 3300025900 Bacteria 2194
217 Ga0207688_10000447 3300025901 Bacteria 19558
218 Ga0207680_10583227 3300025903 Bacteria 799
219 Ga0207647_10029917 3300025904 Bacteria 3518
220 Ga0207647_10335311 3300025904 Bacteria 858
221 Ga0207685_10018416 3300025905 Bacteria 2279
222 Ga0207699_10020215 3300025906 Bacteria 3563
223 Ga0207645_10012433 3300025907 Bacteria 5774
224 Ga0207643_10007556 3300025908 Bacteria 5836
225 Ga0207684_10242649 3300025910 Bacteria 1554
226 Ga0207684_10422540 3300025910 Bacteria 1145
227 Ga0207693_10003443 3300025915 Bacteria 13501
228 Ga0207693_10015430 3300025915 Bacteria 6128
229 Ga0207693_10017237 3300025915 Bacteria 5760
230 Ga0207693_10093222 3300025915 Bacteria 2360
231 Ga0207663_10049315 3300025916 Bacteria 2611
232 Ga0207663_10087850 3300025916 Bacteria 2054
233 Ga0207663_10342748 3300025916 Bacteria 1129
234 Ga0207660_10464408 3300025917 Bacteria 1024
235 Ga0207662_10000788 3300025918 Bacteria 14580
236 Ga0207657_10035616 3300025919 Bacteria 4461
237 Ga0207657_10831983 3300025919 Bacteria 713
238 Ga0207646_10246635 3300025922 Bacteria 1613
239 Ga0207694_10146939 3300025924 Bacteria 1898
240 Ga0207650_10098612 3300025925 Bacteria 2245
241 Ga0207650_10208466 3300025925 Bacteria 1569
242 Ga0207659_10061633 3300025926 Bacteria 2704
243 Ga0207687_10071608 3300025927 Bacteria 2477
244 Ga0207687_10071817 3300025927 Bacteria 2474
245 Ga0207700_10130587 3300025928 Bacteria 2050
246 Ga0207700_10226249 3300025928 Bacteria 1588
247 Ga0207700_10252674 3300025928 Bacteria 1506
248 Ga0207664_10012312 3300025929 Bacteria 6110
249 Ga0207664_10306776 3300025929 Bacteria 1398
250 Ga0207664_10507250 3300025929 Bacteria 1080
251 Ga0207706_10009920 3300025933 Bacteria 8733
252 Ga0207686_10372230 3300025934 Bacteria 1081
253 Ga0207709_10010146 3300025935 Bacteria 5187
254 Ga0207670_10031265 3300025936 Bacteria 3409
255 Ga0207670_10039032 3300025936 Bacteria 3106
256 Ga0207669_10023517 3300025937 Bacteria 3293
257 Ga0207704_10875408 3300025938 Bacteria 754
258 Ga0207665_10000206 3300025939 Bacteria 39664
259 Ga0207665_10212645 3300025939 Bacteria 1413
260 Ga0207691_10021871 3300025940 Bacteria 6036
261 Ga0207711_10054318 3300025941 Bacteria 3437
262 Ga0207689_10004078 3300025942 Bacteria 13276
263 Ga0207661_10207354 3300025944 Bacteria 1726
264 Ga0207651_10064018 3300025960 Bacteria 2571
265 Ga0207712_10011129 3300025961 Bacteria 5726
266 Ga0207668_10112583 3300025972 Bacteria 2044
267 Ga0207640_10019563 3300025981 Bacteria 4003
268 Ga0207658_10141832 3300025986 Bacteria 1945
269 Ga0207677_10060907 3300026023 Bacteria 2611
270 Ga0207677_10255122 3300026023 Bacteria 1426
271 Ga0207703_10014624 3300026035 Bacteria 6122
272 Ga0207639_10041749 3300026041 Bacteria 3434
273 Ga0207708_10000823 3300026075 Bacteria 23384
274 Ga0207702_10260632 3300026078 Bacteria 1632
275 Ga0207641_10034045 3300026088 Bacteria 4235
276 Ga0207648_10001310 3300026089 Bacteria 27700
277 Ga0207676_10089955 3300026095 Bacteria 2517
278 Ga0207674_10208427 3300026116 Bacteria 1904
279 Ga0207674_11088967 3300026116 Bacteria 768
280 Ga0207675_100029093 3300026118 Bacteria 5149
281 Ga0207675_100169632 3300026118 Bacteria 2085
282 Ga0207675_100199934 3300026118 Bacteria 1919
283 Ga0207683_10014866 3300026121 Bacteria 6628
284 Ga0207683_10532518 3300026121 Bacteria 1086
285 Ga0207698_10010459 3300026142 Bacteria 5964
286 Ga0207428_10236531 3300027907 Bacteria 1366
287 Ga0207428_10823578 3300027907 Bacteria 659
288 Ga0268266_10112426 3300028379 Bacteria 2414
289 Ga0268265_10160789 3300028380 Bacteria 1907
290 Ga0265338_10013501 3300028800 Bacteria 9210
291 Ga0265324_10159851 3300029957 Bacteria 765
292 Ga0265760_10110053 3300031090 Bacteria 877
293 Ga0265325_10017407 3300031241 Bacteria 3994
294 Ga0265339_10000228 3300031249 Bacteria 45435
295 Ga0265313_10000203 3300031595 Bacteria 63977
296 Ga0265313_10000917 3300031595 Bacteria 29468
297 Ga0265314_10016002 3300031711 Bacteria 5937
298 Ga0373930_0120040 3300034816 Bacteria 639
299 Ga0373948_0008236 3300034817 Bacteria 1771
300 Ga0373958_0006521 3300034819 Bacteria 1822
301 Ga0373928_0012687 3300035084 Bacteria 1684
302 Ga0373928_0037313 3300035084 Bacteria 1102
303 Ga0373929_0026350 3300035085 Bacteria 1214
304 Ga0373929_0077876 3300035085 Bacteria 803
305 Ga0373940_0032303 3300035088 Bacteria 1402
306 Ga0373949_0004006 3300035090 Bacteria 3414
307 Ga0373949_0158054 3300035090 Bacteria 659
308 Ga0373951_0040869 3300035091 Bacteria 1118
309 Ga0373932_0006337 3300035112 Bacteria 2797
310 Ga0373939_0004832 3300035114 Bacteria 3195
311 Ga0373939_0311153 3300035114 Bacteria 631
312 Ga0373941_0002530 3300035115 Bacteria 4044
313 Ga0373941_0018703 3300035115 Bacteria 1918
314 Ga0373941_0043678 3300035115 Bacteria 1396
315 Ga0373954_0081201 3300035118 Bacteria 1549
316 Ga0373960_0005948 3300035121 Bacteria 2843
317 Ga0373961_0004077 3300035241 Bacteria 3558
318 Ga0373962_0002894 3300035242 Bacteria 4113
319 Ga0373962_0007558 3300035242 Bacteria 2664
320 Ga0373931_0000445 3300035691 Bacteria 16816
321 Ga0373931_0005252 3300035691 Bacteria 5974
322 Ga0373931_0006571 3300035691 Bacteria 5440
323 Ga0373931_0039433 3300035691 Bacteria 2475
324 Ga0373931_0635461 3300035691 Bacteria 700
325 Ga0373931_0668146 3300035691 Bacteria 684
326 Ga0373927_0107157 3300035695 Bacteria 1820
327 Ga0373933_0037080 3300035724 Bacteria 2858
328 Ga0373947_0195982 3300035725 Bacteria 1320
329 Ga0373937_0492532 3300036401 Bacteria 1164
330 Ga0373937_0587929 3300036401 Bacteria 1057
331 Ga0373925_0064431 3300037068 Bacteria 2759
332 Ga0373925_0353070 3300037068 Bacteria 1194
333 Ga0395905_0214714 3300037471 Bacteria 1802
334 Ga0436364_0191605 3300037853 Bacteria 46122
335 Ga0436365_0569625 3300039437 Bacteria 808
336 Ga0436365_0684505 3300039437 Bacteria 901
337 Ga0436365_0688201 3300039437 Bacteria 945
338 Ga0436365_1524923 3300039437 Bacteria 1824
339 Ga0436365_1858544 3300039437 Bacteria 552
340 Ga0436360_0351713 3300039438 Bacteria 1196
341 Ga0436361_1075969 3300039447 Bacteria 705
342 Ga0436363_0608712 3300039450 Bacteria 543
343 Ga0436363_1468080 3300039450 Bacteria 1878
344 Ga0436362_0521384 3300039453 Bacteria 858
345 Ga0451853_0731668 3300041512 Bacteria 1518
346 Ga0439450_141532 3300042008 Bacteria 628
347 Ga0451577_0645945 3300042876 Bacteria 959
348 Ga0466967_0910938 3300045976 Bacteria 874
349 Ga0495592_0318118 3300046454 Bacteria 1006
350 Ga0495603_0188732 3300046455 Bacteria 1192
351 Ga0495590_0014214 3300046457 Bacteria 2910
352 Ga0495629_0057438 3300046459 Bacteria 2721
