F462995
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 554 | 303 | 554 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300025929|Ga0207664_10507250|Ga0207664_105072501 |
| Length | 197 |
| Sequence | MSISVARFIGAAPSGGLRARAITHLNGVPNVVLGTARMTRILELVLNGRRRVDAVPDNLLLLDYLREVVGLTGTKTGCDGGECGACTVLVDDQPRLSCLTLAATVNGQRVDTVESLGHDGRLSAVQRGFHEKLGAQCGYCTPGFIMASAGLLRRNPHPSEDDIRAALGSNICRCTGYVKIIEAVKYAAELHASGVAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 116 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 179 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 202 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 205 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 206 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 301 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.81 |
| Nodule | 0 |
| Rhizoplane | 11.37 |
| Rhizosphere | 84.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1003822 | 3300001977 | Bacteria | 2378 |
| 2 | JGI24737J22298_10041117 | 3300001990 | Bacteria | 1418 |
| 3 | JGI24743J22301_10000566 | 3300001991 | Bacteria | 4434 |
| 4 | JGI24750J21931_1001645 | 3300002070 | Bacteria | 2742 |
| 5 | JGI24745J21846_1001606 | 3300002073 | Bacteria | 2217 |
| 6 | JGI24744J21845_10007865 | 3300002077 | Bacteria | 2202 |
| 7 | JGI24033J26618_1009974 | 3300002155 | Bacteria | 1113 |
| 8 | JGI24034J26672_10010530 | 3300002239 | Bacteria | 1376 |
| 9 | JGI24742J22300_10001659 | 3300002244 | Bacteria | 3543 |
| 10 | JGI24751J29686_10006542 | 3300002459 | Bacteria | 2375 |
| 11 | Ga0070683_100414667 | 3300005329 | Bacteria | 1284 |
| 12 | Ga0070690_100028954 | 3300005330 | Bacteria | 3433 |
| 13 | Ga0070670_100047454 | 3300005331 | Bacteria | 3695 |
| 14 | Ga0070670_100057256 | 3300005331 | Bacteria | 3347 |
| 15 | Ga0070670_101074107 | 3300005331 | Bacteria | 733 |
| 16 | Ga0070666_10051697 | 3300005335 | Bacteria | 2768 |
| 17 | Ga0070682_100248191 | 3300005337 | Bacteria | 1282 |
| 18 | Ga0068868_100002061 | 3300005338 | Bacteria | 13818 |
| 19 | Ga0068868_100545661 | 3300005338 | Bacteria | 1021 |
| 20 | Ga0070660_100307966 | 3300005339 | Bacteria | 1299 |
| 21 | Ga0070689_100011043 | 3300005340 | Bacteria | 6456 |
| 22 | Ga0070689_100150680 | 3300005340 | Bacteria | 1875 |
| 23 | Ga0070689_101089065 | 3300005340 | Bacteria | 714 |
| 24 | Ga0070691_10010824 | 3300005341 | Bacteria | 4162 |
| 25 | Ga0070691_10062938 | 3300005341 | Bacteria | 1787 |
| 26 | Ga0070687_100040738 | 3300005343 | Bacteria | 2342 |
| 27 | Ga0070692_10026449 | 3300005345 | Bacteria | 2868 |
| 28 | Ga0070668_100015764 | 3300005347 | Bacteria | 5654 |
| 29 | Ga0070669_100037777 | 3300005353 | Bacteria | 3503 |
| 30 | Ga0070675_100118630 | 3300005354 | Bacteria | 2246 |
| 31 | Ga0070671_100021615 | 3300005355 | Bacteria | 5256 |
| 32 | Ga0070674_100240015 | 3300005356 | Bacteria | 1418 |
| 33 | Ga0070674_100313514 | 3300005356 | Bacteria | 1255 |
| 34 | Ga0070673_100335467 | 3300005364 | Bacteria | 1338 |
| 35 | Ga0070659_100078632 | 3300005366 | Bacteria | 2631 |
| 36 | Ga0070667_100015732 | 3300005367 | Bacteria | 6255 |
| 37 | Ga0070709_10031167 | 3300005434 | Bacteria | 3206 |
| 38 | Ga0070714_100010663 | 3300005435 | Bacteria | 7271 |
| 39 | Ga0070714_100028935 | 3300005435 | Bacteria | 4602 |
| 40 | Ga0070714_100781935 | 3300005435 | Bacteria | 924 |
| 41 | Ga0070713_100073884 | 3300005436 | Bacteria | 2887 |
| 42 | Ga0070713_100317312 | 3300005436 | Bacteria | 1438 |
| 43 | Ga0070713_100450472 | 3300005436 | Bacteria | 1209 |
| 44 | Ga0070713_101123391 | 3300005436 | Bacteria | 760 |
| 45 | Ga0070710_10011836 | 3300005437 | Bacteria | 4320 |
| 46 | Ga0070710_10092912 | 3300005437 | Bacteria | 1783 |
| 47 | Ga0070701_10029660 | 3300005438 | Bacteria | 2700 |
| 48 | Ga0070711_100027455 | 3300005439 | Bacteria | 3737 |
| 49 | Ga0070711_100055898 | 3300005439 | Bacteria | 2728 |
| 50 | Ga0070711_100426560 | 3300005439 | Bacteria | 1081 |
| 51 | Ga0070705_100463116 | 3300005440 | Bacteria | 954 |
| 52 | Ga0070700_100002511 | 3300005441 | Bacteria | 9350 |
| 53 | Ga0070700_100372754 | 3300005441 | Bacteria | 1065 |
| 54 | Ga0070694_100005533 | 3300005444 | Bacteria | 7648 |
| 55 | Ga0070708_100071584 | 3300005445 | Bacteria | 3122 |
| 56 | Ga0070708_100601574 | 3300005445 | Bacteria | 1037 |
| 57 | Ga0070708_100644944 | 3300005445 | Bacteria | 998 |
| 58 | Ga0070663_100035302 | 3300005455 | Bacteria | 3468 |
| 59 | Ga0070663_100719042 | 3300005455 | Bacteria | 850 |
| 60 | Ga0070662_100200370 | 3300005457 | Bacteria | 1583 |
| 61 | Ga0070685_10047425 | 3300005466 | Bacteria | 2470 |
| 62 | Ga0070698_100157339 | 3300005471 | Bacteria | 2218 |
| 63 | Ga0070698_100363408 | 3300005471 | Bacteria | 1379 |
| 64 | Ga0070698_100367145 | 3300005471 | Bacteria | 1371 |
| 65 | Ga0070699_100003596 | 3300005518 | Bacteria | 13702 |
| 66 | Ga0070679_101219027 | 3300005530 | Bacteria | 698 |
| 67 | Ga0070684_100150888 | 3300005535 | Bacteria | 2105 |
| 68 | Ga0070697_100224989 | 3300005536 | Bacteria | 1599 |
| 69 | Ga0070697_100452588 | 3300005536 | Bacteria | 1118 |
| 70 | Ga0068853_100158346 | 3300005539 | Bacteria | 2041 |
| 71 | Ga0070672_100086369 | 3300005543 | Bacteria | 2523 |
| 72 | Ga0070695_100036074 | 3300005545 | Bacteria | 3110 |
| 73 | Ga0070696_100738048 | 3300005546 | Bacteria | 806 |
| 74 | Ga0070693_100128278 | 3300005547 | Bacteria | 1582 |
| 75 | Ga0070665_100299988 | 3300005548 | Bacteria | 1609 |
| 76 | Ga0070665_100700410 | 3300005548 | Bacteria | 1026 |
| 77 | Ga0070704_100349515 | 3300005549 | Bacteria | 1248 |
| 78 | Ga0070664_100122991 | 3300005564 | Bacteria | 2273 |
| 79 | Ga0068857_101717072 | 3300005577 | Bacteria | 614 |
| 80 | Ga0068854_100041784 | 3300005578 | Bacteria | 3241 |
| 81 | Ga0068856_100202442 | 3300005614 | Bacteria | 2000 |
| 82 | Ga0070702_100075722 | 3300005615 | Bacteria | 2001 |
| 83 | Ga0070702_100082177 | 3300005615 | Bacteria | 1932 |
| 84 | Ga0068852_100143228 | 3300005616 | Bacteria | 2214 |
| 85 | Ga0068864_100014519 | 3300005618 | Bacteria | 6543 |
| 86 | Ga0068864_100641314 | 3300005618 | Bacteria | 1034 |
| 87 | Ga0068866_10155508 | 3300005718 | Bacteria | 1328 |
| 88 | Ga0068861_100217549 | 3300005719 | Bacteria | 1612 |
| 89 | Ga0068861_100218303 | 3300005719 | Bacteria | 1610 |
| 90 | Ga0068870_10001098 | 3300005840 | Bacteria | 10755 |
| 91 | Ga0068863_100034678 | 3300005841 | Bacteria | 4806 |
| 92 | Ga0068858_100128046 | 3300005842 | Bacteria | 2379 |
| 93 | Ga0081455_10000833 | 3300005937 | Bacteria | 39733 |
| 94 | Ga0081455_10001744 | 3300005937 | Bacteria | 26280 |
| 95 | Ga0081455_10015715 | 3300005937 | Bacteria | 7338 |
| 96 | Ga0081455_10048929 | 3300005937 | Bacteria | 3648 |
| 97 | Ga0081455_10068809 | 3300005937 | Bacteria | 2946 |
| 98 | Ga0081455_10093440 | 3300005937 | Bacteria | 2432 |
| 99 | Ga0081455_10670284 | 3300005937 | Bacteria | 665 |
| 100 | Ga0081538_10000477 | 3300005981 | Bacteria | 45047 |
| 101 | Ga0081538_10006000 | 3300005981 | Bacteria | 10813 |
| 102 | Ga0081538_10040352 | 3300005981 | Bacteria | 2979 |
| 103 | Ga0081540_1000066 | 3300005983 | Bacteria | 115420 |
| 104 | Ga0081540_1006683 | 3300005983 | Bacteria | 8342 |
| 105 | Ga0081540_1075323 | 3300005983 | Bacteria | 1543 |
| 106 | Ga0081540_1089050 | 3300005983 | Bacteria | 1363 |
| 107 | Ga0081540_1089689 | 3300005983 | Bacteria | 1356 |
| 108 | Ga0081540_1301956 | 3300005983 | Bacteria | 550 |
| 109 | Ga0081539_10027262 | 3300005985 | Bacteria | 3622 |
| 110 | Ga0081539_10114855 | 3300005985 | Bacteria | 1348 |
| 111 | Ga0070717_10011195 | 3300006028 | Bacteria | 6801 |
| 112 | Ga0070717_10078478 | 3300006028 | Bacteria | 2767 |
| 113 | Ga0070717_10128913 | 3300006028 | Bacteria | 2174 |
| 114 | Ga0070717_10151321 | 3300006028 | Bacteria | 2008 |
| 115 | Ga0070717_11338330 | 3300006028 | Bacteria | 651 |
| 116 | Ga0075365_10197931 | 3300006038 | Bacteria | 1407 |
| 117 | Ga0075365_10235572 | 3300006038 | Bacteria | 1285 |
| 118 | Ga0075363_100234484 | 3300006048 | Bacteria | 1054 |
| 119 | Ga0075363_100313666 | 3300006048 | Bacteria | 912 |
| 120 | Ga0070715_10016789 | 3300006163 | Bacteria | 2758 |
| 121 | Ga0070715_10046392 | 3300006163 | Bacteria | 1847 |
| 122 | Ga0070716_100026220 | 3300006173 | Bacteria | 3119 |
| 123 | Ga0070712_100001496 | 3300006175 | Bacteria | 14258 |
| 124 | Ga0070712_100093273 | 3300006175 | Bacteria | 2210 |
| 125 | Ga0070712_100102950 | 3300006175 | Bacteria | 2116 |
| 126 | Ga0070712_100130303 | 3300006175 | Bacteria | 1905 |
| 127 | Ga0070712_100209924 | 3300006175 | Bacteria | 1535 |
| 128 | Ga0070712_100413975 | 3300006175 | Bacteria | 1116 |
| 129 | Ga0070712_100720213 | 3300006175 | Bacteria | 852 |
| 130 | Ga0075362_10340198 | 3300006177 | Bacteria | 750 |
| 131 | Ga0097621_100291073 | 3300006237 | Bacteria | 1440 |
| 132 | Ga0068871_100066837 | 3300006358 | Bacteria | 2948 |
| 133 | Ga0068871_100584459 | 3300006358 | Bacteria | 1014 |
| 134 | Ga0075428_100012713 | 3300006844 | Bacteria | 9362 |
| 135 | Ga0075428_100061160 | 3300006844 | Bacteria | 4124 |
| 136 | Ga0075428_100343160 | 3300006844 | Bacteria | 1603 |
| 137 | Ga0075428_100344656 | 3300006844 | Bacteria | 1599 |
| 138 | Ga0075428_100654118 | 3300006844 | Bacteria | 1121 |
| 139 | Ga0075430_100036944 | 3300006846 | Bacteria | 4140 |
| 140 | Ga0075430_100507158 | 3300006846 | Bacteria | 996 |
| 141 | Ga0075430_100830036 | 3300006846 | Bacteria | 762 |
| 142 | Ga0075431_100043012 | 3300006847 | Bacteria | 4661 |
| 143 | Ga0075431_100123672 | 3300006847 | Bacteria | 2669 |
| 144 | Ga0075431_100236100 | 3300006847 | Bacteria | 1861 |