353 Ga0495629_0372416 3300046459 Bacteria 972
354 Ga0495638_0257434 3300046460 Bacteria 959
355 Ga0495641_0105084 3300046461 Bacteria 1260
356 Ga0495650_0145211 3300046471 Bacteria 856
357 Ga0495582_0069021 3300046473 Bacteria 1954
358 Ga0495662_0419433 3300046476 Bacteria 657
359 Ga0495584_0056689 3300046491 Bacteria 1972
360 Ga0495584_0136964 3300046491 Bacteria 1243
361 Ga0495584_0177149 3300046491 Bacteria 1084
362 Ga0495584_0193380 3300046491 Bacteria 1034
363 Ga0495585_0479365 3300046492 Bacteria 593
364 Ga0495607_0096747 3300046501 Bacteria 1589
365 Ga0495618_0262581 3300046514 Bacteria 1081
366 Ga0495630_1249366 3300046517 Bacteria 561
367 Ga0495631_0269742 3300046518 Bacteria 725
368 Ga0495632_0232899 3300046519 Bacteria 830
369 Ga0495637_0270660 3300046520 Bacteria 608
370 Ga0495652_0140164 3300046529 Bacteria 1902
371 Ga0495665_0150064 3300046531 Bacteria 1217
372 Ga0495640_0133337 3300046533 Bacteria 1606
373 Ga0495640_0364738 3300046533 Bacteria 890
374 Ga0495586_0128412 3300046535 Bacteria 1419
375 Ga0495586_0167799 3300046535 Bacteria 1240
376 Ga0495587_0117666 3300046536 Bacteria 1523
377 Ga0495609_0325428 3300046538 Bacteria 623
378 Ga0495645_0059971 3300046543 Bacteria 2758
379 Ga0495656_0033621 3300046615 Bacteria 2094
380 Ga0495656_0113645 3300046615 Bacteria 1270
381 Ga0495656_0175708 3300046615 Bacteria 1050
382 Ga0495634_0045179 3300046642 Bacteria 2979
383 Ga0495625_0433809 3300046660 Bacteria 815
384 Ga0495659_0176571 3300046664 Bacteria 868
385 Ga0495599_0037983 3300046678 Bacteria 3025
386 Ga0495623_0006581 3300046679 Bacteria 7561
387 Ga0495647_0080707 3300046681 Bacteria 1319
388 Ga0495658_0090738 3300046683 Bacteria 1809
389 Ga0495658_0338771 3300046683 Bacteria 955
390 Ga0495613_0155398 3300046689 Bacteria 1630
391 Ga0495649_0277478 3300046694 Bacteria 857
392 Ga0495600_0154425 3300046809 Bacteria 1485
393 Ga0495660_0039750 3300046810 Bacteria 2611
394 Ga0495604_0164648 3300047317 Bacteria 1564
395 Ga0495672_0090793 3300047320 Bacteria 1678
396 Ga0495680_0072104 3300047322 Bacteria 2628
397 Ga0495684_0410693 3300047471 Bacteria 948
398 Ga0495684_0553142 3300047471 Bacteria 783
399 Ga0495686_0623250 3300047472 Bacteria 557
400 Ga0495593_0091987 3300047673 Bacteria 1561
401 Ga0495593_0379221 3300047673 Bacteria 707
402 Ga0495615_0013196 3300048090 Bacteria 1722
403 Ga0496100_0025958 3300048903 Bacteria 3587
404 Ga0496100_0031483 3300048903 Bacteria 3298
405 Ga0496100_0301266 3300048903 Bacteria 1200
406 Ga0496101_0014604 3300048904 Bacteria 5280
407 Ga0496101_0032209 3300048904 Bacteria 3688
408 Ga0496102_0036614 3300048905 Bacteria 4421
409 Ga0496102_0123873 3300048905 Bacteria 2415
410 Ga0496102_0296378 3300048905 Bacteria 1524
411 Ga0496103_0001303 3300048906 Bacteria 16987
412 Ga0496103_0004456 3300048906 Bacteria 8490
413 Ga0496104_0000833 3300048907 Bacteria 26625
414 Ga0496104_0006728 3300048907 Bacteria 10122
415 Ga0496104_0016526 3300048907 Bacteria 6705
416 Ga0496104_0016928 3300048907 Bacteria 6631
417 Ga0496105_0001940 3300048908 Bacteria 14860
418 Ga0496105_0025499 3300048908 Bacteria 4813
419 Ga0496105_0095147 3300048908 Bacteria 2460
420 Ga0496105_0141245 3300048908 Bacteria 1982
421 Ga0496105_0309736 3300048908 Bacteria 1268
422 Ga0496106_0001089 3300048909 Bacteria 20073
423 Ga0496106_0023496 3300048909 Bacteria 4580
424 Ga0496106_0064524 3300048909 Bacteria 2786
425 Ga0496106_0181844 3300048909 Bacteria 1669
426 Ga0496106_0191210 3300048909 Bacteria 1627
427 Ga0496106_0735988 3300048909 Bacteria 785
428 Ga0496107_0115071 3300048910 Bacteria 1979
429 Ga0496107_0349760 3300048910 Bacteria 1100
430 Ga0496107_0369291 3300048910 Bacteria 1067
431 Ga0496107_0609893 3300048910 Bacteria 806
432 Ga0496108_0000775 3300048911 Bacteria 24949
433 Ga0496108_0012371 3300048911 Bacteria 6944
434 Ga0496108_0012564 3300048911 Bacteria 6897
435 Ga0496108_0018391 3300048911 Bacteria 5722
436 Ga0496108_0187761 3300048911 Bacteria 1791
437 Ga0496109_0006247 3300048912 Bacteria 10020
438 Ga0496109_1315304 3300048912 Bacteria 659
439 Ga0496110_0003027 3300048913 Bacteria 12758
440 Ga0496110_0006963 3300048913 Bacteria 8994
441 Ga0496110_0093959 3300048913 Bacteria 2685
442 Ga0496110_0099819 3300048913 Bacteria 2602
443 Ga0496110_0231222 3300048913 Bacteria 1682
444 Ga0496110_1211004 3300048913 Bacteria 664
445 Ga0496111_0001603 3300048914 Bacteria 13082
446 Ga0496111_0028102 3300048914 Bacteria 3984
447 Ga0496111_0039934 3300048914 Bacteria 3366
448 Ga0496111_0205820 3300048914 Bacteria 1462
449 Ga0496112_0017309 3300048915 Bacteria 6769
450 Ga0496112_0045865 3300048915 Bacteria 4284
451 Ga0496112_0209683 3300048915 Bacteria 1906
452 Ga0496112_0543300 3300048915 Bacteria 1096
453 Ga0496112_0715378 3300048915 Bacteria 929
454 Ga0496113_0000524 3300048916 Bacteria 18933
455 Ga0496113_0003988 3300048916 Bacteria 8968
456 Ga0496113_0006125 3300048916 Bacteria 7592
457 Ga0496113_1186382 3300048916 Bacteria 596
458 Ga0496114_0017299 3300048917 Bacteria 5817
459 Ga0496114_0193847 3300048917 Bacteria 1778
460 Ga0496114_0407443 3300048917 Bacteria 1204
461 Ga0496114_0577638 3300048917 Bacteria 992
462 Ga0496115_0018841 3300048918 Bacteria 5306
463 Ga0496115_0041842 3300048918 Bacteria 3648
464 Ga0496115_0152666 3300048918 Bacteria 1907
465 Ga0496115_0292910 3300048918 Bacteria 1335
466 Ga0501036_0117364 3300049572 Bacteria 2248
467 Ga0501038_0339456 3300049574 Bacteria 1172
468 Ga0501039_0258813 3300049575 Bacteria 1368
469 Ga0501039_1130813 3300049575 Bacteria 607
470 Ga0501041_0325486 3300049577 Bacteria 970
471 Ga0501041_0564189 3300049577 Bacteria 726
472 Ga0501046_1074837 3300049580 Bacteria 556
473 Ga0501068_0591648 3300049584 Bacteria 723
474 Ga0501068_0691681 3300049584 Bacteria 667
475 Ga0501070_0563498 3300049586 Bacteria 911
476 Ga0501071_1002260 3300049587 Bacteria 645
477 Ga0501072_0297934 3300049588 Bacteria 1282
478 Ga0501073_0055597 3300049589 Bacteria 2769
479 Ga0501074_0533581 3300049590 Bacteria 831
480 Ga0501075_0104941 3300049591 Bacteria 2148
481 Ga0501075_0311622 3300049591 Bacteria 1199
482 Ga0501076_0358068 3300049592 Bacteria 1199
483 Ga0501076_0362124 3300049592 Bacteria 1191
484 Ga0501077_0309204 3300049593 Bacteria 1007
485 Ga0501079_0549055 3300049741 Bacteria 909
486 Ga0501079_0688118 3300049741 Bacteria 805
487 Ga0501080_0801837 3300049742 Bacteria 826
488 Ga0501045_0402232 3300049824 Bacteria 1019
489 nmdc:mga03n38_278600_c1 3300050490 Bacteria 892
490 nmdc:mga0yw44_661840_c1 3300050492 Bacteria 710
491 nmdc:mga0k408_455676_c1 3300050493 Bacteria 759
492 nmdc:mga0k408_81429_c1 3300050493 Bacteria 1895
493 nmdc:mga05p37_14334_c1 3300050507 Bacteria 9517
494 nmdc:mga05p37_16059_c1 3300050507 Bacteria 9010
495 nmdc:mga05p37_16864_c1 3300050507 Bacteria 8805
496 nmdc:mga05p37_398807_c1 3300050507 Bacteria 1607
497 nmdc:mga05p37_656148_c1 3300050507 Bacteria 1174
498 nmdc:mga05p37_677646_c1 3300050507 Bacteria 1150
499 nmdc:mga05p37_788772_c1 3300050507 Bacteria 1041
500 nmdc:mga09592_134179_c1 3300050508 Bacteria 2132
501 nmdc:mga09592_413294_c1 3300050508 Bacteria 1166
502 nmdc:mga09592_415198_c1 3300050508 Bacteria 1163
503 nmdc:mga0qj67_29558_c1 3300050509 Bacteria 4257
504 nmdc:mga0qj67_398164_c1 3300050509 Bacteria 1111
505 nmdc:mga0qj67_600011_c1 3300050509 Bacteria 881
506 nmdc:mga0qj67_760326_c1 3300050509 Bacteria 768
507 nmdc:mga0qj67_765185_c1 3300050509 Bacteria 766
508 nmdc:mga06r32_140666_c1 3300050510 Bacteria 2389
509 nmdc:mga06r32_253697_c1 3300050510 Bacteria 1747
510 nmdc:mga06r32_347204_c1 3300050510 Bacteria 1468
511 nmdc:mga06r32_35928_c1 3300050510 Bacteria 4678
512 nmdc:mga06r32_494828_c1 3300050510 Bacteria 1200
513 nmdc:mga06r32_513304_c1 3300050510 Bacteria 1175
514 nmdc:mga06r32_533586_c1 3300050510 Bacteria 1148
515 nmdc:mga06r32_60633_c1 3300050510 Bacteria 3641
516 nmdc:mga06r32_800997_c1 3300050510 Bacteria 903
517 nmdc:mga08y16_1168804_c1 3300050511 Bacteria 742
518 nmdc:mga08y16_227320_c1 3300050511 Bacteria 1930
519 nmdc:mga08y16_286844_c1 3300050511 Bacteria 1697
520 nmdc:mga08y16_437189_c1 3300050511 Bacteria 1336
521 nmdc:mga08y16_462134_c1 3300050511 Bacteria 1293
522 nmdc:mga0n895_1183_c1 3300050512 Bacteria 19168
523 nmdc:mga0n895_189979_c1 3300050512 Bacteria 2085
524 nmdc:mga0n895_203391_c1 3300050512 Bacteria 2011
525 nmdc:mga0n895_217748_c1 3300050512 Bacteria 1939
526 nmdc:mga0n895_227161_c1 3300050512 Bacteria 1895
527 nmdc:mga0n895_588001_c1 3300050512 Bacteria 1116
528 nmdc:mga0rr50_1109508_c1 3300050513 Bacteria 673
529 nmdc:mga0rr50_156016_c1 3300050513 Bacteria 1849
530 nmdc:mga0rr50_19486_c1 3300050513 Bacteria 3917
531 nmdc:mga0rr50_421964_c1 3300050513 Bacteria 1128
532 nmdc:mga0rr50_81752_c1 3300050513 Bacteria 2494
533 nmdc:mga0a205_608831_c1 3300050515 Bacteria 945
534 nmdc:mga0a205_7946_c1 3300050515 Bacteria 9633
535 Ga0495601_0130097 3300053077 Bacteria 1639
536 Ga0495601_0314212 3300053077 Bacteria 1020
537 Ga0495601_0458107 3300053077 Bacteria 824
538 Ga0495612_0276539 3300053078 Bacteria 750
539 Ga0495595_0087970 3300053084 Bacteria 1487
540 Ga0495595_0126791 3300053084 Bacteria 1246
541 Ga0495595_0449382 3300053084 Bacteria 655
542 Ga0495619_0028928 3300053085 Bacteria 3577
543 Ga0495619_0120908 3300053085 Bacteria 1795
544 Ga0500627_0065738 3300053158 Bacteria 1601
545 Ga0501084_0158530 3300054114 Bacteria 1909
546 Ga0501084_0382758 3300054114 Bacteria 1189
547 Ga0501084_0567236 3300054114 Bacteria 959
548 Ga0501084_0587879 3300054114 Bacteria 941
549 Ga0501082_0000175 3300060353 Bacteria 55693
550 Ga0501082_0025769 3300060353 Bacteria 5067
551 Ga0501082_0777264 3300060353 Bacteria 838
552 Ga0530510_0124765 3300061734 Bacteria 1892
553 Ga0530510_0168670 3300061734 Bacteria 1621
554 Ga0530510_0381345 3300061734 Bacteria 1061

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100545661 Ga0068868_1005456612 159
2 3300005356 Ga0070674_100313514 Ga0070674_1003135142 159
3 3300005441 Ga0070700_100372754 Ga0070700_1003727541 159
4 3300005455 Ga0070663_100719042 Ga0070663_1007190421 159
5 3300005471 Ga0070698_100157339 Ga0070698_1001573392 159
6 3300005545 Ga0070695_100036074 Ga0070695_1000360742 159
7 3300005719 Ga0068861_100217549 Ga0068861_1002175492 159
8 3300006881 Ga0068865_100286237 Ga0068865_1002862372 159
9 3300009098 Ga0105245_10121568 Ga0105245_101215682 159
10 3300025904 Ga0207647_10335311 Ga0207647_103353112 159
11 3300025919 Ga0207657_10831983 Ga0207657_108319832 159
12 3300025927 Ga0207687_10071817 Ga0207687_100718172 159
13 3300025938 Ga0207704_10875408 Ga0207704_108754082 159
14 3300026023 Ga0207677_10255122 Ga0207677_102551221 159
15 3300026118 Ga0207675_100199934 Ga0207675_1001999342 159
16 3300026121 Ga0207683_10532518 Ga0207683_105325181 159
17 3300042876 Ga0451577_0645945 Ga0451577_0645945_254_742 159
18 3300048910 Ga0496107_0609893 Ga0496107_0609893_258_740 159
19 3300050507 nmdc:mga05p37_788772_c1 nmdc:mga05p37_788772_c1_351_839 159
20 3300005331 Ga0070670_101074107 Ga0070670_1010741071 160
21 3300005340 Ga0070689_100150680 Ga0070689_1001506802 160
22 3300005340 Ga0070689_101089065 Ga0070689_1010890651 160
23 3300005341 Ga0070691_10010824 Ga0070691_100108242 160
24 3300005434 Ga0070709_10031167 Ga0070709_100311673 160
25 3300005435 Ga0070714_100010663 Ga0070714_1000106634 160
26 3300005435 Ga0070714_100028935 Ga0070714_1000289353 160
27 3300005435 Ga0070714_100781935 Ga0070714_1007819351 160
28 3300005436 Ga0070713_100073884 Ga0070713_1000738842 160
29 3300005436 Ga0070713_100317312 Ga0070713_1003173122 160
30 3300005436 Ga0070713_101123391 Ga0070713_1011233911 160
31 3300005437 Ga0070710_10011836 Ga0070710_100118362 160
32 3300005439 Ga0070711_100027455 Ga0070711_1000274554 160
33 3300005439 Ga0070711_100055898 Ga0070711_1000558983 160
34 3300005439 Ga0070711_100426560 Ga0070711_1004265602 160
35 3300005444 Ga0070694_100005533 Ga0070694_1000055334 160
36 3300005445 Ga0070708_100071584 Ga0070708_1000715842 160
37 3300005445 Ga0070708_100601574 Ga0070708_1006015741 160
38 3300005445 Ga0070708_100644944 Ga0070708_1006449442 160
39 3300005471 Ga0070698_100363408 Ga0070698_1003634082 160
40 3300005471 Ga0070698_100367145 Ga0070698_1003671452 160
41 3300005518 Ga0070699_100003596 Ga0070699_10000359618 160
42 3300005536 Ga0070697_100224989 Ga0070697_1002249892 160
43 3300005536 Ga0070697_100452588 Ga0070697_1004525881 160
44 3300005548 Ga0070665_100700410 Ga0070665_1007004101 160
45 3300005577 Ga0068857_101717072 Ga0068857_1017170721 160
46 3300005615 Ga0070702_100075722 Ga0070702_1000757222 160
47 3300005719 Ga0068861_100218303 Ga0068861_1002183032 160
48 3300005937 Ga0081455_10000833 Ga0081455_1000083333 160
49 3300005937 Ga0081455_10001744 Ga0081455_1000174413 160
50 3300005937 Ga0081455_10048929 Ga0081455_100489292 160
51 3300005937 Ga0081455_10068809 Ga0081455_100688093 160
52 3300005937 Ga0081455_10670284 Ga0081455_106702841 160
53 3300005981 Ga0081538_10000477 Ga0081538_1000047724 160
54 3300005981 Ga0081538_10040352 Ga0081538_100403522 160
55 3300005983 Ga0081540_1000066 Ga0081540_100006639 160
56 3300005983 Ga0081540_1075323 Ga0081540_10753232 160