| 145 | Ga0075431_100329203 | 3300006847 | Bacteria | 1539 |
| 146 | Ga0075431_100708654 | 3300006847 | Bacteria | 984 |
| 147 | Ga0075431_100939162 | 3300006847 | Bacteria | 833 |
| 148 | Ga0075431_101644557 | 3300006847 | Bacteria | 599 |
| 149 | Ga0075433_10016781 | 3300006852 | Bacteria | 6046 |
| 150 | Ga0075433_10067174 | 3300006852 | Bacteria | 3147 |
| 151 | Ga0075434_100003615 | 3300006871 | Bacteria | 13799 |
| 152 | Ga0075434_100005126 | 3300006871 | Bacteria | 11898 |
| 153 | Ga0075434_100033616 | 3300006871 | Bacteria | 5062 |
| 154 | Ga0075434_100190414 | 3300006871 | Bacteria | 2072 |
| 155 | Ga0075434_100196707 | 3300006871 | Bacteria | 2036 |
| 156 | Ga0075434_100458733 | 3300006871 | Bacteria | 1295 |
| 157 | Ga0075434_100799227 | 3300006871 | Bacteria | 959 |
| 158 | Ga0075429_100052078 | 3300006880 | Bacteria | 3561 |
| 159 | Ga0075429_100277424 | 3300006880 | Bacteria | 1468 |
| 160 | Ga0075429_100321470 | 3300006880 | Bacteria | 1354 |
| 161 | Ga0068865_100010707 | 3300006881 | Bacteria | 5715 |
| 162 | Ga0068865_100286237 | 3300006881 | Bacteria | 1314 |
| 163 | Ga0075435_100009708 | 3300007076 | Bacteria | 6992 |
| 164 | Ga0075435_100079765 | 3300007076 | Bacteria | 2687 |
| 165 | Ga0075435_100102085 | 3300007076 | Bacteria | 2377 |
| 166 | Ga0075435_100809891 | 3300007076 | Bacteria | 816 |
| 167 | Ga0075435_101254578 | 3300007076 | Bacteria | 649 |
| 168 | Ga0099795_10130477 | 3300007788 | Bacteria | 1013 |
| 169 | Ga0099795_10334364 | 3300007788 | Bacteria | 674 |
| 170 | Ga0105250_10021342 | 3300009092 | Bacteria | 2615 |
| 171 | Ga0111539_10012212 | 3300009094 | Bacteria | 10773 |
| 172 | Ga0111539_10120071 | 3300009094 | Bacteria | 3080 |
| 173 | Ga0111539_11822123 | 3300009094 | Bacteria | 706 |
| 174 | Ga0105245_10084593 | 3300009098 | Bacteria | 2907 |
| 175 | Ga0105245_10121568 | 3300009098 | Bacteria | 2440 |
| 176 | Ga0114129_10005944 | 3300009147 | Bacteria | 17275 |
| 177 | Ga0114129_10025593 | 3300009147 | Bacteria | 8361 |
| 178 | Ga0114129_10088285 | 3300009147 | Bacteria | 4299 |
| 179 | Ga0114129_10138418 | 3300009147 | Bacteria | 3339 |
| 180 | Ga0114129_10911259 | 3300009147 | Bacteria | 1113 |
| 181 | Ga0114129_10915290 | 3300009147 | Bacteria | 1110 |
| 182 | Ga0105243_10014819 | 3300009148 | Bacteria | 5899 |
| 183 | Ga0105241_10946426 | 3300009174 | Bacteria | 803 |
| 184 | Ga0105242_10042996 | 3300009176 | Bacteria | 3652 |
| 185 | Ga0105248_10007960 | 3300009177 | Bacteria | 11652 |
| 186 | Ga0105248_11850695 | 3300009177 | Bacteria | 685 |
| 187 | Ga0105237_10082617 | 3300009545 | Bacteria | 3203 |
| 188 | Ga0105249_10060160 | 3300009553 | Bacteria | 3484 |
| 189 | Ga0105249_10301413 | 3300009553 | Bacteria | 1607 |
| 190 | Ga0099796_10031110 | 3300010159 | Bacteria | 1738 |
| 191 | Ga0099796_10166528 | 3300010159 | Bacteria | 877 |
| 192 | Ga0105246_10235470 | 3300011119 | Bacteria | 1444 |
| 193 | Ga0105246_10753197 | 3300011119 | Bacteria | 859 |
| 194 | Ga0157371_10176523 | 3300013102 | Bacteria | 1527 |
| 195 | Ga0157374_10059435 | 3300013296 | Bacteria | 3574 |
| 196 | Ga0163162_10151281 | 3300013306 | Bacteria | 2439 |
| 197 | Ga0157372_10878927 | 3300013307 | Bacteria | 1040 |
| 198 | Ga0157375_10184320 | 3300013308 | Bacteria | 2240 |
| 199 | Ga0163163_10134042 | 3300014325 | Bacteria | 2517 |
| 200 | Ga0163163_10139397 | 3300014325 | Bacteria | 2467 |
| 201 | Ga0157380_10048109 | 3300014326 | Bacteria | 3357 |
| 202 | Ga0157380_10049760 | 3300014326 | Bacteria | 3307 |
| 203 | Ga0157377_10041804 | 3300014745 | Bacteria | 2544 |
| 204 | Ga0157379_10009784 | 3300014968 | Bacteria | 8354 |
| 205 | Ga0157376_10157545 | 3300014969 | Bacteria | 2055 |
| 206 | Ga0157376_10259940 | 3300014969 | Bacteria | 1626 |
| 207 | Ga0157376_10373530 | 3300014969 | Bacteria | 1371 |
| 208 | Ga0163161_10015993 | 3300017792 | Bacteria | 5236 |
| 209 | Ga0163161_10316198 | 3300017792 | Bacteria | 1233 |
| 210 | Ga0213874_10164247 | 3300021377 | Bacteria | 782 |
| 211 | Ga0213876_10276364 | 3300021384 | Bacteria | 893 |
| 212 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 213 | Ga0224572_1066899 | 3300024225 | Bacteria | 664 |
| 214 | Ga0228598_1000419 | 3300024227 | Bacteria | 8618 |
| 215 | Ga0207656_10191252 | 3300025321 | Bacteria | 985 |
| 216 | Ga0207710_10035504 | 3300025900 | Bacteria | 2194 |
| 217 | Ga0207688_10000447 | 3300025901 | Bacteria | 19558 |
| 218 | Ga0207680_10583227 | 3300025903 | Bacteria | 799 |
| 219 | Ga0207647_10029917 | 3300025904 | Bacteria | 3518 |
| 220 | Ga0207647_10335311 | 3300025904 | Bacteria | 858 |
| 221 | Ga0207685_10018416 | 3300025905 | Bacteria | 2279 |
| 222 | Ga0207699_10020215 | 3300025906 | Bacteria | 3563 |
| 223 | Ga0207645_10012433 | 3300025907 | Bacteria | 5774 |
| 224 | Ga0207643_10007556 | 3300025908 | Bacteria | 5836 |
| 225 | Ga0207684_10242649 | 3300025910 | Bacteria | 1554 |
| 226 | Ga0207684_10422540 | 3300025910 | Bacteria | 1145 |
| 227 | Ga0207693_10003443 | 3300025915 | Bacteria | 13501 |
| 228 | Ga0207693_10015430 | 3300025915 | Bacteria | 6128 |
| 229 | Ga0207693_10017237 | 3300025915 | Bacteria | 5760 |
| 230 | Ga0207693_10093222 | 3300025915 | Bacteria | 2360 |
| 231 | Ga0207663_10049315 | 3300025916 | Bacteria | 2611 |
| 232 | Ga0207663_10087850 | 3300025916 | Bacteria | 2054 |
| 233 | Ga0207663_10342748 | 3300025916 | Bacteria | 1129 |
| 234 | Ga0207660_10464408 | 3300025917 | Bacteria | 1024 |
| 235 | Ga0207662_10000788 | 3300025918 | Bacteria | 14580 |
| 236 | Ga0207657_10035616 | 3300025919 | Bacteria | 4461 |
| 237 | Ga0207657_10831983 | 3300025919 | Bacteria | 713 |
| 238 | Ga0207646_10246635 | 3300025922 | Bacteria | 1613 |
| 239 | Ga0207694_10146939 | 3300025924 | Bacteria | 1898 |
| 240 | Ga0207650_10098612 | 3300025925 | Bacteria | 2245 |
| 241 | Ga0207650_10208466 | 3300025925 | Bacteria | 1569 |
| 242 | Ga0207659_10061633 | 3300025926 | Bacteria | 2704 |
| 243 | Ga0207687_10071608 | 3300025927 | Bacteria | 2477 |
| 244 | Ga0207687_10071817 | 3300025927 | Bacteria | 2474 |
| 245 | Ga0207700_10130587 | 3300025928 | Bacteria | 2050 |
| 246 | Ga0207700_10226249 | 3300025928 | Bacteria | 1588 |
| 247 | Ga0207700_10252674 | 3300025928 | Bacteria | 1506 |
| 248 | Ga0207664_10012312 | 3300025929 | Bacteria | 6110 |
| 249 | Ga0207664_10306776 | 3300025929 | Bacteria | 1398 |
| 250 | Ga0207664_10507250 | 3300025929 | Bacteria | 1080 |
| 251 | Ga0207706_10009920 | 3300025933 | Bacteria | 8733 |
| 252 | Ga0207686_10372230 | 3300025934 | Bacteria | 1081 |
| 253 | Ga0207709_10010146 | 3300025935 | Bacteria | 5187 |
| 254 | Ga0207670_10031265 | 3300025936 | Bacteria | 3409 |
| 255 | Ga0207670_10039032 | 3300025936 | Bacteria | 3106 |
| 256 | Ga0207669_10023517 | 3300025937 | Bacteria | 3293 |
| 257 | Ga0207704_10875408 | 3300025938 | Bacteria | 754 |
| 258 | Ga0207665_10000206 | 3300025939 | Bacteria | 39664 |
| 259 | Ga0207665_10212645 | 3300025939 | Bacteria | 1413 |
| 260 | Ga0207691_10021871 | 3300025940 | Bacteria | 6036 |
| 261 | Ga0207711_10054318 | 3300025941 | Bacteria | 3437 |
| 262 | Ga0207689_10004078 | 3300025942 | Bacteria | 13276 |
| 263 | Ga0207661_10207354 | 3300025944 | Bacteria | 1726 |
| 264 | Ga0207651_10064018 | 3300025960 | Bacteria | 2571 |
| 265 | Ga0207712_10011129 | 3300025961 | Bacteria | 5726 |
| 266 | Ga0207668_10112583 | 3300025972 | Bacteria | 2044 |
| 267 | Ga0207640_10019563 | 3300025981 | Bacteria | 4003 |
| 268 | Ga0207658_10141832 | 3300025986 | Bacteria | 1945 |
| 269 | Ga0207677_10060907 | 3300026023 | Bacteria | 2611 |
| 270 | Ga0207677_10255122 | 3300026023 | Bacteria | 1426 |
| 271 | Ga0207703_10014624 | 3300026035 | Bacteria | 6122 |
| 272 | Ga0207639_10041749 | 3300026041 | Bacteria | 3434 |
| 273 | Ga0207708_10000823 | 3300026075 | Bacteria | 23384 |
| 274 | Ga0207702_10260632 | 3300026078 | Bacteria | 1632 |
| 275 | Ga0207641_10034045 | 3300026088 | Bacteria | 4235 |
| 276 | Ga0207648_10001310 | 3300026089 | Bacteria | 27700 |
| 277 | Ga0207676_10089955 | 3300026095 | Bacteria | 2517 |
| 278 | Ga0207674_10208427 | 3300026116 | Bacteria | 1904 |
| 279 | Ga0207674_11088967 | 3300026116 | Bacteria | 768 |
| 280 | Ga0207675_100029093 | 3300026118 | Bacteria | 5149 |
| 281 | Ga0207675_100169632 | 3300026118 | Bacteria | 2085 |
| 282 | Ga0207675_100199934 | 3300026118 | Bacteria | 1919 |
| 283 | Ga0207683_10014866 | 3300026121 | Bacteria | 6628 |
| 284 | Ga0207683_10532518 | 3300026121 | Bacteria | 1086 |
| 285 | Ga0207698_10010459 | 3300026142 | Bacteria | 5964 |
| 286 | Ga0207428_10236531 | 3300027907 | Bacteria | 1366 |
| 287 | Ga0207428_10823578 | 3300027907 | Bacteria | 659 |
| 288 | Ga0268266_10112426 | 3300028379 | Bacteria | 2414 |
| 289 | Ga0268265_10160789 | 3300028380 | Bacteria | 1907 |
| 290 | Ga0265338_10013501 | 3300028800 | Bacteria | 9210 |
| 291 | Ga0265324_10159851 | 3300029957 | Bacteria | 765 |
| 292 | Ga0265760_10110053 | 3300031090 | Bacteria | 877 |
| 293 | Ga0265325_10017407 | 3300031241 | Bacteria | 3994 |
| 294 | Ga0265339_10000228 | 3300031249 | Bacteria | 45435 |
| 295 | Ga0265313_10000203 | 3300031595 | Bacteria | 63977 |
| 296 | Ga0265313_10000917 | 3300031595 | Bacteria | 29468 |
| 297 | Ga0265314_10016002 | 3300031711 | Bacteria | 5937 |
| 298 | Ga0373930_0120040 | 3300034816 | Bacteria | 639 |
| 299 | Ga0373948_0008236 | 3300034817 | Bacteria | 1771 |
| 300 | Ga0373958_0006521 | 3300034819 | Bacteria | 1822 |
| 301 | Ga0373928_0012687 | 3300035084 | Bacteria | 1684 |
| 302 | Ga0373928_0037313 | 3300035084 | Bacteria | 1102 |
| 303 | Ga0373929_0026350 | 3300035085 | Bacteria | 1214 |
| 304 | Ga0373929_0077876 | 3300035085 | Bacteria | 803 |
| 305 | Ga0373940_0032303 | 3300035088 | Bacteria | 1402 |
| 306 | Ga0373949_0004006 | 3300035090 | Bacteria | 3414 |
| 307 | Ga0373949_0158054 | 3300035090 | Bacteria | 659 |
| 308 | Ga0373951_0040869 | 3300035091 | Bacteria | 1118 |
| 309 | Ga0373932_0006337 | 3300035112 | Bacteria | 2797 |
| 310 | Ga0373939_0004832 | 3300035114 | Bacteria | 3195 |
| 311 | Ga0373939_0311153 | 3300035114 | Bacteria | 631 |
| 312 | Ga0373941_0002530 | 3300035115 | Bacteria | 4044 |
| 313 | Ga0373941_0018703 | 3300035115 | Bacteria | 1918 |
| 314 | Ga0373941_0043678 | 3300035115 | Bacteria | 1396 |
| 315 | Ga0373954_0081201 | 3300035118 | Bacteria | 1549 |
| 316 | Ga0373960_0005948 | 3300035121 | Bacteria | 2843 |
| 317 | Ga0373961_0004077 | 3300035241 | Bacteria | 3558 |
| 318 | Ga0373962_0002894 | 3300035242 | Bacteria | 4113 |
| 319 | Ga0373962_0007558 | 3300035242 | Bacteria | 2664 |
| 320 | Ga0373931_0000445 | 3300035691 | Bacteria | 16816 |
| 321 | Ga0373931_0005252 | 3300035691 | Bacteria | 5974 |
| 322 | Ga0373931_0006571 | 3300035691 | Bacteria | 5440 |
| 323 | Ga0373931_0039433 | 3300035691 | Bacteria | 2475 |
| 324 | Ga0373931_0635461 | 3300035691 | Bacteria | 700 |
| 325 | Ga0373931_0668146 | 3300035691 | Bacteria | 684 |
| 326 | Ga0373927_0107157 | 3300035695 | Bacteria | 1820 |
| 327 | Ga0373933_0037080 | 3300035724 | Bacteria | 2858 |
| 328 | Ga0373947_0195982 | 3300035725 | Bacteria | 1320 |
| 329 | Ga0373937_0492532 | 3300036401 | Bacteria | 1164 |
| 330 | Ga0373937_0587929 | 3300036401 | Bacteria | 1057 |
| 331 | Ga0373925_0064431 | 3300037068 | Bacteria | 2759 |
| 332 | Ga0373925_0353070 | 3300037068 | Bacteria | 1194 |
| 333 | Ga0395905_0214714 | 3300037471 | Bacteria | 1802 |
| 334 | Ga0436364_0191605 | 3300037853 | Bacteria | 46122 |
| 335 | Ga0436365_0569625 | 3300039437 | Bacteria | 808 |
| 336 | Ga0436365_0684505 | 3300039437 | Bacteria | 901 |
| 337 | Ga0436365_0688201 | 3300039437 | Bacteria | 945 |
| 338 | Ga0436365_1524923 | 3300039437 | Bacteria | 1824 |
| 339 | Ga0436365_1858544 | 3300039437 | Bacteria | 552 |
| 340 | Ga0436360_0351713 | 3300039438 | Bacteria | 1196 |
| 341 | Ga0436361_1075969 | 3300039447 | Bacteria | 705 |
| 342 | Ga0436363_0608712 | 3300039450 | Bacteria | 543 |
| 343 | Ga0436363_1468080 | 3300039450 | Bacteria | 1878 |
| 344 | Ga0436362_0521384 | 3300039453 | Bacteria | 858 |
| 345 | Ga0451853_0731668 | 3300041512 | Bacteria | 1518 |
| 346 | Ga0439450_141532 | 3300042008 | Bacteria | 628 |
| 347 | Ga0451577_0645945 | 3300042876 | Bacteria | 959 |
| 348 | Ga0466967_0910938 | 3300045976 | Bacteria | 874 |
| 349 | Ga0495592_0318118 | 3300046454 | Bacteria | 1006 |
| 350 | Ga0495603_0188732 | 3300046455 | Bacteria | 1192 |
| 351 | Ga0495590_0014214 | 3300046457 | Bacteria | 2910 |
| 352 | Ga0495629_0057438 | 3300046459 | Bacteria | 2721 |
| 353 | Ga0495629_0372416 | 3300046459 | Bacteria | 972 |
| 354 | Ga0495638_0257434 | 3300046460 | Bacteria | 959 |
| 355 | Ga0495641_0105084 | 3300046461 | Bacteria | 1260 |
| 356 | Ga0495650_0145211 | 3300046471 | Bacteria | 856 |
| 357 | Ga0495582_0069021 | 3300046473 | Bacteria | 1954 |
| 358 | Ga0495662_0419433 | 3300046476 | Bacteria | 657 |
| 359 | Ga0495584_0056689 | 3300046491 | Bacteria | 1972 |
| 360 | Ga0495584_0136964 | 3300046491 | Bacteria | 1243 |
| 361 | Ga0495584_0177149 | 3300046491 | Bacteria | 1084 |
| 362 | Ga0495584_0193380 | 3300046491 | Bacteria | 1034 |
| 363 | Ga0495585_0479365 | 3300046492 | Bacteria | 593 |
| 364 | Ga0495607_0096747 | 3300046501 | Bacteria | 1589 |
| 365 | Ga0495618_0262581 | 3300046514 | Bacteria | 1081 |
| 366 | Ga0495630_1249366 | 3300046517 | Bacteria | 561 |
| 367 | Ga0495631_0269742 | 3300046518 | Bacteria | 725 |
| 368 | Ga0495632_0232899 | 3300046519 | Bacteria | 830 |
| 369 | Ga0495637_0270660 | 3300046520 | Bacteria | 608 |
| 370 | Ga0495652_0140164 | 3300046529 | Bacteria | 1902 |
| 371 | Ga0495665_0150064 | 3300046531 | Bacteria | 1217 |
| 372 | Ga0495640_0133337 | 3300046533 | Bacteria | 1606 |
| 373 | Ga0495640_0364738 | 3300046533 | Bacteria | 890 |
| 374 | Ga0495586_0128412 | 3300046535 | Bacteria | 1419 |
| 375 | Ga0495586_0167799 | 3300046535 | Bacteria | 1240 |
| 376 | Ga0495587_0117666 | 3300046536 | Bacteria | 1523 |
| 377 | Ga0495609_0325428 | 3300046538 | Bacteria | 623 |
| 378 | Ga0495645_0059971 | 3300046543 | Bacteria | 2758 |
| 379 | Ga0495656_0033621 | 3300046615 | Bacteria | 2094 |
| 380 | Ga0495656_0113645 | 3300046615 | Bacteria | 1270 |
| 381 | Ga0495656_0175708 | 3300046615 | Bacteria | 1050 |
| 382 | Ga0495634_0045179 | 3300046642 | Bacteria | 2979 |
| 383 | Ga0495625_0433809 | 3300046660 | Bacteria | 815 |
| 384 | Ga0495659_0176571 | 3300046664 | Bacteria | 868 |
| 385 | Ga0495599_0037983 | 3300046678 | Bacteria | 3025 |
| 386 | Ga0495623_0006581 | 3300046679 | Bacteria | 7561 |
| 387 | Ga0495647_0080707 | 3300046681 | Bacteria | 1319 |
| 388 | Ga0495658_0090738 | 3300046683 | Bacteria | 1809 |
| 389 | Ga0495658_0338771 | 3300046683 | Bacteria | 955 |
| 390 | Ga0495613_0155398 | 3300046689 | Bacteria | 1630 |
| 391 | Ga0495649_0277478 | 3300046694 | Bacteria | 857 |
| 392 | Ga0495600_0154425 | 3300046809 | Bacteria | 1485 |
| 393 | Ga0495660_0039750 | 3300046810 | Bacteria | 2611 |
| 394 | Ga0495604_0164648 | 3300047317 | Bacteria | 1564 |
| 395 | Ga0495672_0090793 | 3300047320 | Bacteria | 1678 |
| 396 | Ga0495680_0072104 | 3300047322 | Bacteria | 2628 |
| 397 | Ga0495684_0410693 | 3300047471 | Bacteria | 948 |
| 398 | Ga0495684_0553142 | 3300047471 | Bacteria | 783 |
| 399 | Ga0495686_0623250 | 3300047472 | Bacteria | 557 |
| 400 | Ga0495593_0091987 | 3300047673 | Bacteria | 1561 |
| 401 | Ga0495593_0379221 | 3300047673 | Bacteria | 707 |
| 402 | Ga0495615_0013196 | 3300048090 | Bacteria | 1722 |
| 403 | Ga0496100_0025958 | 3300048903 | Bacteria | 3587 |
| 404 | Ga0496100_0031483 | 3300048903 | Bacteria | 3298 |
| 405 | Ga0496100_0301266 | 3300048903 | Bacteria | 1200 |
| 406 | Ga0496101_0014604 | 3300048904 | Bacteria | 5280 |
| 407 | Ga0496101_0032209 | 3300048904 | Bacteria | 3688 |
| 408 | Ga0496102_0036614 | 3300048905 | Bacteria | 4421 |
| 409 | Ga0496102_0123873 | 3300048905 | Bacteria | 2415 |
| 410 | Ga0496102_0296378 | 3300048905 | Bacteria | 1524 |
| 411 | Ga0496103_0001303 | 3300048906 | Bacteria | 16987 |
| 412 | Ga0496103_0004456 | 3300048906 | Bacteria | 8490 |
| 413 | Ga0496104_0000833 | 3300048907 | Bacteria | 26625 |
| 414 | Ga0496104_0006728 | 3300048907 | Bacteria | 10122 |
| 415 | Ga0496104_0016526 | 3300048907 | Bacteria | 6705 |
| 416 | Ga0496104_0016928 | 3300048907 | Bacteria | 6631 |
| 417 | Ga0496105_0001940 | 3300048908 | Bacteria | 14860 |
| 418 | Ga0496105_0025499 | 3300048908 | Bacteria | 4813 |
| 419 | Ga0496105_0095147 | 3300048908 | Bacteria | 2460 |
| 420 | Ga0496105_0141245 | 3300048908 | Bacteria | 1982 |
| 421 | Ga0496105_0309736 | 3300048908 | Bacteria | 1268 |
| 422 | Ga0496106_0001089 | 3300048909 | Bacteria | 20073 |
| 423 | Ga0496106_0023496 | 3300048909 | Bacteria | 4580 |
| 424 | Ga0496106_0064524 | 3300048909 | Bacteria | 2786 |
| 425 | Ga0496106_0181844 | 3300048909 | Bacteria | 1669 |
| 426 | Ga0496106_0191210 | 3300048909 | Bacteria | 1627 |
| 427 | Ga0496106_0735988 | 3300048909 | Bacteria | 785 |
| 428 | Ga0496107_0115071 | 3300048910 | Bacteria | 1979 |
| 429 | Ga0496107_0349760 | 3300048910 | Bacteria | 1100 |
| 430 | Ga0496107_0369291 | 3300048910 | Bacteria | 1067 |
| 431 | Ga0496107_0609893 | 3300048910 | Bacteria | 806 |
| 432 | Ga0496108_0000775 | 3300048911 | Bacteria | 24949 |
| 433 | Ga0496108_0012371 | 3300048911 | Bacteria | 6944 |
| 434 | Ga0496108_0012564 | 3300048911 | Bacteria | 6897 |
| 435 | Ga0496108_0018391 | 3300048911 | Bacteria | 5722 |
| 436 | Ga0496108_0187761 | 3300048911 | Bacteria | 1791 |
| 437 | Ga0496109_0006247 | 3300048912 | Bacteria | 10020 |
| 438 | Ga0496109_1315304 | 3300048912 | Bacteria | 659 |
| 439 | Ga0496110_0003027 | 3300048913 | Bacteria | 12758 |
| 440 | Ga0496110_0006963 | 3300048913 | Bacteria | 8994 |
| 441 | Ga0496110_0093959 | 3300048913 | Bacteria | 2685 |
| 442 | Ga0496110_0099819 | 3300048913 | Bacteria | 2602 |
| 443 | Ga0496110_0231222 | 3300048913 | Bacteria | 1682 |
| 444 | Ga0496110_1211004 | 3300048913 | Bacteria | 664 |
| 445 | Ga0496111_0001603 | 3300048914 | Bacteria | 13082 |
| 446 | Ga0496111_0028102 | 3300048914 | Bacteria | 3984 |
| 447 | Ga0496111_0039934 | 3300048914 | Bacteria | 3366 |
| 448 | Ga0496111_0205820 | 3300048914 | Bacteria | 1462 |
| 449 | Ga0496112_0017309 | 3300048915 | Bacteria | 6769 |
| 450 | Ga0496112_0045865 | 3300048915 | Bacteria | 4284 |
| 451 | Ga0496112_0209683 | 3300048915 | Bacteria | 1906 |
| 452 | Ga0496112_0543300 | 3300048915 | Bacteria | 1096 |
| 453 | Ga0496112_0715378 | 3300048915 | Bacteria | 929 |
| 454 | Ga0496113_0000524 | 3300048916 | Bacteria | 18933 |
| 455 | Ga0496113_0003988 | 3300048916 | Bacteria | 8968 |
| 456 | Ga0496113_0006125 | 3300048916 | Bacteria | 7592 |
| 457 | Ga0496113_1186382 | 3300048916 | Bacteria | 596 |
| 458 | Ga0496114_0017299 | 3300048917 | Bacteria | 5817 |
| 459 | Ga0496114_0193847 | 3300048917 | Bacteria | 1778 |
| 460 | Ga0496114_0407443 | 3300048917 | Bacteria | 1204 |
| 461 | Ga0496114_0577638 | 3300048917 | Bacteria | 992 |
| 462 | Ga0496115_0018841 | 3300048918 | Bacteria | 5306 |
| 463 | Ga0496115_0041842 | 3300048918 | Bacteria | 3648 |
| 464 | Ga0496115_0152666 | 3300048918 | Bacteria | 1907 |
| 465 | Ga0496115_0292910 | 3300048918 | Bacteria | 1335 |
| 466 | Ga0501036_0117364 | 3300049572 | Bacteria | 2248 |
| 467 | Ga0501038_0339456 | 3300049574 | Bacteria | 1172 |