57 3300005983 Ga0081540_1089050 Ga0081540_10890502 160
58 3300005983 Ga0081540_1089689 Ga0081540_10896892 160
59 3300005983 Ga0081540_1301956 Ga0081540_13019561 160
60 3300005985 Ga0081539_10027262 Ga0081539_100272626 160
61 3300005985 Ga0081539_10114855 Ga0081539_101148552 160
62 3300006028 Ga0070717_10011195 Ga0070717_100111953 160
63 3300006028 Ga0070717_10078478 Ga0070717_100784784 160
64 3300006028 Ga0070717_10128913 Ga0070717_101289132 160
65 3300006028 Ga0070717_11338330 Ga0070717_113383301 160
66 3300006048 Ga0075363_100234484 Ga0075363_1002344841 160
67 3300006163 Ga0070715_10016789 Ga0070715_100167892 160
68 3300006163 Ga0070715_10046392 Ga0070715_100463922 160
69 3300006173 Ga0070716_100026220 Ga0070716_1000262203 160
70 3300006175 Ga0070712_100102950 Ga0070712_1001029502 160
71 3300006175 Ga0070712_100130303 Ga0070712_1001303032 160
72 3300006175 Ga0070712_100209924 Ga0070712_1002099242 160
73 3300006175 Ga0070712_100413975 Ga0070712_1004139752 160
74 3300006175 Ga0070712_100720213 Ga0070712_1007202131 160
75 3300006358 Ga0068871_100584459 Ga0068871_1005844592 160
76 3300006844 Ga0075428_100012713 Ga0075428_1000127136 160
77 3300006844 Ga0075428_100344656 Ga0075428_1003446563 160
78 3300006844 Ga0075428_100654118 Ga0075428_1006541182 160
79 3300006846 Ga0075430_100036944 Ga0075430_1000369442 160
80 3300006846 Ga0075430_100507158 Ga0075430_1005071582 160
81 3300006847 Ga0075431_100043012 Ga0075431_1000430122 160
82 3300006847 Ga0075431_100123672 Ga0075431_1001236722 160
83 3300006847 Ga0075431_100708654 Ga0075431_1007086542 160
84 3300006847 Ga0075431_101644557 Ga0075431_1016445571 160
85 3300006852 Ga0075433_10016781 Ga0075433_100167813 160
86 3300006852 Ga0075433_10067174 Ga0075433_100671744 160
87 3300006871 Ga0075434_100003615 Ga0075434_10000361513 160
88 3300006871 Ga0075434_100005126 Ga0075434_1000051269 160
89 3300006871 Ga0075434_100033616 Ga0075434_1000336164 160
90 3300006871 Ga0075434_100190414 Ga0075434_1001904142 160
91 3300006871 Ga0075434_100458733 Ga0075434_1004587331 160
92 3300006871 Ga0075434_100799227 Ga0075434_1007992271 160
93 3300006880 Ga0075429_100052078 Ga0075429_1000520783 160
94 3300006880 Ga0075429_100321470 Ga0075429_1003214702 160
95 3300007076 Ga0075435_100009708 Ga0075435_1000097085 160
96 3300007076 Ga0075435_100079765 Ga0075435_1000797652 160
97 3300007076 Ga0075435_100102085 Ga0075435_1001020852 160
98 3300007076 Ga0075435_100809891 Ga0075435_1008098911 160
99 3300007788 Ga0099795_10130477 Ga0099795_101304772 160
100 3300009094 Ga0111539_10012212 Ga0111539_100122122 160
101 3300009094 Ga0111539_11822123 Ga0111539_118221232 160
102 3300009147 Ga0114129_10005944 Ga0114129_100059443 160
103 3300009147 Ga0114129_10138418 Ga0114129_101384182 160
104 3300009147 Ga0114129_10911259 Ga0114129_109112591 160
105 3300010159 Ga0099796_10031110 Ga0099796_100311102 160
106 3300010159 Ga0099796_10166528 Ga0099796_101665282 160
107 3300014326 Ga0157380_10048109 Ga0157380_100481093 160
108 3300014969 Ga0157376_10157545 Ga0157376_101575452 160
109 3300014969 Ga0157376_10259940 Ga0157376_102599403 160
110 3300017792 Ga0163161_10316198 Ga0163161_103161982 160
111 3300021377 Ga0213874_10164247 Ga0213874_101642472 160
112 3300021384 Ga0213876_10276364 Ga0213876_102763642 160
113 3300021388 Ga0213875_10000003 Ga0213875_10000003348 160
114 3300024225 Ga0224572_1066899 Ga0224572_10668992 160
115 3300024227 Ga0228598_1000419 Ga0228598_10004192 160
116 3300025905 Ga0207685_10018416 Ga0207685_100184162 160
117 3300025906 Ga0207699_10020215 Ga0207699_100202152 160
118 3300025910 Ga0207684_10242649 Ga0207684_102426492 160
119 3300025910 Ga0207684_10422540 Ga0207684_104225402 160
120 3300025915 Ga0207693_10003443 Ga0207693_100034438 160
121 3300025915 Ga0207693_10015430 Ga0207693_100154303 160
122 3300025916 Ga0207663_10049315 Ga0207663_100493152 160
123 3300025916 Ga0207663_10087850 Ga0207663_100878502 160
124 3300025916 Ga0207663_10342748 Ga0207663_103427482 160
125 3300025922 Ga0207646_10246635 Ga0207646_102466352 160
126 3300025928 Ga0207700_10130587 Ga0207700_101305871 160
127 3300025928 Ga0207700_10252674 Ga0207700_102526742 160
128 3300025929 Ga0207664_10012312 Ga0207664_100123123 160
129 3300025929 Ga0207664_10306776 Ga0207664_103067762 160
130 3300025936 Ga0207670_10031265 Ga0207670_100312651 160
131 3300025939 Ga0207665_10000206 Ga0207665_1000020634 160
132 3300025939 Ga0207665_10212645 Ga0207665_102126452 160
133 3300026116 Ga0207674_11088967 Ga0207674_110889671 160
134 3300026118 Ga0207675_100169632 Ga0207675_1001696322 160
135 3300027907 Ga0207428_10236531 Ga0207428_102365312 160
136 3300028800 Ga0265338_10013501 Ga0265338_100135016 160
137 3300029957 Ga0265324_10159851 Ga0265324_101598512 160
138 3300031090 Ga0265760_10110053 Ga0265760_101100531 160
139 3300031241 Ga0265325_10017407 Ga0265325_100174072 160
140 3300031249 Ga0265339_10000228 Ga0265339_1000022816 160
141 3300031595 Ga0265313_10000203 Ga0265313_1000020311 160
142 3300031595 Ga0265313_10000917 Ga0265313_1000091719 160
143 3300031711 Ga0265314_10016002 Ga0265314_100160026 160
144 3300034816 Ga0373930_0120040 Ga0373930_0120040_16_501 160
145 3300034817 Ga0373948_0008236 Ga0373948_0008236_1268_1753 160
146 3300035084 Ga0373928_0012687 Ga0373928_0012687_226_708 160
147 3300035084 Ga0373928_0037313 Ga0373928_0037313_476_961 160
148 3300035085 Ga0373929_0026350 Ga0373929_0026350_73_558 160
149 3300035085 Ga0373929_0077876 Ga0373929_0077876_289_774 160
150 3300035088 Ga0373940_0032303 Ga0373940_0032303_577_1059 160
151 3300035090 Ga0373949_0004006 Ga0373949_0004006_29_514 160
152 3300035090 Ga0373949_0158054 Ga0373949_0158054_120_602 160
153 3300035091 Ga0373951_0040869 Ga0373951_0040869_569_1054 160
154 3300035114 Ga0373939_0004832 Ga0373939_0004832_1511_1996 160
155 3300035115 Ga0373941_0002530 Ga0373941_0002530_2099_2584 160
156 3300035115 Ga0373941_0018703 Ga0373941_0018703_111_593 160
157 3300035118 Ga0373954_0081201 Ga0373954_0081201_866_1348 160
158 3300035121 Ga0373960_0005948 Ga0373960_0005948_1307_1792 160
159 3300035241 Ga0373961_0004077 Ga0373961_0004077_2088_2573 160
160 3300035242 Ga0373962_0007558 Ga0373962_0007558_1930_2415 160
161 3300035691 Ga0373931_0005252 Ga0373931_0005252_3361_3843 160
162 3300035691 Ga0373931_0006571 Ga0373931_0006571_1952_2437 160
163 3300035691 Ga0373931_0668146 Ga0373931_0668146_29_511 160
164 3300035695 Ga0373927_0107157 Ga0373927_0107157_706_1188 160
165 3300035724 Ga0373933_0037080 Ga0373933_0037080_342_824 160
166 3300035725 Ga0373947_0195982 Ga0373947_0195982_366_848 160
167 3300036401 Ga0373937_0492532 Ga0373937_0492532_63_545 160
168 3300037068 Ga0373925_0064431 Ga0373925_0064431_2236_2718 160
169 3300037068 Ga0373925_0353070 Ga0373925_0353070_141_623 160
170 3300037471 Ga0395905_0214714 Ga0395905_0214714_505_1002 160
171 3300037853 Ga0436364_0191605 Ga0436364_0191605_22615_23097 160
172 3300039437 Ga0436365_0569625 Ga0436365_0569625_92_574 160
173 3300039437 Ga0436365_0684505 Ga0436365_0684505_275_757 160
174 3300039437 Ga0436365_0688201 Ga0436365_0688201_187_672 160
175 3300039437 Ga0436365_1524923 Ga0436365_1524923_93_575 160
176 3300039437 Ga0436365_1858544 Ga0436365_1858544_30_512 160
177 3300039438 Ga0436360_0351713 Ga0436360_0351713_640_1122 160
178 3300039447 Ga0436361_1075969 Ga0436361_1075969_75_557 160
179 3300039450 Ga0436363_0608712 Ga0436363_0608712_23_505 160
180 3300039450 Ga0436363_1468080 Ga0436363_1468080_1236_1718 160
181 3300039453 Ga0436362_0521384 Ga0436362_0521384_347_829 160
182 3300042008 Ga0439450_141532 Ga0439450_141532_29_511 160
183 3300045976 Ga0466967_0910938 Ga0466967_0910938_360_842 160
184 3300046454 Ga0495592_0318118 Ga0495592_0318118_281_763 160
185 3300046455 Ga0495603_0188732 Ga0495603_0188732_105_587 160
186 3300046457 Ga0495590_0014214 Ga0495590_0014214_1975_2463 160
187 3300046459 Ga0495629_0372416 Ga0495629_0372416_88_570 160
188 3300046460 Ga0495638_0257434 Ga0495638_0257434_274_762 160
189 3300046461 Ga0495641_0105084 Ga0495641_0105084_41_523 160
190 3300046473 Ga0495582_0069021 Ga0495582_0069021_1163_1645 160
191 3300046491 Ga0495584_0056689 Ga0495584_0056689_159_641 160
192 3300046491 Ga0495584_0136964 Ga0495584_0136964_642_1127 160
193 3300046491 Ga0495584_0177149 Ga0495584_0177149_435_923 160
194 3300046514 Ga0495618_0262581 Ga0495618_0262581_160_642 160
195 3300046517 Ga0495630_1249366 Ga0495630_1249366_32_514 160
196 3300046520 Ga0495637_0270660 Ga0495637_0270660_65_547 160
197 3300046529 Ga0495652_0140164 Ga0495652_0140164_352_834 160
198 3300046533 Ga0495640_0133337 Ga0495640_0133337_957_1439 160
199 3300046535 Ga0495586_0128412 Ga0495586_0128412_695_1177 160
200 3300046535 Ga0495586_0167799 Ga0495586_0167799_378_860 160
201 3300046536 Ga0495587_0117666 Ga0495587_0117666_509_991 160
202 3300046538 Ga0495609_0325428 Ga0495609_0325428_51_536 160
203 3300046543 Ga0495645_0059971 Ga0495645_0059971_1567_2049 160
204 3300046615 Ga0495656_0113645 Ga0495656_0113645_611_1093 160
205 3300046615 Ga0495656_0175708 Ga0495656_0175708_360_848 160
206 3300046664 Ga0495659_0176571 Ga0495659_0176571_174_659 160
207 3300046678 Ga0495599_0037983 Ga0495599_0037983_1798_2280 160
208 3300046679 Ga0495623_0006581 Ga0495623_0006581_1725_2207 160
209 3300046681 Ga0495647_0080707 Ga0495647_0080707_336_818 160
210 3300046683 Ga0495658_0090738 Ga0495658_0090738_344_826 160
211 3300046683 Ga0495658_0338771 Ga0495658_0338771_209_691 160
212 3300046689 Ga0495613_0155398 Ga0495613_0155398_410_892 160
213 3300046694 Ga0495649_0277478 Ga0495649_0277478_313_801 160
214 3300046809 Ga0495600_0154425 Ga0495600_0154425_131_613 160
215 3300047317 Ga0495604_0164648 Ga0495604_0164648_1048_1530 160
216 3300047471 Ga0495684_0553142 Ga0495684_0553142_32_514 160
217 3300047673 Ga0495593_0379221 Ga0495593_0379221_214_696 160
218 3300048903 Ga0496100_0301266 Ga0496100_0301266_312_794 160
219 3300048907 Ga0496104_0000833 Ga0496104_0000833_14901_15383 160
220 3300048907 Ga0496104_0006728 Ga0496104_0006728_5036_5524 160
221 3300048907 Ga0496104_0016526 Ga0496104_0016526_226_708 160
222 3300048908 Ga0496105_0025499 Ga0496105_0025499_2055_2537 160
223 3300048908 Ga0496105_0141245 Ga0496105_0141245_1124_1606 160
224 3300048908 Ga0496105_0309736 Ga0496105_0309736_152_634 160
225 3300048909 Ga0496106_0064524 Ga0496106_0064524_2054_2536 160
226 3300048909 Ga0496106_0181844 Ga0496106_0181844_989_1471 160
227 3300048909 Ga0496106_0735988 Ga0496106_0735988_244_726 160
228 3300048910 Ga0496107_0115071 Ga0496107_0115071_394_876 160
229 3300048910 Ga0496107_0369291 Ga0496107_0369291_571_1053 160
230 3300048911 Ga0496108_0012371 Ga0496108_0012371_3858_4346 160
231 3300048911 Ga0496108_0018391 Ga0496108_0018391_4924_5406 160
232 3300048911 Ga0496108_0187761 Ga0496108_0187761_113_595 160
233 3300048912 Ga0496109_0006247 Ga0496109_0006247_3116_3604 160
234 3300048912 Ga0496109_1315304 Ga0496109_1315304_144_626 160
235 3300048913 Ga0496110_0003027 Ga0496110_0003027_8597_9085 160
236 3300048913 Ga0496110_0093959 Ga0496110_0093959_2086_2568 160
237 3300048913 Ga0496110_0231222 Ga0496110_0231222_706_1188 160
238 3300048913 Ga0496110_1211004 Ga0496110_1211004_133_615 160
239 3300048914 Ga0496111_0028102 Ga0496111_0028102_522_1010 160
240 3300048914 Ga0496111_0205820 Ga0496111_0205820_477_965 160
241 3300048915 Ga0496112_0209683 Ga0496112_0209683_1052_1540 160
242 3300048915 Ga0496112_0543300 Ga0496112_0543300_234_716 160
243 3300048915 Ga0496112_0715378 Ga0496112_0715378_224_706 160
244 3300048916 Ga0496113_0006125 Ga0496113_0006125_4654_5142 160
245 3300048916 Ga0496113_1186382 Ga0496113_1186382_100_582 160
246 3300048917 Ga0496114_0407443 Ga0496114_0407443_99_581 160
247 3300048917 Ga0496114_0577638 Ga0496114_0577638_37_519 160
248 3300048918 Ga0496115_0292910 Ga0496115_0292910_91_573 160
249 3300049572 Ga0501036_0117364 Ga0501036_0117364_781_1263 160
250 3300049574 Ga0501038_0339456 Ga0501038_0339456_142_624 160
251 3300049575 Ga0501039_0258813 Ga0501039_0258813_81_563 160
252 3300049575 Ga0501039_1130813 Ga0501039_1130813_114_596 160
253 3300049577 Ga0501041_0325486 Ga0501041_0325486_292_774 160
254 3300049577 Ga0501041_0564189 Ga0501041_0564189_38_520 160
255 3300049580 Ga0501046_1074837 Ga0501046_1074837_45_527 160
256 3300049584 Ga0501068_0691681 Ga0501068_0691681_13_495 160
257 3300049586 Ga0501070_0563498 Ga0501070_0563498_370_855 160
258 3300049587 Ga0501071_1002260 Ga0501071_1002260_118_600 160
259 3300049588 Ga0501072_0297934 Ga0501072_0297934_607_1089 160
260 3300049589 Ga0501073_0055597 Ga0501073_0055597_79_561 160
261 3300049590 Ga0501074_0533581 Ga0501074_0533581_227_709 160
262 3300049591 Ga0501075_0104941 Ga0501075_0104941_1357_1839 160
263 3300049591 Ga0501075_0311622 Ga0501075_0311622_10_498 160
264 3300049592 Ga0501076_0358068 Ga0501076_0358068_408_890 160
265 3300049592 Ga0501076_0362124 Ga0501076_0362124_251_733 160
266 3300049741 Ga0501079_0549055 Ga0501079_0549055_348_830 160
267 3300049741 Ga0501079_0688118 Ga0501079_0688118_73_555 160
268 3300049742 Ga0501080_0801837 Ga0501080_0801837_19_507 160
269 3300049824 Ga0501045_0402232 Ga0501045_0402232_29_511 160