| 468 | Ga0501039_0258813 | 3300049575 | Bacteria | 1368 |
| 469 | Ga0501039_1130813 | 3300049575 | Bacteria | 607 |
| 470 | Ga0501041_0325486 | 3300049577 | Bacteria | 970 |
| 471 | Ga0501041_0564189 | 3300049577 | Bacteria | 726 |
| 472 | Ga0501046_1074837 | 3300049580 | Bacteria | 556 |
| 473 | Ga0501068_0591648 | 3300049584 | Bacteria | 723 |
| 474 | Ga0501068_0691681 | 3300049584 | Bacteria | 667 |
| 475 | Ga0501070_0563498 | 3300049586 | Bacteria | 911 |
| 476 | Ga0501071_1002260 | 3300049587 | Bacteria | 645 |
| 477 | Ga0501072_0297934 | 3300049588 | Bacteria | 1282 |
| 478 | Ga0501073_0055597 | 3300049589 | Bacteria | 2769 |
| 479 | Ga0501074_0533581 | 3300049590 | Bacteria | 831 |
| 480 | Ga0501075_0104941 | 3300049591 | Bacteria | 2148 |
| 481 | Ga0501075_0311622 | 3300049591 | Bacteria | 1199 |
| 482 | Ga0501076_0358068 | 3300049592 | Bacteria | 1199 |
| 483 | Ga0501076_0362124 | 3300049592 | Bacteria | 1191 |
| 484 | Ga0501077_0309204 | 3300049593 | Bacteria | 1007 |
| 485 | Ga0501079_0549055 | 3300049741 | Bacteria | 909 |
| 486 | Ga0501079_0688118 | 3300049741 | Bacteria | 805 |
| 487 | Ga0501080_0801837 | 3300049742 | Bacteria | 826 |
| 488 | Ga0501045_0402232 | 3300049824 | Bacteria | 1019 |
| 489 | nmdc:mga03n38_278600_c1 | 3300050490 | Bacteria | 892 |
| 490 | nmdc:mga0yw44_661840_c1 | 3300050492 | Bacteria | 710 |
| 491 | nmdc:mga0k408_455676_c1 | 3300050493 | Bacteria | 759 |
| 492 | nmdc:mga0k408_81429_c1 | 3300050493 | Bacteria | 1895 |
| 493 | nmdc:mga05p37_14334_c1 | 3300050507 | Bacteria | 9517 |
| 494 | nmdc:mga05p37_16059_c1 | 3300050507 | Bacteria | 9010 |
| 495 | nmdc:mga05p37_16864_c1 | 3300050507 | Bacteria | 8805 |
| 496 | nmdc:mga05p37_398807_c1 | 3300050507 | Bacteria | 1607 |
| 497 | nmdc:mga05p37_656148_c1 | 3300050507 | Bacteria | 1174 |
| 498 | nmdc:mga05p37_677646_c1 | 3300050507 | Bacteria | 1150 |
| 499 | nmdc:mga05p37_788772_c1 | 3300050507 | Bacteria | 1041 |
| 500 | nmdc:mga09592_134179_c1 | 3300050508 | Bacteria | 2132 |
| 501 | nmdc:mga09592_413294_c1 | 3300050508 | Bacteria | 1166 |
| 502 | nmdc:mga09592_415198_c1 | 3300050508 | Bacteria | 1163 |
| 503 | nmdc:mga0qj67_29558_c1 | 3300050509 | Bacteria | 4257 |
| 504 | nmdc:mga0qj67_398164_c1 | 3300050509 | Bacteria | 1111 |
| 505 | nmdc:mga0qj67_600011_c1 | 3300050509 | Bacteria | 881 |
| 506 | nmdc:mga0qj67_760326_c1 | 3300050509 | Bacteria | 768 |
| 507 | nmdc:mga0qj67_765185_c1 | 3300050509 | Bacteria | 766 |
| 508 | nmdc:mga06r32_140666_c1 | 3300050510 | Bacteria | 2389 |
| 509 | nmdc:mga06r32_253697_c1 | 3300050510 | Bacteria | 1747 |
| 510 | nmdc:mga06r32_347204_c1 | 3300050510 | Bacteria | 1468 |
| 511 | nmdc:mga06r32_35928_c1 | 3300050510 | Bacteria | 4678 |
| 512 | nmdc:mga06r32_494828_c1 | 3300050510 | Bacteria | 1200 |
| 513 | nmdc:mga06r32_513304_c1 | 3300050510 | Bacteria | 1175 |
| 514 | nmdc:mga06r32_533586_c1 | 3300050510 | Bacteria | 1148 |
| 515 | nmdc:mga06r32_60633_c1 | 3300050510 | Bacteria | 3641 |
| 516 | nmdc:mga06r32_800997_c1 | 3300050510 | Bacteria | 903 |
| 517 | nmdc:mga08y16_1168804_c1 | 3300050511 | Bacteria | 742 |
| 518 | nmdc:mga08y16_227320_c1 | 3300050511 | Bacteria | 1930 |
| 519 | nmdc:mga08y16_286844_c1 | 3300050511 | Bacteria | 1697 |
| 520 | nmdc:mga08y16_437189_c1 | 3300050511 | Bacteria | 1336 |
| 521 | nmdc:mga08y16_462134_c1 | 3300050511 | Bacteria | 1293 |
| 522 | nmdc:mga0n895_1183_c1 | 3300050512 | Bacteria | 19168 |
| 523 | nmdc:mga0n895_189979_c1 | 3300050512 | Bacteria | 2085 |
| 524 | nmdc:mga0n895_203391_c1 | 3300050512 | Bacteria | 2011 |
| 525 | nmdc:mga0n895_217748_c1 | 3300050512 | Bacteria | 1939 |
| 526 | nmdc:mga0n895_227161_c1 | 3300050512 | Bacteria | 1895 |
| 527 | nmdc:mga0n895_588001_c1 | 3300050512 | Bacteria | 1116 |
| 528 | nmdc:mga0rr50_1109508_c1 | 3300050513 | Bacteria | 673 |
| 529 | nmdc:mga0rr50_156016_c1 | 3300050513 | Bacteria | 1849 |
| 530 | nmdc:mga0rr50_19486_c1 | 3300050513 | Bacteria | 3917 |
| 531 | nmdc:mga0rr50_421964_c1 | 3300050513 | Bacteria | 1128 |
| 532 | nmdc:mga0rr50_81752_c1 | 3300050513 | Bacteria | 2494 |
| 533 | nmdc:mga0a205_608831_c1 | 3300050515 | Bacteria | 945 |
| 534 | nmdc:mga0a205_7946_c1 | 3300050515 | Bacteria | 9633 |
| 535 | Ga0495601_0130097 | 3300053077 | Bacteria | 1639 |
| 536 | Ga0495601_0314212 | 3300053077 | Bacteria | 1020 |
| 537 | Ga0495601_0458107 | 3300053077 | Bacteria | 824 |
| 538 | Ga0495612_0276539 | 3300053078 | Bacteria | 750 |
| 539 | Ga0495595_0087970 | 3300053084 | Bacteria | 1487 |
| 540 | Ga0495595_0126791 | 3300053084 | Bacteria | 1246 |
| 541 | Ga0495595_0449382 | 3300053084 | Bacteria | 655 |
| 542 | Ga0495619_0028928 | 3300053085 | Bacteria | 3577 |
| 543 | Ga0495619_0120908 | 3300053085 | Bacteria | 1795 |
| 544 | Ga0500627_0065738 | 3300053158 | Bacteria | 1601 |
| 545 | Ga0501084_0158530 | 3300054114 | Bacteria | 1909 |
| 546 | Ga0501084_0382758 | 3300054114 | Bacteria | 1189 |
| 547 | Ga0501084_0567236 | 3300054114 | Bacteria | 959 |
| 548 | Ga0501084_0587879 | 3300054114 | Bacteria | 941 |
| 549 | Ga0501082_0000175 | 3300060353 | Bacteria | 55693 |
| 550 | Ga0501082_0025769 | 3300060353 | Bacteria | 5067 |
| 551 | Ga0501082_0777264 | 3300060353 | Bacteria | 838 |
| 552 | Ga0530510_0124765 | 3300061734 | Bacteria | 1892 |
| 553 | Ga0530510_0168670 | 3300061734 | Bacteria | 1621 |
| 554 | Ga0530510_0381345 | 3300061734 | Bacteria | 1061 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_100545661 | Ga0068868_1005456612 | 159 |
| 2 | 3300005356 | Ga0070674_100313514 | Ga0070674_1003135142 | 159 |
| 3 | 3300005441 | Ga0070700_100372754 | Ga0070700_1003727541 | 159 |
| 4 | 3300005455 | Ga0070663_100719042 | Ga0070663_1007190421 | 159 |
| 5 | 3300005471 | Ga0070698_100157339 | Ga0070698_1001573392 | 159 |
| 6 | 3300005545 | Ga0070695_100036074 | Ga0070695_1000360742 | 159 |
| 7 | 3300005719 | Ga0068861_100217549 | Ga0068861_1002175492 | 159 |
| 8 | 3300006881 | Ga0068865_100286237 | Ga0068865_1002862372 | 159 |
| 9 | 3300009098 | Ga0105245_10121568 | Ga0105245_101215682 | 159 |
| 10 | 3300025904 | Ga0207647_10335311 | Ga0207647_103353112 | 159 |
| 11 | 3300025919 | Ga0207657_10831983 | Ga0207657_108319832 | 159 |
| 12 | 3300025927 | Ga0207687_10071817 | Ga0207687_100718172 | 159 |
| 13 | 3300025938 | Ga0207704_10875408 | Ga0207704_108754082 | 159 |
| 14 | 3300026023 | Ga0207677_10255122 | Ga0207677_102551221 | 159 |
| 15 | 3300026118 | Ga0207675_100199934 | Ga0207675_1001999342 | 159 |
| 16 | 3300026121 | Ga0207683_10532518 | Ga0207683_105325181 | 159 |
| 17 | 3300042876 | Ga0451577_0645945 | Ga0451577_0645945_254_742 | 159 |
| 18 | 3300048910 | Ga0496107_0609893 | Ga0496107_0609893_258_740 | 159 |
| 19 | 3300050507 | nmdc:mga05p37_788772_c1 | nmdc:mga05p37_788772_c1_351_839 | 159 |
| 20 | 3300005331 | Ga0070670_101074107 | Ga0070670_1010741071 | 160 |
| 21 | 3300005340 | Ga0070689_100150680 | Ga0070689_1001506802 | 160 |
| 22 | 3300005340 | Ga0070689_101089065 | Ga0070689_1010890651 | 160 |
| 23 | 3300005341 | Ga0070691_10010824 | Ga0070691_100108242 | 160 |
| 24 | 3300005434 | Ga0070709_10031167 | Ga0070709_100311673 | 160 |
| 25 | 3300005435 | Ga0070714_100010663 | Ga0070714_1000106634 | 160 |
| 26 | 3300005435 | Ga0070714_100028935 | Ga0070714_1000289353 | 160 |
| 27 | 3300005435 | Ga0070714_100781935 | Ga0070714_1007819351 | 160 |
| 28 | 3300005436 | Ga0070713_100073884 | Ga0070713_1000738842 | 160 |
| 29 | 3300005436 | Ga0070713_100317312 | Ga0070713_1003173122 | 160 |
| 30 | 3300005436 | Ga0070713_101123391 | Ga0070713_1011233911 | 160 |
| 31 | 3300005437 | Ga0070710_10011836 | Ga0070710_100118362 | 160 |
| 32 | 3300005439 | Ga0070711_100027455 | Ga0070711_1000274554 | 160 |
| 33 | 3300005439 | Ga0070711_100055898 | Ga0070711_1000558983 | 160 |
| 34 | 3300005439 | Ga0070711_100426560 | Ga0070711_1004265602 | 160 |
| 35 | 3300005444 | Ga0070694_100005533 | Ga0070694_1000055334 | 160 |
| 36 | 3300005445 | Ga0070708_100071584 | Ga0070708_1000715842 | 160 |
| 37 | 3300005445 | Ga0070708_100601574 | Ga0070708_1006015741 | 160 |
| 38 | 3300005445 | Ga0070708_100644944 | Ga0070708_1006449442 | 160 |
| 39 | 3300005471 | Ga0070698_100363408 | Ga0070698_1003634082 | 160 |
| 40 | 3300005471 | Ga0070698_100367145 | Ga0070698_1003671452 | 160 |
| 41 | 3300005518 | Ga0070699_100003596 | Ga0070699_10000359618 | 160 |
| 42 | 3300005536 | Ga0070697_100224989 | Ga0070697_1002249892 | 160 |
| 43 | 3300005536 | Ga0070697_100452588 | Ga0070697_1004525881 | 160 |
| 44 | 3300005548 | Ga0070665_100700410 | Ga0070665_1007004101 | 160 |
| 45 | 3300005577 | Ga0068857_101717072 | Ga0068857_1017170721 | 160 |
| 46 | 3300005615 | Ga0070702_100075722 | Ga0070702_1000757222 | 160 |
| 47 | 3300005719 | Ga0068861_100218303 | Ga0068861_1002183032 | 160 |
| 48 | 3300005937 | Ga0081455_10000833 | Ga0081455_1000083333 | 160 |
| 49 | 3300005937 | Ga0081455_10001744 | Ga0081455_1000174413 | 160 |
| 50 | 3300005937 | Ga0081455_10048929 | Ga0081455_100489292 | 160 |
| 51 | 3300005937 | Ga0081455_10068809 | Ga0081455_100688093 | 160 |
| 52 | 3300005937 | Ga0081455_10670284 | Ga0081455_106702841 | 160 |
| 53 | 3300005981 | Ga0081538_10000477 | Ga0081538_1000047724 | 160 |
| 54 | 3300005981 | Ga0081538_10040352 | Ga0081538_100403522 | 160 |
| 55 | 3300005983 | Ga0081540_1000066 | Ga0081540_100006639 | 160 |
| 56 | 3300005983 | Ga0081540_1075323 | Ga0081540_10753232 | 160 |
| 57 | 3300005983 | Ga0081540_1089050 | Ga0081540_10890502 | 160 |
| 58 | 3300005983 | Ga0081540_1089689 | Ga0081540_10896892 | 160 |
| 59 | 3300005983 | Ga0081540_1301956 | Ga0081540_13019561 | 160 |
| 60 | 3300005985 | Ga0081539_10027262 | Ga0081539_100272626 | 160 |