270 3300050493 nmdc:mga0k408_455676_c1 nmdc:mga0k408_455676_c1_232_714 160
271 3300050507 nmdc:mga05p37_16059_c1 nmdc:mga05p37_16059_c1_2636_3118 160
272 3300050507 nmdc:mga05p37_656148_c1 nmdc:mga05p37_656148_c1_280_765 160
273 3300050507 nmdc:mga05p37_677646_c1 nmdc:mga05p37_677646_c1_422_904 160
274 3300050508 nmdc:mga09592_415198_c1 nmdc:mga09592_415198_c1_288_770 160
275 3300050509 nmdc:mga0qj67_600011_c1 nmdc:mga0qj67_600011_c1_181_663 160
276 3300050510 nmdc:mga06r32_35928_c1 nmdc:mga06r32_35928_c1_511_999 160
277 3300050510 nmdc:mga06r32_494828_c1 nmdc:mga06r32_494828_c1_576_1058 160
278 3300050510 nmdc:mga06r32_533586_c1 nmdc:mga06r32_533586_c1_211_693 160
279 3300050510 nmdc:mga06r32_800997_c1 nmdc:mga06r32_800997_c1_396_878 160
280 3300050511 nmdc:mga08y16_1168804_c1 nmdc:mga08y16_1168804_c1_171_656 160
281 3300050512 nmdc:mga0n895_1183_c1 nmdc:mga0n895_1183_c1_15737_16225 160
282 3300050512 nmdc:mga0n895_203391_c1 nmdc:mga0n895_203391_c1_101_583 160
283 3300050512 nmdc:mga0n895_217748_c1 nmdc:mga0n895_217748_c1_1196_1681 160
284 3300050512 nmdc:mga0n895_227161_c1 nmdc:mga0n895_227161_c1_1224_1706 160
285 3300050512 nmdc:mga0n895_588001_c1 nmdc:mga0n895_588001_c1_343_825 160
286 3300050513 nmdc:mga0rr50_1109508_c1 nmdc:mga0rr50_1109508_c1_14_496 160
287 3300050513 nmdc:mga0rr50_156016_c1 nmdc:mga0rr50_156016_c1_877_1359 160
288 3300050513 nmdc:mga0rr50_19486_c1 nmdc:mga0rr50_19486_c1_2235_2720 160
289 3300050513 nmdc:mga0rr50_81752_c1 nmdc:mga0rr50_81752_c1_823_1311 160
290 3300050515 nmdc:mga0a205_608831_c1 nmdc:mga0a205_608831_c1_111_593 160
291 3300050515 nmdc:mga0a205_7946_c1 nmdc:mga0a205_7946_c1_3863_4348 160
292 3300053077 Ga0495601_0314212 Ga0495601_0314212_374_856 160
293 3300053077 Ga0495601_0458107 Ga0495601_0458107_158_640 160
294 3300053078 Ga0495612_0276539 Ga0495612_0276539_129_611 160
295 3300053084 Ga0495595_0087970 Ga0495595_0087970_768_1250 160
296 3300053085 Ga0495619_0028928 Ga0495619_0028928_2875_3357 160
297 3300053085 Ga0495619_0120908 Ga0495619_0120908_427_909 160
298 3300054114 Ga0501084_0158530 Ga0501084_0158530_41_523 160
299 3300054114 Ga0501084_0382758 Ga0501084_0382758_364_846 160
300 3300054114 Ga0501084_0567236 Ga0501084_0567236_415_897 160
301 3300054114 Ga0501084_0587879 Ga0501084_0587879_355_837 160
302 3300060353 Ga0501082_0000175 Ga0501082_0000175_33332_33814 160
303 3300060353 Ga0501082_0025769 Ga0501082_0025769_3655_4137 160
304 3300060353 Ga0501082_0777264 Ga0501082_0777264_70_552 160
305 3300061734 Ga0530510_0124765 Ga0530510_0124765_153_635 160
306 3300061734 Ga0530510_0168670 Ga0530510_0168670_588_1070 160
307 3300061734 Ga0530510_0381345 Ga0530510_0381345_204_686 160
308 3300049593 Ga0501077_0309204 Ga0501077_0309204_34_519 161
309 3300006175 Ga0070712_100001496 Ga0070712_1000014968 162
310 3300025915 Ga0207693_10017237 Ga0207693_100172376 162
311 3300050508 nmdc:mga09592_413294_c1 nmdc:mga09592_413294_c1_538_1044 162
312 3300050509 nmdc:mga0qj67_398164_c1 nmdc:mga0qj67_398164_c1_221_727 162
313 3300001977 JGI24746J21847_1003822 JGI24746J21847_10038222 164
314 3300001990 JGI24737J22298_10041117 JGI24737J22298_100411172 164
315 3300001991 JGI24743J22301_10000566 JGI24743J22301_100005662 164
316 3300002070 JGI24750J21931_1001645 JGI24750J21931_10016453 164
317 3300002073 JGI24745J21846_1001606 JGI24745J21846_10016062 164
318 3300002077 JGI24744J21845_10007865 JGI24744J21845_100078652 164
319 3300002155 JGI24033J26618_1009974 JGI24033J26618_10099741 164
320 3300002239 JGI24034J26672_10010530 JGI24034J26672_100105302 164
321 3300002244 JGI24742J22300_10001659 JGI24742J22300_100016594 164
322 3300002459 JGI24751J29686_10006542 JGI24751J29686_100065422 164
323 3300005329 Ga0070683_100414667 Ga0070683_1004146672 164
324 3300005330 Ga0070690_100028954 Ga0070690_1000289544 164
325 3300005331 Ga0070670_100047454 Ga0070670_1000474542 164
326 3300005331 Ga0070670_100057256 Ga0070670_1000572562 164
327 3300005335 Ga0070666_10051697 Ga0070666_100516972 164
328 3300005337 Ga0070682_100248191 Ga0070682_1002481912 164
329 3300005338 Ga0068868_100002061 Ga0068868_1000020616 164
330 3300005339 Ga0070660_100307966 Ga0070660_1003079662 164
331 3300005340 Ga0070689_100011043 Ga0070689_1000110437 164
332 3300005341 Ga0070691_10062938 Ga0070691_100629382 164
333 3300005343 Ga0070687_100040738 Ga0070687_1000407382 164
334 3300005345 Ga0070692_10026449 Ga0070692_100264492 164
335 3300005347 Ga0070668_100015764 Ga0070668_1000157646 164
336 3300005353 Ga0070669_100037777 Ga0070669_1000377772 164
337 3300005354 Ga0070675_100118630 Ga0070675_1001186302 164
338 3300005355 Ga0070671_100021615 Ga0070671_1000216153 164
339 3300005356 Ga0070674_100240015 Ga0070674_1002400152 164
340 3300005364 Ga0070673_100335467 Ga0070673_1003354672 164
341 3300005366 Ga0070659_100078632 Ga0070659_1000786322 164
342 3300005367 Ga0070667_100015732 Ga0070667_1000157323 164
343 3300005436 Ga0070713_100450472 Ga0070713_1004504722 164
344 3300005437 Ga0070710_10092912 Ga0070710_100929121 164
345 3300005438 Ga0070701_10029660 Ga0070701_100296604 164
346 3300005440 Ga0070705_100463116 Ga0070705_1004631162 164
347 3300005441 Ga0070700_100002511 Ga0070700_1000025113 164
348 3300005455 Ga0070663_100035302 Ga0070663_1000353022 164
349 3300005457 Ga0070662_100200370 Ga0070662_1002003701 164
350 3300005466 Ga0070685_10047425 Ga0070685_100474252 164
351 3300005530 Ga0070679_101219027 Ga0070679_1012190272 164
352 3300005535 Ga0070684_100150888 Ga0070684_1001508882 164
353 3300005539 Ga0068853_100158346 Ga0068853_1001583462 164
354 3300005543 Ga0070672_100086369 Ga0070672_1000863692 164
355 3300005546 Ga0070696_100738048 Ga0070696_1007380481 164
356 3300005547 Ga0070693_100128278 Ga0070693_1001282782 164
357 3300005548 Ga0070665_100299988 Ga0070665_1002999882 164
358 3300005549 Ga0070704_100349515 Ga0070704_1003495152 164
359 3300005564 Ga0070664_100122991 Ga0070664_1001229912 164
360 3300005578 Ga0068854_100041784 Ga0068854_1000417842 164
361 3300005614 Ga0068856_100202442 Ga0068856_1002024422 164
362 3300005615 Ga0070702_100082177 Ga0070702_1000821772 164
363 3300005616 Ga0068852_100143228 Ga0068852_1001432282 164
364 3300005618 Ga0068864_100014519 Ga0068864_1000145195 164
365 3300005618 Ga0068864_100641314 Ga0068864_1006413142 164
366 3300005718 Ga0068866_10155508 Ga0068866_101555082 164
367 3300005840 Ga0068870_10001098 Ga0068870_100010983 164
368 3300005841 Ga0068863_100034678 Ga0068863_1000346783 164
369 3300005842 Ga0068858_100128046 Ga0068858_1001280462 164