| 61 | 3300005985 | Ga0081539_10114855 | Ga0081539_101148552 | 160 |
| 62 | 3300006028 | Ga0070717_10011195 | Ga0070717_100111953 | 160 |
| 63 | 3300006028 | Ga0070717_10078478 | Ga0070717_100784784 | 160 |
| 64 | 3300006028 | Ga0070717_10128913 | Ga0070717_101289132 | 160 |
| 65 | 3300006028 | Ga0070717_11338330 | Ga0070717_113383301 | 160 |
| 66 | 3300006048 | Ga0075363_100234484 | Ga0075363_1002344841 | 160 |
| 67 | 3300006163 | Ga0070715_10016789 | Ga0070715_100167892 | 160 |
| 68 | 3300006163 | Ga0070715_10046392 | Ga0070715_100463922 | 160 |
| 69 | 3300006173 | Ga0070716_100026220 | Ga0070716_1000262203 | 160 |
| 70 | 3300006175 | Ga0070712_100102950 | Ga0070712_1001029502 | 160 |
| 71 | 3300006175 | Ga0070712_100130303 | Ga0070712_1001303032 | 160 |
| 72 | 3300006175 | Ga0070712_100209924 | Ga0070712_1002099242 | 160 |
| 73 | 3300006175 | Ga0070712_100413975 | Ga0070712_1004139752 | 160 |
| 74 | 3300006175 | Ga0070712_100720213 | Ga0070712_1007202131 | 160 |
| 75 | 3300006358 | Ga0068871_100584459 | Ga0068871_1005844592 | 160 |
| 76 | 3300006844 | Ga0075428_100012713 | Ga0075428_1000127136 | 160 |
| 77 | 3300006844 | Ga0075428_100344656 | Ga0075428_1003446563 | 160 |
| 78 | 3300006844 | Ga0075428_100654118 | Ga0075428_1006541182 | 160 |
| 79 | 3300006846 | Ga0075430_100036944 | Ga0075430_1000369442 | 160 |
| 80 | 3300006846 | Ga0075430_100507158 | Ga0075430_1005071582 | 160 |
| 81 | 3300006847 | Ga0075431_100043012 | Ga0075431_1000430122 | 160 |
| 82 | 3300006847 | Ga0075431_100123672 | Ga0075431_1001236722 | 160 |
| 83 | 3300006847 | Ga0075431_100708654 | Ga0075431_1007086542 | 160 |
| 84 | 3300006847 | Ga0075431_101644557 | Ga0075431_1016445571 | 160 |
| 85 | 3300006852 | Ga0075433_10016781 | Ga0075433_100167813 | 160 |
| 86 | 3300006852 | Ga0075433_10067174 | Ga0075433_100671744 | 160 |
| 87 | 3300006871 | Ga0075434_100003615 | Ga0075434_10000361513 | 160 |
| 88 | 3300006871 | Ga0075434_100005126 | Ga0075434_1000051269 | 160 |
| 89 | 3300006871 | Ga0075434_100033616 | Ga0075434_1000336164 | 160 |
| 90 | 3300006871 | Ga0075434_100190414 | Ga0075434_1001904142 | 160 |
| 91 | 3300006871 | Ga0075434_100458733 | Ga0075434_1004587331 | 160 |
| 92 | 3300006871 | Ga0075434_100799227 | Ga0075434_1007992271 | 160 |
| 93 | 3300006880 | Ga0075429_100052078 | Ga0075429_1000520783 | 160 |
| 94 | 3300006880 | Ga0075429_100321470 | Ga0075429_1003214702 | 160 |
| 95 | 3300007076 | Ga0075435_100009708 | Ga0075435_1000097085 | 160 |
| 96 | 3300007076 | Ga0075435_100079765 | Ga0075435_1000797652 | 160 |
| 97 | 3300007076 | Ga0075435_100102085 | Ga0075435_1001020852 | 160 |
| 98 | 3300007076 | Ga0075435_100809891 | Ga0075435_1008098911 | 160 |
| 99 | 3300007788 | Ga0099795_10130477 | Ga0099795_101304772 | 160 |
| 100 | 3300009094 | Ga0111539_10012212 | Ga0111539_100122122 | 160 |
| 101 | 3300009094 | Ga0111539_11822123 | Ga0111539_118221232 | 160 |
| 102 | 3300009147 | Ga0114129_10005944 | Ga0114129_100059443 | 160 |
| 103 | 3300009147 | Ga0114129_10138418 | Ga0114129_101384182 | 160 |
| 104 | 3300009147 | Ga0114129_10911259 | Ga0114129_109112591 | 160 |
| 105 | 3300010159 | Ga0099796_10031110 | Ga0099796_100311102 | 160 |
| 106 | 3300010159 | Ga0099796_10166528 | Ga0099796_101665282 | 160 |
| 107 | 3300014326 | Ga0157380_10048109 | Ga0157380_100481093 | 160 |
| 108 | 3300014969 | Ga0157376_10157545 | Ga0157376_101575452 | 160 |
| 109 | 3300014969 | Ga0157376_10259940 | Ga0157376_102599403 | 160 |
| 110 | 3300017792 | Ga0163161_10316198 | Ga0163161_103161982 | 160 |
| 111 | 3300021377 | Ga0213874_10164247 | Ga0213874_101642472 | 160 |
| 112 | 3300021384 | Ga0213876_10276364 | Ga0213876_102763642 | 160 |
| 113 | 3300021388 | Ga0213875_10000003 | Ga0213875_10000003348 | 160 |
| 114 | 3300024225 | Ga0224572_1066899 | Ga0224572_10668992 | 160 |
| 115 | 3300024227 | Ga0228598_1000419 | Ga0228598_10004192 | 160 |
| 116 | 3300025905 | Ga0207685_10018416 | Ga0207685_100184162 | 160 |
| 117 | 3300025906 | Ga0207699_10020215 | Ga0207699_100202152 | 160 |
| 118 | 3300025910 | Ga0207684_10242649 | Ga0207684_102426492 | 160 |
| 119 | 3300025910 | Ga0207684_10422540 | Ga0207684_104225402 | 160 |
| 120 | 3300025915 | Ga0207693_10003443 | Ga0207693_100034438 | 160 |
| 121 | 3300025915 | Ga0207693_10015430 | Ga0207693_100154303 | 160 |
| 122 | 3300025916 | Ga0207663_10049315 | Ga0207663_100493152 | 160 |
| 123 | 3300025916 | Ga0207663_10087850 | Ga0207663_100878502 | 160 |
| 124 | 3300025916 | Ga0207663_10342748 | Ga0207663_103427482 | 160 |
| 125 | 3300025922 | Ga0207646_10246635 | Ga0207646_102466352 | 160 |
| 126 | 3300025928 | Ga0207700_10130587 | Ga0207700_101305871 | 160 |
| 127 | 3300025928 | Ga0207700_10252674 | Ga0207700_102526742 | 160 |
| 128 | 3300025929 | Ga0207664_10012312 | Ga0207664_100123123 | 160 |
| 129 | 3300025929 | Ga0207664_10306776 | Ga0207664_103067762 | 160 |
| 130 | 3300025936 | Ga0207670_10031265 | Ga0207670_100312651 | 160 |
| 131 | 3300025939 | Ga0207665_10000206 | Ga0207665_1000020634 | 160 |
| 132 | 3300025939 | Ga0207665_10212645 | Ga0207665_102126452 | 160 |
| 133 | 3300026116 | Ga0207674_11088967 | Ga0207674_110889671 | 160 |
| 134 | 3300026118 | Ga0207675_100169632 | Ga0207675_1001696322 | 160 |
| 135 | 3300027907 | Ga0207428_10236531 | Ga0207428_102365312 | 160 |
| 136 | 3300028800 | Ga0265338_10013501 | Ga0265338_100135016 | 160 |
| 137 | 3300029957 | Ga0265324_10159851 | Ga0265324_101598512 | 160 |
| 138 | 3300031090 | Ga0265760_10110053 | Ga0265760_101100531 | 160 |
| 139 | 3300031241 | Ga0265325_10017407 | Ga0265325_100174072 | 160 |
| 140 | 3300031249 | Ga0265339_10000228 | Ga0265339_1000022816 | 160 |
| 141 | 3300031595 | Ga0265313_10000203 | Ga0265313_1000020311 | 160 |
| 142 | 3300031595 | Ga0265313_10000917 | Ga0265313_1000091719 | 160 |
| 143 | 3300031711 | Ga0265314_10016002 | Ga0265314_100160026 | 160 |
| 144 | 3300034816 | Ga0373930_0120040 | Ga0373930_0120040_16_501 | 160 |
| 145 | 3300034817 | Ga0373948_0008236 | Ga0373948_0008236_1268_1753 | 160 |
| 146 | 3300035084 | Ga0373928_0012687 | Ga0373928_0012687_226_708 | 160 |
| 147 | 3300035084 | Ga0373928_0037313 | Ga0373928_0037313_476_961 | 160 |
| 148 | 3300035085 | Ga0373929_0026350 | Ga0373929_0026350_73_558 | 160 |
| 149 | 3300035085 | Ga0373929_0077876 | Ga0373929_0077876_289_774 | 160 |
| 150 | 3300035088 | Ga0373940_0032303 | Ga0373940_0032303_577_1059 | 160 |
| 151 | 3300035090 | Ga0373949_0004006 | Ga0373949_0004006_29_514 | 160 |
| 152 | 3300035090 | Ga0373949_0158054 | Ga0373949_0158054_120_602 | 160 |
| 153 | 3300035091 | Ga0373951_0040869 | Ga0373951_0040869_569_1054 | 160 |
| 154 | 3300035114 | Ga0373939_0004832 | Ga0373939_0004832_1511_1996 | 160 |
| 155 | 3300035115 | Ga0373941_0002530 | Ga0373941_0002530_2099_2584 | 160 |
| 156 | 3300035115 | Ga0373941_0018703 | Ga0373941_0018703_111_593 | 160 |
| 157 | 3300035118 | Ga0373954_0081201 | Ga0373954_0081201_866_1348 | 160 |
| 158 | 3300035121 | Ga0373960_0005948 | Ga0373960_0005948_1307_1792 | 160 |
| 159 | 3300035241 | Ga0373961_0004077 | Ga0373961_0004077_2088_2573 | 160 |
| 160 | 3300035242 | Ga0373962_0007558 | Ga0373962_0007558_1930_2415 | 160 |
| 161 | 3300035691 | Ga0373931_0005252 | Ga0373931_0005252_3361_3843 | 160 |
| 162 | 3300035691 | Ga0373931_0006571 | Ga0373931_0006571_1952_2437 | 160 |
| 163 | 3300035691 | Ga0373931_0668146 | Ga0373931_0668146_29_511 | 160 |
| 164 | 3300035695 | Ga0373927_0107157 | Ga0373927_0107157_706_1188 | 160 |
| 165 | 3300035724 | Ga0373933_0037080 | Ga0373933_0037080_342_824 | 160 |
| 166 | 3300035725 | Ga0373947_0195982 | Ga0373947_0195982_366_848 | 160 |
| 167 | 3300036401 | Ga0373937_0492532 | Ga0373937_0492532_63_545 | 160 |
| 168 | 3300037068 | Ga0373925_0064431 | Ga0373925_0064431_2236_2718 | 160 |
| 169 | 3300037068 | Ga0373925_0353070 | Ga0373925_0353070_141_623 | 160 |
| 170 | 3300037471 | Ga0395905_0214714 | Ga0395905_0214714_505_1002 | 160 |
| 171 | 3300037853 | Ga0436364_0191605 | Ga0436364_0191605_22615_23097 | 160 |
| 172 | 3300039437 | Ga0436365_0569625 | Ga0436365_0569625_92_574 | 160 |
| 173 | 3300039437 | Ga0436365_0684505 | Ga0436365_0684505_275_757 | 160 |
| 174 | 3300039437 | Ga0436365_0688201 | Ga0436365_0688201_187_672 | 160 |
| 175 | 3300039437 | Ga0436365_1524923 | Ga0436365_1524923_93_575 | 160 |
| 176 | 3300039437 | Ga0436365_1858544 | Ga0436365_1858544_30_512 | 160 |
| 177 | 3300039438 | Ga0436360_0351713 | Ga0436360_0351713_640_1122 | 160 |
| 178 | 3300039447 | Ga0436361_1075969 | Ga0436361_1075969_75_557 | 160 |
| 179 | 3300039450 | Ga0436363_0608712 | Ga0436363_0608712_23_505 | 160 |
| 180 | 3300039450 | Ga0436363_1468080 | Ga0436363_1468080_1236_1718 | 160 |
| 181 | 3300039453 | Ga0436362_0521384 | Ga0436362_0521384_347_829 | 160 |
| 182 | 3300042008 | Ga0439450_141532 | Ga0439450_141532_29_511 | 160 |
| 183 | 3300045976 | Ga0466967_0910938 | Ga0466967_0910938_360_842 | 160 |
| 184 | 3300046454 | Ga0495592_0318118 | Ga0495592_0318118_281_763 | 160 |
| 185 | 3300046455 | Ga0495603_0188732 | Ga0495603_0188732_105_587 | 160 |
| 186 | 3300046457 | Ga0495590_0014214 | Ga0495590_0014214_1975_2463 | 160 |
| 187 | 3300046459 | Ga0495629_0372416 | Ga0495629_0372416_88_570 | 160 |
| 188 | 3300046460 | Ga0495638_0257434 | Ga0495638_0257434_274_762 | 160 |
| 189 | 3300046461 | Ga0495641_0105084 | Ga0495641_0105084_41_523 | 160 |
| 190 | 3300046473 | Ga0495582_0069021 | Ga0495582_0069021_1163_1645 | 160 |
| 191 | 3300046491 | Ga0495584_0056689 | Ga0495584_0056689_159_641 | 160 |
| 192 | 3300046491 | Ga0495584_0136964 | Ga0495584_0136964_642_1127 | 160 |
| 193 | 3300046491 | Ga0495584_0177149 | Ga0495584_0177149_435_923 | 160 |
| 194 | 3300046514 | Ga0495618_0262581 | Ga0495618_0262581_160_642 | 160 |
| 195 | 3300046517 | Ga0495630_1249366 | Ga0495630_1249366_32_514 | 160 |
| 196 | 3300046520 | Ga0495637_0270660 | Ga0495637_0270660_65_547 | 160 |
| 197 | 3300046529 | Ga0495652_0140164 | Ga0495652_0140164_352_834 | 160 |
| 198 | 3300046533 | Ga0495640_0133337 | Ga0495640_0133337_957_1439 | 160 |
| 199 | 3300046535 | Ga0495586_0128412 | Ga0495586_0128412_695_1177 | 160 |
| 200 | 3300046535 | Ga0495586_0167799 | Ga0495586_0167799_378_860 | 160 |
| 201 | 3300046536 | Ga0495587_0117666 | Ga0495587_0117666_509_991 | 160 |
| 202 | 3300046538 | Ga0495609_0325428 | Ga0495609_0325428_51_536 | 160 |
| 203 | 3300046543 | Ga0495645_0059971 | Ga0495645_0059971_1567_2049 | 160 |
| 204 | 3300046615 | Ga0495656_0113645 | Ga0495656_0113645_611_1093 | 160 |
| 205 | 3300046615 | Ga0495656_0175708 | Ga0495656_0175708_360_848 | 160 |
| 206 | 3300046664 | Ga0495659_0176571 | Ga0495659_0176571_174_659 | 160 |
| 207 | 3300046678 | Ga0495599_0037983 | Ga0495599_0037983_1798_2280 | 160 |
| 208 | 3300046679 | Ga0495623_0006581 | Ga0495623_0006581_1725_2207 | 160 |
| 209 | 3300046681 | Ga0495647_0080707 | Ga0495647_0080707_336_818 | 160 |
| 210 | 3300046683 | Ga0495658_0090738 | Ga0495658_0090738_344_826 | 160 |
| 211 | 3300046683 | Ga0495658_0338771 | Ga0495658_0338771_209_691 | 160 |
| 212 | 3300046689 | Ga0495613_0155398 | Ga0495613_0155398_410_892 | 160 |
| 213 | 3300046694 | Ga0495649_0277478 | Ga0495649_0277478_313_801 | 160 |
| 214 | 3300046809 | Ga0495600_0154425 | Ga0495600_0154425_131_613 | 160 |
| 215 | 3300047317 | Ga0495604_0164648 | Ga0495604_0164648_1048_1530 | 160 |
| 216 | 3300047471 | Ga0495684_0553142 | Ga0495684_0553142_32_514 | 160 |
| 217 | 3300047673 | Ga0495593_0379221 | Ga0495593_0379221_214_696 | 160 |
| 218 | 3300048903 | Ga0496100_0301266 | Ga0496100_0301266_312_794 | 160 |
| 219 | 3300048907 | Ga0496104_0000833 | Ga0496104_0000833_14901_15383 | 160 |
| 220 | 3300048907 | Ga0496104_0006728 | Ga0496104_0006728_5036_5524 | 160 |
| 221 | 3300048907 | Ga0496104_0016526 | Ga0496104_0016526_226_708 | 160 |
| 222 | 3300048908 | Ga0496105_0025499 | Ga0496105_0025499_2055_2537 | 160 |
| 223 | 3300048908 | Ga0496105_0141245 | Ga0496105_0141245_1124_1606 | 160 |
| 224 | 3300048908 | Ga0496105_0309736 | Ga0496105_0309736_152_634 | 160 |
| 225 | 3300048909 | Ga0496106_0064524 | Ga0496106_0064524_2054_2536 | 160 |
| 226 | 3300048909 | Ga0496106_0181844 | Ga0496106_0181844_989_1471 | 160 |
| 227 | 3300048909 | Ga0496106_0735988 | Ga0496106_0735988_244_726 | 160 |
| 228 | 3300048910 | Ga0496107_0115071 | Ga0496107_0115071_394_876 | 160 |
| 229 | 3300048910 | Ga0496107_0369291 | Ga0496107_0369291_571_1053 | 160 |
| 230 | 3300048911 | Ga0496108_0012371 | Ga0496108_0012371_3858_4346 | 160 |
| 231 | 3300048911 | Ga0496108_0018391 | Ga0496108_0018391_4924_5406 | 160 |
| 232 | 3300048911 | Ga0496108_0187761 | Ga0496108_0187761_113_595 | 160 |
| 233 | 3300048912 | Ga0496109_0006247 | Ga0496109_0006247_3116_3604 | 160 |
| 234 | 3300048912 | Ga0496109_1315304 | Ga0496109_1315304_144_626 | 160 |
| 235 | 3300048913 | Ga0496110_0003027 | Ga0496110_0003027_8597_9085 | 160 |
| 236 | 3300048913 | Ga0496110_0093959 | Ga0496110_0093959_2086_2568 | 160 |
| 237 | 3300048913 | Ga0496110_0231222 | Ga0496110_0231222_706_1188 | 160 |
| 238 | 3300048913 | Ga0496110_1211004 | Ga0496110_1211004_133_615 | 160 |
| 239 | 3300048914 | Ga0496111_0028102 | Ga0496111_0028102_522_1010 | 160 |
| 240 | 3300048914 | Ga0496111_0205820 | Ga0496111_0205820_477_965 | 160 |
| 241 | 3300048915 | Ga0496112_0209683 | Ga0496112_0209683_1052_1540 | 160 |
| 242 | 3300048915 | Ga0496112_0543300 | Ga0496112_0543300_234_716 | 160 |
| 243 | 3300048915 | Ga0496112_0715378 | Ga0496112_0715378_224_706 | 160 |
| 244 | 3300048916 | Ga0496113_0006125 | Ga0496113_0006125_4654_5142 | 160 |
| 245 | 3300048916 | Ga0496113_1186382 | Ga0496113_1186382_100_582 | 160 |
| 246 | 3300048917 | Ga0496114_0407443 | Ga0496114_0407443_99_581 | 160 |
| 247 | 3300048917 | Ga0496114_0577638 | Ga0496114_0577638_37_519 | 160 |
| 248 | 3300048918 | Ga0496115_0292910 | Ga0496115_0292910_91_573 | 160 |
| 249 | 3300049572 | Ga0501036_0117364 | Ga0501036_0117364_781_1263 | 160 |
| 250 | 3300049574 | Ga0501038_0339456 | Ga0501038_0339456_142_624 | 160 |
| 251 | 3300049575 | Ga0501039_0258813 | Ga0501039_0258813_81_563 | 160 |
| 252 | 3300049575 | Ga0501039_1130813 | Ga0501039_1130813_114_596 | 160 |
| 253 | 3300049577 | Ga0501041_0325486 | Ga0501041_0325486_292_774 | 160 |
| 254 | 3300049577 | Ga0501041_0564189 | Ga0501041_0564189_38_520 | 160 |
| 255 | 3300049580 | Ga0501046_1074837 | Ga0501046_1074837_45_527 | 160 |
| 256 | 3300049584 | Ga0501068_0691681 | Ga0501068_0691681_13_495 | 160 |
| 257 | 3300049586 | Ga0501070_0563498 | Ga0501070_0563498_370_855 | 160 |
| 258 | 3300049587 | Ga0501071_1002260 | Ga0501071_1002260_118_600 | 160 |
| 259 | 3300049588 | Ga0501072_0297934 | Ga0501072_0297934_607_1089 | 160 |
| 260 | 3300049589 | Ga0501073_0055597 | Ga0501073_0055597_79_561 | 160 |
| 261 | 3300049590 | Ga0501074_0533581 | Ga0501074_0533581_227_709 | 160 |
| 262 | 3300049591 | Ga0501075_0104941 | Ga0501075_0104941_1357_1839 | 160 |
| 263 | 3300049591 | Ga0501075_0311622 | Ga0501075_0311622_10_498 | 160 |
| 264 | 3300049592 | Ga0501076_0358068 | Ga0501076_0358068_408_890 | 160 |
| 265 | 3300049592 | Ga0501076_0362124 | Ga0501076_0362124_251_733 | 160 |
| 266 | 3300049741 | Ga0501079_0549055 | Ga0501079_0549055_348_830 | 160 |
| 267 | 3300049741 | Ga0501079_0688118 | Ga0501079_0688118_73_555 | 160 |
| 268 | 3300049742 | Ga0501080_0801837 | Ga0501080_0801837_19_507 | 160 |
| 269 | 3300049824 | Ga0501045_0402232 | Ga0501045_0402232_29_511 | 160 |
| 270 | 3300050493 | nmdc:mga0k408_455676_c1 | nmdc:mga0k408_455676_c1_232_714 | 160 |
| 271 | 3300050507 | nmdc:mga05p37_16059_c1 | nmdc:mga05p37_16059_c1_2636_3118 | 160 |
| 272 | 3300050507 | nmdc:mga05p37_656148_c1 | nmdc:mga05p37_656148_c1_280_765 | 160 |
| 273 | 3300050507 | nmdc:mga05p37_677646_c1 | nmdc:mga05p37_677646_c1_422_904 | 160 |
| 274 | 3300050508 | nmdc:mga09592_415198_c1 | nmdc:mga09592_415198_c1_288_770 | 160 |
| 275 | 3300050509 | nmdc:mga0qj67_600011_c1 | nmdc:mga0qj67_600011_c1_181_663 | 160 |
| 276 | 3300050510 | nmdc:mga06r32_35928_c1 | nmdc:mga06r32_35928_c1_511_999 | 160 |
| 277 | 3300050510 | nmdc:mga06r32_494828_c1 | nmdc:mga06r32_494828_c1_576_1058 | 160 |
| 278 | 3300050510 | nmdc:mga06r32_533586_c1 | nmdc:mga06r32_533586_c1_211_693 | 160 |
| 279 | 3300050510 | nmdc:mga06r32_800997_c1 | nmdc:mga06r32_800997_c1_396_878 | 160 |
| 280 | 3300050511 | nmdc:mga08y16_1168804_c1 | nmdc:mga08y16_1168804_c1_171_656 | 160 |
| 281 | 3300050512 | nmdc:mga0n895_1183_c1 | nmdc:mga0n895_1183_c1_15737_16225 | 160 |
| 282 | 3300050512 | nmdc:mga0n895_203391_c1 | nmdc:mga0n895_203391_c1_101_583 | 160 |
| 283 | 3300050512 | nmdc:mga0n895_217748_c1 | nmdc:mga0n895_217748_c1_1196_1681 | 160 |
| 284 | 3300050512 | nmdc:mga0n895_227161_c1 | nmdc:mga0n895_227161_c1_1224_1706 | 160 |
| 285 | 3300050512 | nmdc:mga0n895_588001_c1 | nmdc:mga0n895_588001_c1_343_825 | 160 |
| 286 | 3300050513 | nmdc:mga0rr50_1109508_c1 | nmdc:mga0rr50_1109508_c1_14_496 | 160 |
| 287 | 3300050513 | nmdc:mga0rr50_156016_c1 | nmdc:mga0rr50_156016_c1_877_1359 | 160 |
| 288 | 3300050513 | nmdc:mga0rr50_19486_c1 | nmdc:mga0rr50_19486_c1_2235_2720 | 160 |
| 289 | 3300050513 | nmdc:mga0rr50_81752_c1 | nmdc:mga0rr50_81752_c1_823_1311 | 160 |
| 290 | 3300050515 | nmdc:mga0a205_608831_c1 | nmdc:mga0a205_608831_c1_111_593 | 160 |
| 291 | 3300050515 | nmdc:mga0a205_7946_c1 | nmdc:mga0a205_7946_c1_3863_4348 | 160 |
| 292 | 3300053077 | Ga0495601_0314212 | Ga0495601_0314212_374_856 | 160 |
| 293 | 3300053077 | Ga0495601_0458107 | Ga0495601_0458107_158_640 | 160 |
| 294 | 3300053078 | Ga0495612_0276539 | Ga0495612_0276539_129_611 | 160 |
| 295 | 3300053084 | Ga0495595_0087970 | Ga0495595_0087970_768_1250 | 160 |
| 296 | 3300053085 | Ga0495619_0028928 | Ga0495619_0028928_2875_3357 | 160 |
| 297 | 3300053085 | Ga0495619_0120908 | Ga0495619_0120908_427_909 | 160 |
| 298 | 3300054114 | Ga0501084_0158530 | Ga0501084_0158530_41_523 | 160 |
| 299 | 3300054114 | Ga0501084_0382758 | Ga0501084_0382758_364_846 | 160 |
| 300 | 3300054114 | Ga0501084_0567236 | Ga0501084_0567236_415_897 | 160 |
| 301 | 3300054114 | Ga0501084_0587879 | Ga0501084_0587879_355_837 | 160 |
| 302 | 3300060353 | Ga0501082_0000175 | Ga0501082_0000175_33332_33814 | 160 |
| 303 | 3300060353 | Ga0501082_0025769 | Ga0501082_0025769_3655_4137 | 160 |
| 304 | 3300060353 | Ga0501082_0777264 | Ga0501082_0777264_70_552 | 160 |
| 305 | 3300061734 | Ga0530510_0124765 | Ga0530510_0124765_153_635 | 160 |
| 306 | 3300061734 | Ga0530510_0168670 | Ga0530510_0168670_588_1070 | 160 |
| 307 | 3300061734 | Ga0530510_0381345 | Ga0530510_0381345_204_686 | 160 |
| 308 | 3300049593 | Ga0501077_0309204 | Ga0501077_0309204_34_519 | 161 |
| 309 | 3300006175 | Ga0070712_100001496 | Ga0070712_1000014968 | 162 |
| 310 | 3300025915 | Ga0207693_10017237 | Ga0207693_100172376 | 162 |
| 311 | 3300050508 | nmdc:mga09592_413294_c1 | nmdc:mga09592_413294_c1_538_1044 | 162 |
| 312 | 3300050509 | nmdc:mga0qj67_398164_c1 | nmdc:mga0qj67_398164_c1_221_727 | 162 |
| 313 | 3300001977 | JGI24746J21847_1003822 | JGI24746J21847_10038222 | 164 |
| 314 | 3300001990 | JGI24737J22298_10041117 | JGI24737J22298_100411172 | 164 |
| 315 | 3300001991 | JGI24743J22301_10000566 | JGI24743J22301_100005662 | 164 |
| 316 | 3300002070 | JGI24750J21931_1001645 | JGI24750J21931_10016453 | 164 |