370 3300005937 Ga0081455_10015715 Ga0081455_100157152 164
371 3300005937 Ga0081455_10093440 Ga0081455_100934402 164
372 3300005981 Ga0081538_10006000 Ga0081538_100060006 164
373 3300005983 Ga0081540_1006683 Ga0081540_10066834 164
374 3300006028 Ga0070717_10151321 Ga0070717_101513212 164
375 3300006038 Ga0075365_10197931 Ga0075365_101979312 164
376 3300006038 Ga0075365_10235572 Ga0075365_102355722 164
377 3300006048 Ga0075363_100313666 Ga0075363_1003136662 164
378 3300006175 Ga0070712_100093273 Ga0070712_1000932732 164
379 3300006177 Ga0075362_10340198 Ga0075362_103401982 164
380 3300006237 Ga0097621_100291073 Ga0097621_1002910732 164
381 3300006358 Ga0068871_100066837 Ga0068871_1000668373 164
382 3300006844 Ga0075428_100061160 Ga0075428_1000611602 164
383 3300006844 Ga0075428_100343160 Ga0075428_1003431602 164
384 3300006846 Ga0075430_100830036 Ga0075430_1008300362 164
385 3300006847 Ga0075431_100236100 Ga0075431_1002361002 164
386 3300006847 Ga0075431_100329203 Ga0075431_1003292032 164
387 3300006847 Ga0075431_100939162 Ga0075431_1009391622 164
388 3300006871 Ga0075434_100196707 Ga0075434_1001967072 164
389 3300006880 Ga0075429_100277424 Ga0075429_1002774242 164
390 3300006881 Ga0068865_100010707 Ga0068865_1000107074 164
391 3300007076 Ga0075435_101254578 Ga0075435_1012545781 164
392 3300007788 Ga0099795_10334364 Ga0099795_103343641 164
393 3300009092 Ga0105250_10021342 Ga0105250_100213423 164
394 3300009094 Ga0111539_10120071 Ga0111539_101200713 164
395 3300009098 Ga0105245_10084593 Ga0105245_100845933 164
396 3300009147 Ga0114129_10025593 Ga0114129_100255938 164
397 3300009147 Ga0114129_10088285 Ga0114129_100882852 164
398 3300009147 Ga0114129_10915290 Ga0114129_109152902 164
399 3300009148 Ga0105243_10014819 Ga0105243_100148196 164
400 3300009174 Ga0105241_10946426 Ga0105241_109464262 164
401 3300009176 Ga0105242_10042996 Ga0105242_100429962 164
402 3300009177 Ga0105248_10007960 Ga0105248_1000796011 164
403 3300009177 Ga0105248_11850695 Ga0105248_118506951 164
404 3300009545 Ga0105237_10082617 Ga0105237_100826172 164
405 3300009553 Ga0105249_10060160 Ga0105249_100601602 164
406 3300009553 Ga0105249_10301413 Ga0105249_103014133 164
407 3300011119 Ga0105246_10235470 Ga0105246_102354702 164
408 3300011119 Ga0105246_10753197 Ga0105246_107531971 164
409 3300013102 Ga0157371_10176523 Ga0157371_101765232 164
410 3300013296 Ga0157374_10059435 Ga0157374_100594352 164
411 3300013306 Ga0163162_10151281 Ga0163162_101512812 164
412 3300013307 Ga0157372_10878927 Ga0157372_108789272 164
413 3300013308 Ga0157375_10184320 Ga0157375_101843202 164
414 3300014325 Ga0163163_10134042 Ga0163163_101340422 164
415 3300014325 Ga0163163_10139397 Ga0163163_101393972 164
416 3300014326 Ga0157380_10049760 Ga0157380_100497602 164
417 3300014745 Ga0157377_10041804 Ga0157377_100418042 164
418 3300014968 Ga0157379_10009784 Ga0157379_100097846 164
419 3300014969 Ga0157376_10373530 Ga0157376_103735302 164
420 3300017792 Ga0163161_10015993 Ga0163161_100159936 164
421 3300025321 Ga0207656_10191252 Ga0207656_101912521 164
422 3300025900 Ga0207710_10035504 Ga0207710_100355042 164
423 3300025901 Ga0207688_10000447 Ga0207688_1000044716 164
424 3300025903 Ga0207680_10583227 Ga0207680_105832271 164
425 3300025904 Ga0207647_10029917 Ga0207647_100299172 164
426 3300025907 Ga0207645_10012433 Ga0207645_100124332 164
427 3300025908 Ga0207643_10007556 Ga0207643_100075565 164
428 3300025915 Ga0207693_10093222 Ga0207693_100932222 164
429 3300025917 Ga0207660_10464408 Ga0207660_104644081 164
430 3300025918 Ga0207662_10000788 Ga0207662_1000078810 164
431 3300025919 Ga0207657_10035616 Ga0207657_100356162 164
432 3300025924 Ga0207694_10146939 Ga0207694_101469393 164
433 3300025925 Ga0207650_10098612 Ga0207650_100986122 164
434 3300025925 Ga0207650_10208466 Ga0207650_102084662 164
435 3300025926 Ga0207659_10061633 Ga0207659_100616333 164
436 3300025927 Ga0207687_10071608 Ga0207687_100716083 164
437 3300025928 Ga0207700_10226249 Ga0207700_102262492 164
438 3300025929 Ga0207664_10507250 Ga0207664_105072501 164
439 3300025933 Ga0207706_10009920 Ga0207706_100099204 164
440 3300025934 Ga0207686_10372230 Ga0207686_103722302 164
441 3300025935 Ga0207709_10010146 Ga0207709_100101462 164
442 3300025936 Ga0207670_10039032 Ga0207670_100390322 164
443 3300025937 Ga0207669_10023517 Ga0207669_100235173 164
444 3300025940 Ga0207691_10021871 Ga0207691_100218713 164
445 3300025941 Ga0207711_10054318 Ga0207711_100543182 164
446 3300025942 Ga0207689_10004078 Ga0207689_100040788 164
447 3300025944 Ga0207661_10207354 Ga0207661_102073542 164
448 3300025960 Ga0207651_10064018 Ga0207651_100640182 164
449 3300025961 Ga0207712_10011129 Ga0207712_100111294 164
450 3300025972 Ga0207668_10112583 Ga0207668_101125832 164
451 3300025981 Ga0207640_10019563 Ga0207640_100195635 164
452 3300025986 Ga0207658_10141832 Ga0207658_101418322 164
453 3300026023 Ga0207677_10060907 Ga0207677_100609072 164
454 3300026035 Ga0207703_10014624 Ga0207703_100146244 164
455 3300026041 Ga0207639_10041749 Ga0207639_100417492 164
456 3300026075 Ga0207708_10000823 Ga0207708_1000082310 164
457 3300026078 Ga0207702_10260632 Ga0207702_102606322 164
458 3300026088 Ga0207641_10034045 Ga0207641_100340452 164
459 3300026089 Ga0207648_10001310 Ga0207648_1000131015 164
460 3300026095 Ga0207676_10089955 Ga0207676_100899553 164
461 3300026116 Ga0207674_10208427 Ga0207674_102084272 164
462 3300026118 Ga0207675_100029093 Ga0207675_1000290932 164
463 3300026121 Ga0207683_10014866 Ga0207683_100148665 164
464 3300026142 Ga0207698_10010459 Ga0207698_100104593 164
465 3300027907 Ga0207428_10823578 Ga0207428_108235782 164
466 3300028379 Ga0268266_10112426 Ga0268266_101124262 164
467 3300028380 Ga0268265_10160789 Ga0268265_101607892 164
468 3300034819 Ga0373958_0006521 Ga0373958_0006521_713_1279 164
469 3300035112 Ga0373932_0006337 Ga0373932_0006337_363_929 164
470 3300035114 Ga0373939_0311153 Ga0373939_0311153_42_536 164
471 3300035115 Ga0373941_0043678 Ga0373941_0043678_25_591 164
472 3300035242 Ga0373962_0002894 Ga0373962_0002894_2104_2670 164
473 3300035691 Ga0373931_0000445 Ga0373931_0000445_13554_14120 164
474 3300035691 Ga0373931_0039433 Ga0373931_0039433_17_511 164
475 3300035691 Ga0373931_0635461 Ga0373931_0635461_74_622 164
476 3300036401 Ga0373937_0587929 Ga0373937_0587929_543_1037 164
477 3300041512 Ga0451853_0731668 Ga0451853_0731668_406_954 164
478 3300046459 Ga0495629_0057438 Ga0495629_0057438_63_557 164
479 3300046471 Ga0495650_0145211 Ga0495650_0145211_241_789 164
480 3300046476 Ga0495662_0419433 Ga0495662_0419433_13_561 164
481 3300046491 Ga0495584_0193380 Ga0495584_0193380_55_558 164
482 3300046492 Ga0495585_0479365 Ga0495585_0479365_79_573 164
483 3300046501 Ga0495607_0096747 Ga0495607_0096747_998_1501 164
484 3300046518 Ga0495631_0269742 Ga0495631_0269742_52_600 164
485 3300046519 Ga0495632_0232899 Ga0495632_0232899_152_646 164
486 3300046531 Ga0495665_0150064 Ga0495665_0150064_698_1192 164
487 3300046533 Ga0495640_0364738 Ga0495640_0364738_11_505 164
488 3300046615 Ga0495656_0033621 Ga0495656_0033621_643_1146 164
489 3300046642 Ga0495634_0045179 Ga0495634_0045179_1142_1636 164
490 3300046660 Ga0495625_0433809 Ga0495625_0433809_120_614 164
491 3300046810 Ga0495660_0039750 Ga0495660_0039750_1927_2475 164
492 3300047320 Ga0495672_0090793 Ga0495672_0090793_987_1496 164
493 3300047322 Ga0495680_0072104 Ga0495680_0072104_1016_1510 164
494 3300047471 Ga0495684_0410693 Ga0495684_0410693_409_903 164
495 3300047472 Ga0495686_0623250 Ga0495686_0623250_14_508 164
496 3300047673 Ga0495593_0091987 Ga0495593_0091987_133_627 164
497 3300048090 Ga0495615_0013196 Ga0495615_0013196_18_566 164
498 3300048903 Ga0496100_0025958 Ga0496100_0025958_2554_3048 164
499 3300048903 Ga0496100_0031483 Ga0496100_0031483_1667_2161 164
500 3300048904 Ga0496101_0014604 Ga0496101_0014604_4227_4775 164
501 3300048904 Ga0496101_0032209 Ga0496101_0032209_29_523 164
502 3300048905 Ga0496102_0036614 Ga0496102_0036614_1478_2026 164
503 3300048905 Ga0496102_0123873 Ga0496102_0123873_947_1441 164
504 3300048905 Ga0496102_0296378 Ga0496102_0296378_863_1384 164
505 3300048906 Ga0496103_0001303 Ga0496103_0001303_10933_11481 164
506 3300048906 Ga0496103_0004456 Ga0496103_0004456_4298_4792 164
507 3300048907 Ga0496104_0016928 Ga0496104_0016928_374_868 164
508 3300048908 Ga0496105_0001940 Ga0496105_0001940_5896_6444 164
509 3300048908 Ga0496105_0095147 Ga0496105_0095147_46_540 164
510 3300048909 Ga0496106_0001089 Ga0496106_0001089_12543_13091 164
511 3300048909 Ga0496106_0023496 Ga0496106_0023496_1570_2091 164
512 3300048909 Ga0496106_0191210 Ga0496106_0191210_340_834 164
513 3300048910 Ga0496107_0349760 Ga0496107_0349760_401_922 164
514 3300048911 Ga0496108_0000775 Ga0496108_0000775_19670_20164 164
515 3300048911 Ga0496108_0012564 Ga0496108_0012564_1103_1651 164
516 3300048913 Ga0496110_0006963 Ga0496110_0006963_8448_8942 164
517 3300048913 Ga0496110_0099819 Ga0496110_0099819_327_887 164
518 3300048914 Ga0496111_0001603 Ga0496111_0001603_11751_12299 164
519 3300048914 Ga0496111_0039934 Ga0496111_0039934_1894_2388 164
520 3300048915 Ga0496112_0017309 Ga0496112_0017309_777_1271 164
521 3300048915 Ga0496112_0045865 Ga0496112_0045865_849_1397 164
522 3300048916 Ga0496113_0000524 Ga0496113_0000524_16762_17310 164
523 3300048916 Ga0496113_0003988 Ga0496113_0003988_5532_6026 164
524 3300048917 Ga0496114_0017299 Ga0496114_0017299_1171_1719 164
525 3300048917 Ga0496114_0193847 Ga0496114_0193847_711_1205 164
526 3300048918 Ga0496115_0018841 Ga0496115_0018841_783_1331 164
527 3300048918 Ga0496115_0041842 Ga0496115_0041842_2518_3012 164
528 3300048918 Ga0496115_0152666 Ga0496115_0152666_816_1364 164
529 3300049584 Ga0501068_0591648 Ga0501068_0591648_158_679 164
530 3300050490 nmdc:mga03n38_278600_c1 nmdc:mga03n38_278600_c1_376_870 164
531 3300050492 nmdc:mga0yw44_661840_c1 nmdc:mga0yw44_661840_c1_14_517 164
532 3300050493 nmdc:mga0k408_81429_c1 nmdc:mga0k408_81429_c1_546_1040 164
533 3300050507 nmdc:mga05p37_14334_c1 nmdc:mga05p37_14334_c1_8078_8599 164
534 3300050507 nmdc:mga05p37_16864_c1 nmdc:mga05p37_16864_c1_6540_7034 164
535 3300050507 nmdc:mga05p37_398807_c1 nmdc:mga05p37_398807_c1_363_866 164
536 3300050508 nmdc:mga09592_134179_c1 nmdc:mga09592_134179_c1_374_877 164
537 3300050509 nmdc:mga0qj67_29558_c1 nmdc:mga0qj67_29558_c1_3281_3784 164
538 3300050509 nmdc:mga0qj67_760326_c1 nmdc:mga0qj67_760326_c1_211_705 164
539 3300050509 nmdc:mga0qj67_765185_c1 nmdc:mga0qj67_765185_c1_106_624 164
540 3300050510 nmdc:mga06r32_140666_c1 nmdc:mga06r32_140666_c1_637_1131 164
541 3300050510 nmdc:mga06r32_253697_c1 nmdc:mga06r32_253697_c1_945_1466 164
542 3300050510 nmdc:mga06r32_347204_c1 nmdc:mga06r32_347204_c1_462_956 164
543 3300050510 nmdc:mga06r32_513304_c1 nmdc:mga06r32_513304_c1_579_1082 164
544 3300050510 nmdc:mga06r32_60633_c1 nmdc:mga06r32_60633_c1_806_1324 164
545 3300050511 nmdc:mga08y16_227320_c1 nmdc:mga08y16_227320_c1_750_1268 164
546 3300050511 nmdc:mga08y16_286844_c1 nmdc:mga08y16_286844_c1_1048_1614 164
547 3300050511 nmdc:mga08y16_437189_c1 nmdc:mga08y16_437189_c1_612_1160 164
548 3300050511 nmdc:mga08y16_462134_c1 nmdc:mga08y16_462134_c1_227_721 164
549 3300050512 nmdc:mga0n895_189979_c1 nmdc:mga0n895_189979_c1_12_506 164
550 3300050513 nmdc:mga0rr50_421964_c1 nmdc:mga0rr50_421964_c1_424_927 164
551 3300053077 Ga0495601_0130097 Ga0495601_0130097_942_1490 164
552 3300053084 Ga0495595_0126791 Ga0495595_0126791_40_534 164
553 3300053084 Ga0495595_0449382 Ga0495595_0449382_66_620 164
554 3300053158 Ga0500627_0065738 Ga0500627_0065738_870_1379 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

112

185

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

44

109

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.8578 5 159
3hrd-assembly1.cif.gz_H crystal structure of nicotinate dehydrogenase 0.8488 6 159
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.8425 5 159
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.8343 7 161
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.8342 7 160
ID Description Score Start End Superfamily
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9168 84 158 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9074 83 158 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9063 83 158 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8947 84 158 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.886 83 158 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A358QQ71-F1-model_v4 Xanthine dehydrogenase 0.8663 1 160 GO:0005506
GO:0016491
GO:0051536
AF-A0A6N7FAG7-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.8627 5 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A327KLZ5-F1-model_v4 (2Fe-2S)-binding protein 0.8595 3 160 GO:0016491
GO:0046872
GO:0051537
AF-A0A419F0Q4-F1-model_v4 (2Fe-2S)-binding protein 0.8589 7 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A6V8PIG4-F1-model_v4 Aerobic carbon-monoxide dehydrogenase small subunit 0.8588 6 163 GO:0005506
GO:0016491
GO:0051537

Feature Viewer

pLDDT pTM Quality
85.87 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map