| 317 | 3300002073 | JGI24745J21846_1001606 | JGI24745J21846_10016062 | 164 |
| 318 | 3300002077 | JGI24744J21845_10007865 | JGI24744J21845_100078652 | 164 |
| 319 | 3300002155 | JGI24033J26618_1009974 | JGI24033J26618_10099741 | 164 |
| 320 | 3300002239 | JGI24034J26672_10010530 | JGI24034J26672_100105302 | 164 |
| 321 | 3300002244 | JGI24742J22300_10001659 | JGI24742J22300_100016594 | 164 |
| 322 | 3300002459 | JGI24751J29686_10006542 | JGI24751J29686_100065422 | 164 |
| 323 | 3300005329 | Ga0070683_100414667 | Ga0070683_1004146672 | 164 |
| 324 | 3300005330 | Ga0070690_100028954 | Ga0070690_1000289544 | 164 |
| 325 | 3300005331 | Ga0070670_100047454 | Ga0070670_1000474542 | 164 |
| 326 | 3300005331 | Ga0070670_100057256 | Ga0070670_1000572562 | 164 |
| 327 | 3300005335 | Ga0070666_10051697 | Ga0070666_100516972 | 164 |
| 328 | 3300005337 | Ga0070682_100248191 | Ga0070682_1002481912 | 164 |
| 329 | 3300005338 | Ga0068868_100002061 | Ga0068868_1000020616 | 164 |
| 330 | 3300005339 | Ga0070660_100307966 | Ga0070660_1003079662 | 164 |
| 331 | 3300005340 | Ga0070689_100011043 | Ga0070689_1000110437 | 164 |
| 332 | 3300005341 | Ga0070691_10062938 | Ga0070691_100629382 | 164 |
| 333 | 3300005343 | Ga0070687_100040738 | Ga0070687_1000407382 | 164 |
| 334 | 3300005345 | Ga0070692_10026449 | Ga0070692_100264492 | 164 |
| 335 | 3300005347 | Ga0070668_100015764 | Ga0070668_1000157646 | 164 |
| 336 | 3300005353 | Ga0070669_100037777 | Ga0070669_1000377772 | 164 |
| 337 | 3300005354 | Ga0070675_100118630 | Ga0070675_1001186302 | 164 |
| 338 | 3300005355 | Ga0070671_100021615 | Ga0070671_1000216153 | 164 |
| 339 | 3300005356 | Ga0070674_100240015 | Ga0070674_1002400152 | 164 |
| 340 | 3300005364 | Ga0070673_100335467 | Ga0070673_1003354672 | 164 |
| 341 | 3300005366 | Ga0070659_100078632 | Ga0070659_1000786322 | 164 |
| 342 | 3300005367 | Ga0070667_100015732 | Ga0070667_1000157323 | 164 |
| 343 | 3300005436 | Ga0070713_100450472 | Ga0070713_1004504722 | 164 |
| 344 | 3300005437 | Ga0070710_10092912 | Ga0070710_100929121 | 164 |
| 345 | 3300005438 | Ga0070701_10029660 | Ga0070701_100296604 | 164 |
| 346 | 3300005440 | Ga0070705_100463116 | Ga0070705_1004631162 | 164 |
| 347 | 3300005441 | Ga0070700_100002511 | Ga0070700_1000025113 | 164 |
| 348 | 3300005455 | Ga0070663_100035302 | Ga0070663_1000353022 | 164 |
| 349 | 3300005457 | Ga0070662_100200370 | Ga0070662_1002003701 | 164 |
| 350 | 3300005466 | Ga0070685_10047425 | Ga0070685_100474252 | 164 |
| 351 | 3300005530 | Ga0070679_101219027 | Ga0070679_1012190272 | 164 |
| 352 | 3300005535 | Ga0070684_100150888 | Ga0070684_1001508882 | 164 |
| 353 | 3300005539 | Ga0068853_100158346 | Ga0068853_1001583462 | 164 |
| 354 | 3300005543 | Ga0070672_100086369 | Ga0070672_1000863692 | 164 |
| 355 | 3300005546 | Ga0070696_100738048 | Ga0070696_1007380481 | 164 |
| 356 | 3300005547 | Ga0070693_100128278 | Ga0070693_1001282782 | 164 |
| 357 | 3300005548 | Ga0070665_100299988 | Ga0070665_1002999882 | 164 |
| 358 | 3300005549 | Ga0070704_100349515 | Ga0070704_1003495152 | 164 |
| 359 | 3300005564 | Ga0070664_100122991 | Ga0070664_1001229912 | 164 |
| 360 | 3300005578 | Ga0068854_100041784 | Ga0068854_1000417842 | 164 |
| 361 | 3300005614 | Ga0068856_100202442 | Ga0068856_1002024422 | 164 |
| 362 | 3300005615 | Ga0070702_100082177 | Ga0070702_1000821772 | 164 |
| 363 | 3300005616 | Ga0068852_100143228 | Ga0068852_1001432282 | 164 |
| 364 | 3300005618 | Ga0068864_100014519 | Ga0068864_1000145195 | 164 |
| 365 | 3300005618 | Ga0068864_100641314 | Ga0068864_1006413142 | 164 |
| 366 | 3300005718 | Ga0068866_10155508 | Ga0068866_101555082 | 164 |
| 367 | 3300005840 | Ga0068870_10001098 | Ga0068870_100010983 | 164 |
| 368 | 3300005841 | Ga0068863_100034678 | Ga0068863_1000346783 | 164 |
| 369 | 3300005842 | Ga0068858_100128046 | Ga0068858_1001280462 | 164 |
| 370 | 3300005937 | Ga0081455_10015715 | Ga0081455_100157152 | 164 |
| 371 | 3300005937 | Ga0081455_10093440 | Ga0081455_100934402 | 164 |
| 372 | 3300005981 | Ga0081538_10006000 | Ga0081538_100060006 | 164 |
| 373 | 3300005983 | Ga0081540_1006683 | Ga0081540_10066834 | 164 |
| 374 | 3300006028 | Ga0070717_10151321 | Ga0070717_101513212 | 164 |
| 375 | 3300006038 | Ga0075365_10197931 | Ga0075365_101979312 | 164 |
| 376 | 3300006038 | Ga0075365_10235572 | Ga0075365_102355722 | 164 |
| 377 | 3300006048 | Ga0075363_100313666 | Ga0075363_1003136662 | 164 |
| 378 | 3300006175 | Ga0070712_100093273 | Ga0070712_1000932732 | 164 |
| 379 | 3300006177 | Ga0075362_10340198 | Ga0075362_103401982 | 164 |
| 380 | 3300006237 | Ga0097621_100291073 | Ga0097621_1002910732 | 164 |
| 381 | 3300006358 | Ga0068871_100066837 | Ga0068871_1000668373 | 164 |
| 382 | 3300006844 | Ga0075428_100061160 | Ga0075428_1000611602 | 164 |
| 383 | 3300006844 | Ga0075428_100343160 | Ga0075428_1003431602 | 164 |
| 384 | 3300006846 | Ga0075430_100830036 | Ga0075430_1008300362 | 164 |
| 385 | 3300006847 | Ga0075431_100236100 | Ga0075431_1002361002 | 164 |
| 386 | 3300006847 | Ga0075431_100329203 | Ga0075431_1003292032 | 164 |
| 387 | 3300006847 | Ga0075431_100939162 | Ga0075431_1009391622 | 164 |
| 388 | 3300006871 | Ga0075434_100196707 | Ga0075434_1001967072 | 164 |
| 389 | 3300006880 | Ga0075429_100277424 | Ga0075429_1002774242 | 164 |
| 390 | 3300006881 | Ga0068865_100010707 | Ga0068865_1000107074 | 164 |
| 391 | 3300007076 | Ga0075435_101254578 | Ga0075435_1012545781 | 164 |
| 392 | 3300007788 | Ga0099795_10334364 | Ga0099795_103343641 | 164 |
| 393 | 3300009092 | Ga0105250_10021342 | Ga0105250_100213423 | 164 |
| 394 | 3300009094 | Ga0111539_10120071 | Ga0111539_101200713 | 164 |
| 395 | 3300009098 | Ga0105245_10084593 | Ga0105245_100845933 | 164 |
| 396 | 3300009147 | Ga0114129_10025593 | Ga0114129_100255938 | 164 |
| 397 | 3300009147 | Ga0114129_10088285 | Ga0114129_100882852 | 164 |
| 398 | 3300009147 | Ga0114129_10915290 | Ga0114129_109152902 | 164 |
| 399 | 3300009148 | Ga0105243_10014819 | Ga0105243_100148196 | 164 |
| 400 | 3300009174 | Ga0105241_10946426 | Ga0105241_109464262 | 164 |
| 401 | 3300009176 | Ga0105242_10042996 | Ga0105242_100429962 | 164 |
| 402 | 3300009177 | Ga0105248_10007960 | Ga0105248_1000796011 | 164 |
| 403 | 3300009177 | Ga0105248_11850695 | Ga0105248_118506951 | 164 |
| 404 | 3300009545 | Ga0105237_10082617 | Ga0105237_100826172 | 164 |
| 405 | 3300009553 | Ga0105249_10060160 | Ga0105249_100601602 | 164 |
| 406 | 3300009553 | Ga0105249_10301413 | Ga0105249_103014133 | 164 |
| 407 | 3300011119 | Ga0105246_10235470 | Ga0105246_102354702 | 164 |
| 408 | 3300011119 | Ga0105246_10753197 | Ga0105246_107531971 | 164 |
| 409 | 3300013102 | Ga0157371_10176523 | Ga0157371_101765232 | 164 |
| 410 | 3300013296 | Ga0157374_10059435 | Ga0157374_100594352 | 164 |
| 411 | 3300013306 | Ga0163162_10151281 | Ga0163162_101512812 | 164 |
| 412 | 3300013307 | Ga0157372_10878927 | Ga0157372_108789272 | 164 |
| 413 | 3300013308 | Ga0157375_10184320 | Ga0157375_101843202 | 164 |
| 414 | 3300014325 | Ga0163163_10134042 | Ga0163163_101340422 | 164 |
| 415 | 3300014325 | Ga0163163_10139397 | Ga0163163_101393972 | 164 |
| 416 | 3300014326 | Ga0157380_10049760 | Ga0157380_100497602 | 164 |
| 417 | 3300014745 | Ga0157377_10041804 | Ga0157377_100418042 | 164 |
| 418 | 3300014968 | Ga0157379_10009784 | Ga0157379_100097846 | 164 |
| 419 | 3300014969 | Ga0157376_10373530 | Ga0157376_103735302 | 164 |
| 420 | 3300017792 | Ga0163161_10015993 | Ga0163161_100159936 | 164 |
| 421 | 3300025321 | Ga0207656_10191252 | Ga0207656_101912521 | 164 |
| 422 | 3300025900 | Ga0207710_10035504 | Ga0207710_100355042 | 164 |
| 423 | 3300025901 | Ga0207688_10000447 | Ga0207688_1000044716 | 164 |
| 424 | 3300025903 | Ga0207680_10583227 | Ga0207680_105832271 | 164 |
| 425 | 3300025904 | Ga0207647_10029917 | Ga0207647_100299172 | 164 |
| 426 | 3300025907 | Ga0207645_10012433 | Ga0207645_100124332 | 164 |
| 427 | 3300025908 | Ga0207643_10007556 | Ga0207643_100075565 | 164 |
| 428 | 3300025915 | Ga0207693_10093222 | Ga0207693_100932222 | 164 |
| 429 | 3300025917 | Ga0207660_10464408 | Ga0207660_104644081 | 164 |
| 430 | 3300025918 | Ga0207662_10000788 | Ga0207662_1000078810 | 164 |
| 431 | 3300025919 | Ga0207657_10035616 | Ga0207657_100356162 | 164 |
| 432 | 3300025924 | Ga0207694_10146939 | Ga0207694_101469393 | 164 |
| 433 | 3300025925 | Ga0207650_10098612 | Ga0207650_100986122 | 164 |
| 434 | 3300025925 | Ga0207650_10208466 | Ga0207650_102084662 | 164 |
| 435 | 3300025926 | Ga0207659_10061633 | Ga0207659_100616333 | 164 |
| 436 | 3300025927 | Ga0207687_10071608 | Ga0207687_100716083 | 164 |
| 437 | 3300025928 | Ga0207700_10226249 | Ga0207700_102262492 | 164 |
| 438 | 3300025929 | Ga0207664_10507250 | Ga0207664_105072501 | 164 |
| 439 | 3300025933 | Ga0207706_10009920 | Ga0207706_100099204 | 164 |
| 440 | 3300025934 | Ga0207686_10372230 | Ga0207686_103722302 | 164 |
| 441 | 3300025935 | Ga0207709_10010146 | Ga0207709_100101462 | 164 |
| 442 | 3300025936 | Ga0207670_10039032 | Ga0207670_100390322 | 164 |
| 443 | 3300025937 | Ga0207669_10023517 | Ga0207669_100235173 | 164 |
| 444 | 3300025940 | Ga0207691_10021871 | Ga0207691_100218713 | 164 |
| 445 | 3300025941 | Ga0207711_10054318 | Ga0207711_100543182 | 164 |
| 446 | 3300025942 | Ga0207689_10004078 | Ga0207689_100040788 | 164 |
| 447 | 3300025944 | Ga0207661_10207354 | Ga0207661_102073542 | 164 |
| 448 | 3300025960 | Ga0207651_10064018 | Ga0207651_100640182 | 164 |
| 449 | 3300025961 | Ga0207712_10011129 | Ga0207712_100111294 | 164 |
| 450 | 3300025972 | Ga0207668_10112583 | Ga0207668_101125832 | 164 |
| 451 | 3300025981 | Ga0207640_10019563 | Ga0207640_100195635 | 164 |
| 452 | 3300025986 | Ga0207658_10141832 | Ga0207658_101418322 | 164 |
| 453 | 3300026023 | Ga0207677_10060907 | Ga0207677_100609072 | 164 |
| 454 | 3300026035 | Ga0207703_10014624 | Ga0207703_100146244 | 164 |
| 455 | 3300026041 | Ga0207639_10041749 | Ga0207639_100417492 | 164 |
| 456 | 3300026075 | Ga0207708_10000823 | Ga0207708_1000082310 | 164 |
| 457 | 3300026078 | Ga0207702_10260632 | Ga0207702_102606322 | 164 |
| 458 | 3300026088 | Ga0207641_10034045 | Ga0207641_100340452 | 164 |
| 459 | 3300026089 | Ga0207648_10001310 | Ga0207648_1000131015 | 164 |
| 460 | 3300026095 | Ga0207676_10089955 | Ga0207676_100899553 | 164 |
| 461 | 3300026116 | Ga0207674_10208427 | Ga0207674_102084272 | 164 |
| 462 | 3300026118 | Ga0207675_100029093 | Ga0207675_1000290932 | 164 |
| 463 | 3300026121 | Ga0207683_10014866 | Ga0207683_100148665 | 164 |
| 464 | 3300026142 | Ga0207698_10010459 | Ga0207698_100104593 | 164 |
| 465 | 3300027907 | Ga0207428_10823578 | Ga0207428_108235782 | 164 |
| 466 | 3300028379 | Ga0268266_10112426 | Ga0268266_101124262 | 164 |
| 467 | 3300028380 | Ga0268265_10160789 | Ga0268265_101607892 | 164 |
| 468 | 3300034819 | Ga0373958_0006521 | Ga0373958_0006521_713_1279 | 164 |
| 469 | 3300035112 | Ga0373932_0006337 | Ga0373932_0006337_363_929 | 164 |
| 470 | 3300035114 | Ga0373939_0311153 | Ga0373939_0311153_42_536 | 164 |
| 471 | 3300035115 | Ga0373941_0043678 | Ga0373941_0043678_25_591 | 164 |
| 472 | 3300035242 | Ga0373962_0002894 | Ga0373962_0002894_2104_2670 | 164 |
| 473 | 3300035691 | Ga0373931_0000445 | Ga0373931_0000445_13554_14120 | 164 |
| 474 | 3300035691 | Ga0373931_0039433 | Ga0373931_0039433_17_511 | 164 |
| 475 | 3300035691 | Ga0373931_0635461 | Ga0373931_0635461_74_622 | 164 |
| 476 | 3300036401 | Ga0373937_0587929 | Ga0373937_0587929_543_1037 | 164 |
| 477 | 3300041512 | Ga0451853_0731668 | Ga0451853_0731668_406_954 | 164 |
| 478 | 3300046459 | Ga0495629_0057438 | Ga0495629_0057438_63_557 | 164 |
| 479 | 3300046471 | Ga0495650_0145211 | Ga0495650_0145211_241_789 | 164 |
| 480 | 3300046476 | Ga0495662_0419433 | Ga0495662_0419433_13_561 | 164 |
| 481 | 3300046491 | Ga0495584_0193380 | Ga0495584_0193380_55_558 | 164 |
| 482 | 3300046492 | Ga0495585_0479365 | Ga0495585_0479365_79_573 | 164 |
| 483 | 3300046501 | Ga0495607_0096747 | Ga0495607_0096747_998_1501 | 164 |
| 484 | 3300046518 | Ga0495631_0269742 | Ga0495631_0269742_52_600 | 164 |
| 485 | 3300046519 | Ga0495632_0232899 | Ga0495632_0232899_152_646 | 164 |
| 486 | 3300046531 | Ga0495665_0150064 | Ga0495665_0150064_698_1192 | 164 |
| 487 | 3300046533 | Ga0495640_0364738 | Ga0495640_0364738_11_505 | 164 |
| 488 | 3300046615 | Ga0495656_0033621 | Ga0495656_0033621_643_1146 | 164 |
| 489 | 3300046642 | Ga0495634_0045179 | Ga0495634_0045179_1142_1636 | 164 |
| 490 | 3300046660 | Ga0495625_0433809 | Ga0495625_0433809_120_614 | 164 |
| 491 | 3300046810 | Ga0495660_0039750 | Ga0495660_0039750_1927_2475 | 164 |
| 492 | 3300047320 | Ga0495672_0090793 | Ga0495672_0090793_987_1496 | 164 |
| 493 | 3300047322 | Ga0495680_0072104 | Ga0495680_0072104_1016_1510 | 164 |
| 494 | 3300047471 | Ga0495684_0410693 | Ga0495684_0410693_409_903 | 164 |
| 495 | 3300047472 | Ga0495686_0623250 | Ga0495686_0623250_14_508 | 164 |
| 496 | 3300047673 | Ga0495593_0091987 | Ga0495593_0091987_133_627 | 164 |
| 497 | 3300048090 | Ga0495615_0013196 | Ga0495615_0013196_18_566 | 164 |
| 498 | 3300048903 | Ga0496100_0025958 | Ga0496100_0025958_2554_3048 | 164 |
| 499 | 3300048903 | Ga0496100_0031483 | Ga0496100_0031483_1667_2161 | 164 |
| 500 | 3300048904 | Ga0496101_0014604 | Ga0496101_0014604_4227_4775 | 164 |
| 501 | 3300048904 | Ga0496101_0032209 | Ga0496101_0032209_29_523 | 164 |
| 502 | 3300048905 | Ga0496102_0036614 | Ga0496102_0036614_1478_2026 | 164 |
| 503 | 3300048905 | Ga0496102_0123873 | Ga0496102_0123873_947_1441 | 164 |
| 504 | 3300048905 | Ga0496102_0296378 | Ga0496102_0296378_863_1384 | 164 |
| 505 | 3300048906 | Ga0496103_0001303 | Ga0496103_0001303_10933_11481 | 164 |
| 506 | 3300048906 | Ga0496103_0004456 | Ga0496103_0004456_4298_4792 | 164 |
| 507 | 3300048907 | Ga0496104_0016928 | Ga0496104_0016928_374_868 | 164 |
| 508 | 3300048908 | Ga0496105_0001940 | Ga0496105_0001940_5896_6444 | 164 |
| 509 | 3300048908 | Ga0496105_0095147 | Ga0496105_0095147_46_540 | 164 |
| 510 | 3300048909 | Ga0496106_0001089 | Ga0496106_0001089_12543_13091 | 164 |
| 511 | 3300048909 | Ga0496106_0023496 | Ga0496106_0023496_1570_2091 | 164 |
| 512 | 3300048909 | Ga0496106_0191210 | Ga0496106_0191210_340_834 | 164 |
| 513 | 3300048910 | Ga0496107_0349760 | Ga0496107_0349760_401_922 | 164 |
| 514 | 3300048911 | Ga0496108_0000775 | Ga0496108_0000775_19670_20164 | 164 |
| 515 | 3300048911 | Ga0496108_0012564 | Ga0496108_0012564_1103_1651 | 164 |
| 516 | 3300048913 | Ga0496110_0006963 | Ga0496110_0006963_8448_8942 | 164 |
| 517 | 3300048913 | Ga0496110_0099819 | Ga0496110_0099819_327_887 | 164 |
| 518 | 3300048914 | Ga0496111_0001603 | Ga0496111_0001603_11751_12299 | 164 |
| 519 | 3300048914 | Ga0496111_0039934 | Ga0496111_0039934_1894_2388 | 164 |
| 520 | 3300048915 | Ga0496112_0017309 | Ga0496112_0017309_777_1271 | 164 |
| 521 | 3300048915 | Ga0496112_0045865 | Ga0496112_0045865_849_1397 | 164 |
| 522 | 3300048916 | Ga0496113_0000524 | Ga0496113_0000524_16762_17310 | 164 |
| 523 | 3300048916 | Ga0496113_0003988 | Ga0496113_0003988_5532_6026 | 164 |
| 524 | 3300048917 | Ga0496114_0017299 | Ga0496114_0017299_1171_1719 | 164 |
| 525 | 3300048917 | Ga0496114_0193847 | Ga0496114_0193847_711_1205 | 164 |
| 526 | 3300048918 | Ga0496115_0018841 | Ga0496115_0018841_783_1331 | 164 |
| 527 | 3300048918 | Ga0496115_0041842 | Ga0496115_0041842_2518_3012 | 164 |
| 528 | 3300048918 | Ga0496115_0152666 | Ga0496115_0152666_816_1364 | 164 |
| 529 | 3300049584 | Ga0501068_0591648 | Ga0501068_0591648_158_679 | 164 |
| 530 | 3300050490 | nmdc:mga03n38_278600_c1 | nmdc:mga03n38_278600_c1_376_870 | 164 |
| 531 | 3300050492 | nmdc:mga0yw44_661840_c1 | nmdc:mga0yw44_661840_c1_14_517 | 164 |
| 532 | 3300050493 | nmdc:mga0k408_81429_c1 | nmdc:mga0k408_81429_c1_546_1040 | 164 |
| 533 | 3300050507 | nmdc:mga05p37_14334_c1 | nmdc:mga05p37_14334_c1_8078_8599 | 164 |
| 534 | 3300050507 | nmdc:mga05p37_16864_c1 | nmdc:mga05p37_16864_c1_6540_7034 | 164 |
| 535 | 3300050507 | nmdc:mga05p37_398807_c1 | nmdc:mga05p37_398807_c1_363_866 | 164 |
| 536 | 3300050508 | nmdc:mga09592_134179_c1 | nmdc:mga09592_134179_c1_374_877 | 164 |
| 537 | 3300050509 | nmdc:mga0qj67_29558_c1 | nmdc:mga0qj67_29558_c1_3281_3784 | 164 |
| 538 | 3300050509 | nmdc:mga0qj67_760326_c1 | nmdc:mga0qj67_760326_c1_211_705 | 164 |
| 539 | 3300050509 | nmdc:mga0qj67_765185_c1 | nmdc:mga0qj67_765185_c1_106_624 | 164 |
| 540 | 3300050510 | nmdc:mga06r32_140666_c1 | nmdc:mga06r32_140666_c1_637_1131 | 164 |
| 541 | 3300050510 | nmdc:mga06r32_253697_c1 | nmdc:mga06r32_253697_c1_945_1466 | 164 |
| 542 | 3300050510 | nmdc:mga06r32_347204_c1 | nmdc:mga06r32_347204_c1_462_956 | 164 |
| 543 | 3300050510 | nmdc:mga06r32_513304_c1 | nmdc:mga06r32_513304_c1_579_1082 | 164 |
| 544 | 3300050510 | nmdc:mga06r32_60633_c1 | nmdc:mga06r32_60633_c1_806_1324 | 164 |
| 545 | 3300050511 | nmdc:mga08y16_227320_c1 | nmdc:mga08y16_227320_c1_750_1268 | 164 |
| 546 | 3300050511 | nmdc:mga08y16_286844_c1 | nmdc:mga08y16_286844_c1_1048_1614 | 164 |
| 547 | 3300050511 | nmdc:mga08y16_437189_c1 | nmdc:mga08y16_437189_c1_612_1160 | 164 |
| 548 | 3300050511 | nmdc:mga08y16_462134_c1 | nmdc:mga08y16_462134_c1_227_721 | 164 |
| 549 | 3300050512 | nmdc:mga0n895_189979_c1 | nmdc:mga0n895_189979_c1_12_506 | 164 |
| 550 | 3300050513 | nmdc:mga0rr50_421964_c1 | nmdc:mga0rr50_421964_c1_424_927 | 164 |
| 551 | 3300053077 | Ga0495601_0130097 | Ga0495601_0130097_942_1490 | 164 |
| 552 | 3300053084 | Ga0495595_0126791 | Ga0495595_0126791_40_534 | 164 |
| 553 | 3300053084 | Ga0495595_0449382 | Ga0495595_0449382_66_620 | 164 |
| 554 | 3300053158 | Ga0500627_0065738 | Ga0500627_0065738_870_1379 | 164 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.8578 | 5 | 159 |
| 3hrd-assembly1.cif.gz_H | crystal structure of nicotinate dehydrogenase | 0.8488 | 6 | 159 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.8425 | 5 | 159 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.8343 | 7 | 161 |
| 4c7y-assembly1.cif.gz_A | aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide | 0.8342 | 7 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ffuD02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9168 | 84 | 158 | 1.10.150.120 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9074 | 83 | 158 | 1.10.150.120 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9063 | 83 | 158 | 1.10.150.120 |
| 1ffuD02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.8947 | 84 | 158 | 1.10.150.120 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.886 | 83 | 158 | 1.10.150.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A358QQ71-F1-model_v4 | Xanthine dehydrogenase | 0.8663 | 1 | 160 |
GO:0005506
GO:0016491 GO:0051536 |
| AF-A0A6N7FAG7-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.8627 | 5 | 159 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A327KLZ5-F1-model_v4 | (2Fe-2S)-binding protein | 0.8595 | 3 | 160 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A419F0Q4-F1-model_v4 | (2Fe-2S)-binding protein | 0.8589 | 7 | 154 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A6V8PIG4-F1-model_v4 | Aerobic carbon-monoxide dehydrogenase small subunit | 0.8588 | 6 | 163 |
GO:0005506
GO:0016491 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar