F463048

General Info

Members Datasets Scaffolds Average Seq Length
554 251 554 144

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_82200_c1|nmdc:mga08x19_82200_c1_997_1491
Length 158
Sequence MIAEHRLEPVETKNSANRRSLIMPTSNAVATWEGKLREGKGNFKGQSGAFGTRFEGKKGSNPEELIAAAHAGCFSMALSSALEKAGHPATRIETRAAVTLEMVDGSPKITKSVLDVRGKVDGIDQAAFQQAAEGAKKNCPVSKALQGNVDVTLDAKLV

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
178 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 0.18
Rhizosphere 98.38
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_2669138 2162886011 Bacteria 2215
2 JGI24751J29686_10001433 3300002459 Bacteria 4992
3 Ga0065714_10074150 3300005288 Bacteria 3077
4 Ga0065704_10643246 3300005289 Bacteria 586
5 Ga0065704_10752521 3300005289 Bacteria 541
6 Ga0065712_10000393 3300005290 Bacteria 14469
7 Ga0065712_10069663 3300005290 Bacteria 6918
8 Ga0065712_10350542 3300005290 Bacteria 788
9 Ga0065715_10131732 3300005293 Bacteria 2003
10 Ga0065707_10091743 3300005295 Bacteria 3886
11 Ga0065707_10227114 3300005295 Unclassified 1200
12 Ga0070658_10184936 3300005327 Bacteria 1754
13 Ga0070676_10185212 3300005328 Unclassified 1356
14 Ga0070676_10191605 3300005328 Bacteria 1335
15 Ga0070690_100002003 3300005330 Bacteria 10847
16 Ga0070690_100095727 3300005330 Bacteria 1961
17 Ga0070670_100004466 3300005331 Bacteria 11714
18 Ga0070670_100011332 3300005331 Bacteria 7619
19 Ga0070670_100015247 3300005331 Bacteria 6596
20 Ga0070670_100043064 3300005331 Unclassified 3881
21 Ga0070670_100353777 3300005331 Bacteria 1291
22 Ga0070670_100571015 3300005331 Unclassified 1010
23 Ga0068869_100018070 3300005334 Unclassified 4793
24 Ga0068869_100041017 3300005334 Bacteria 3313
25 Ga0068869_100623128 3300005334 Bacteria 913
26 Ga0070666_10167995 3300005335 Bacteria 1535
27 Ga0070680_100021318 3300005336 Bacteria 5148
28 Ga0070680_100054899 3300005336 Unclassified 3254
29 Ga0070680_100306724 3300005336 Bacteria 1346
30 Ga0068868_100191305 3300005338 Bacteria 1702
31 Ga0070689_100013704 3300005340 Bacteria 5873
32 Ga0070689_100103172 3300005340 Unclassified 2260
33 Ga0070689_100142065 3300005340 Bacteria 1931
34 Ga0070689_101174762 3300005340 Unclassified 688
35 Ga0070689_101228953 3300005340 Bacteria 673
36 Ga0070687_100021291 3300005343 Bacteria 3045
37 Ga0070687_100096694 3300005343 Bacteria 1645
38 Ga0070687_100250323 3300005343 Bacteria 1100
39 Ga0070687_100553224 3300005343 Bacteria 783
40 Ga0070692_10262707 3300005345 Bacteria 1038
41 Ga0070692_10289215 3300005345 Unclassified 996
42 Ga0070692_10308393 3300005345 Bacteria 969
43 Ga0070668_100067980 3300005347 Unclassified 2769
44 Ga0070668_100630313 3300005347 Bacteria 940
45 Ga0070669_100002549 3300005353 Bacteria 13166
46 Ga0070669_100734582 3300005353 Unclassified 835
47 Ga0070675_100004810 3300005354 Bacteria 10303
48 Ga0070675_100022563 3300005354 Bacteria 5031
49 Ga0070675_100027677 3300005354 Bacteria 4557
50 Ga0070671_100488345 3300005355 Bacteria 1059
51 Ga0070674_100086087 3300005356 Bacteria 2256
52 Ga0070674_101041095 3300005356 Bacteria 720
53 Ga0070674_101075555 3300005356 Bacteria 709
54 Ga0070673_100003572 3300005364 Bacteria 9712
55 Ga0070673_100011926 3300005364 Bacteria 5951
56 Ga0070673_100029120 3300005364 Bacteria 4115
57 Ga0070673_100051833 3300005364 Bacteria 3216
58 Ga0070688_100007036 3300005365 Bacteria 6050
59 Ga0070688_100016843 3300005365 Bacteria 4185
60 Ga0070688_100022092 3300005365 Bacteria 3723
61 Ga0070688_100027353 3300005365 Bacteria 3397
62 Ga0070688_100881809 3300005365 Bacteria 704
63 Ga0070703_10000245 3300005406 Bacteria 26412
64 Ga0070714_100001866 3300005435 Bacteria 15357
65 Ga0070714_100813718 3300005435 Bacteria 905
66 Ga0070710_10158977 3300005437 Bacteria 1400
67 Ga0070701_10015250 3300005438 Bacteria 3544
68 Ga0070701_10067889 3300005438 Bacteria 1898
69 Ga0070701_10339171 3300005438 Bacteria 935
70 Ga0070701_10511211 3300005438 Bacteria 782
71 Ga0070701_11219568 3300005438 Bacteria 534
72 Ga0070705_100002366 3300005440 Bacteria 9513
73 Ga0070705_100011027 3300005440 Bacteria 4546
74 Ga0070705_100012344 3300005440 Unclassified 4341
75 Ga0070700_100037548 3300005441 Bacteria 2947
76 Ga0070700_100394143 3300005441 Bacteria 1039
77 Ga0070700_101508128 3300005441 Bacteria 572
78 Ga0070694_100000872 3300005444 Bacteria 16983
79 Ga0070694_100003743 3300005444 Bacteria 9069
80 Ga0070694_100007039 3300005444 Bacteria 6842
81 Ga0070694_100031886 3300005444 Bacteria 3457
82 Ga0070694_100037712 3300005444 Bacteria 3207
83 Ga0070708_100043528 3300005445 Bacteria 3945
84 Ga0070708_100230000 3300005445 Bacteria 1740
85 Ga0070708_101095099 3300005445 Bacteria 746
86 Ga0070678_100465307 3300005456 Bacteria 1110
87 Ga0070662_100080981 3300005457 Bacteria 2418
88 Ga0070662_100146896 3300005457 Unclassified 1832
89 Ga0068867_100020227 3300005459 Unclassified 4743
90 Ga0068867_100362164 3300005459 Bacteria 1213
91 Ga0068867_100650848 3300005459 Bacteria 925
92 Ga0068867_101107870 3300005459 Bacteria 723
93 Ga0070685_10003193 3300005466 Bacteria 8344
94 Ga0070685_10071027 3300005466 Bacteria 2063
95 Ga0070685_10082608 3300005466 Bacteria 1928
96 Ga0070706_100070138 3300005467 Bacteria 3241
97 Ga0070706_100112000 3300005467 Bacteria 2540
98 Ga0070706_100138025 3300005467 Bacteria 2275
99 Ga0070706_100659111 3300005467 Bacteria 971
100 Ga0070707_100000077 3300005468 Bacteria 86719
101 Ga0070707_100009322 3300005468 Bacteria 9111
102 Ga0070707_100475139 3300005468 Bacteria 1211
103 Ga0070707_101523336 3300005468 Bacteria 635
104 Ga0070698_100001684 3300005471 Bacteria 24662
105 Ga0070698_100031715 3300005471 Bacteria 5478
106 Ga0070698_100084673 3300005471 Bacteria 3158
107 Ga0070698_100534261 3300005471 Bacteria 1111
108 Ga0070698_101262447 3300005471 Bacteria 688
109 Ga0070699_100087007 3300005518 Bacteria 2728
110 Ga0070699_100093976 3300005518 Bacteria 2624
111 Ga0070699_100240011 3300005518 Bacteria 1617
112 Ga0070699_100826566 3300005518 Bacteria 848
113 Ga0070697_100009133 3300005536 Bacteria 7745
114 Ga0070697_100013996 3300005536 Bacteria 6298
115 Ga0070697_100156401 3300005536 Bacteria 1924
116 Ga0070697_100180502 3300005536 Bacteria 1789
117 Ga0070672_100066056 3300005543 Unclassified 2863
118 Ga0070672_100084227 3300005543 Bacteria 2553
119 Ga0070672_101041989 3300005543 Bacteria 726
120 Ga0070686_100016350 3300005544 Bacteria 4315
121 Ga0070686_100038440 3300005544 Bacteria 2975
122 Ga0070686_100265254 3300005544 Bacteria 1260
123 Ga0070695_100004373 3300005545 Bacteria 8286
124 Ga0070695_100012926 3300005545 Bacteria 5011
125 Ga0070695_100060158 3300005545 Bacteria 2461
126 Ga0070695_100129984 3300005545 Unclassified 1735
127 Ga0070695_100327449 3300005545 Bacteria 1141
128 Ga0070696_100005529 3300005546 Bacteria 8436
129 Ga0070696_100014148 3300005546 Bacteria 5355
130 Ga0070696_101033178 3300005546 Archaea 688
131 Ga0070704_100001416 3300005549 Bacteria 12795
132 Ga0070704_100007963 3300005549 Bacteria 6327
133 Ga0070704_100051875 3300005549 Unclassified 2891
134 Ga0070704_100073517 3300005549 Bacteria 2490
135 Ga0070704_101534686 3300005549 Bacteria 613
136 Ga0070664_100147240 3300005564 Bacteria 2077
137 Ga0070664_100169021 3300005564 Unclassified 1939
138 Ga0068857_100007129 3300005577 Bacteria 9627
139 Ga0068854_100013145 3300005578 Bacteria 5426
140 Ga0068854_100898909 3300005578 Bacteria 778
141 Ga0070702_100341139 3300005615 Bacteria 1052
142 Ga0070702_100377759 3300005615 Unclassified 1006
143 Ga0070702_101118922 3300005615 Bacteria 630
144 Ga0068852_101483910 3300005616 Bacteria 700
145 Ga0068859_100025026 3300005617 Bacteria 5992
146 Ga0068859_100028460 3300005617 Bacteria 5602
147 Ga0068859_100090425 3300005617 Bacteria 3112
148 Ga0068859_100511419 3300005617 Bacteria 1296
149 Ga0068859_100704260 3300005617 Bacteria 1100
150 Ga0068864_100010393 3300005618 Bacteria 7687
151 Ga0068864_100029845 3300005618 Bacteria 4621
152 Ga0068864_100082789 3300005618 Bacteria 2816
153 Ga0068864_100798058 3300005618 Bacteria 928
154 Ga0068866_10304594 3300005718 Bacteria 996
155 Ga0068861_100056066 3300005719 Bacteria 3007
156 Ga0068861_100103697 3300005719 Bacteria 2267
157 Ga0068861_101224172 3300005719 Bacteria 727
158 Ga0068870_10102118 3300005840 Bacteria 1622
159 Ga0068863_100006326 3300005841 Bacteria 11612
160 Ga0068863_100098238 3300005841 Bacteria 2780
161 Ga0068863_100190122 3300005841 Bacteria 1973
162 Ga0068863_100507834 3300005841 Bacteria 1187
163 Ga0068858_100164222 3300005842 Bacteria 2092
164 Ga0068860_100273586 3300005843 Bacteria 1649
165 Ga0068860_100836376 3300005843 Bacteria 935
166 Ga0068860_100927276 3300005843 Unclassified 887
167 Ga0068862_100001278 3300005844 Bacteria 23579
168 Ga0068862_100336309 3300005844 Bacteria 1397
169 Ga0068862_100817665 3300005844 Bacteria 911
170 Ga0070717_10155868 3300006028 Bacteria 1979
171 Ga0075432_10113442 3300006058 Bacteria 1012
172 Ga0070715_10039729 3300006163 Bacteria 1962
173 Ga0070712_100512023 3300006175 Bacteria 1007
174 Ga0097621_100011962 3300006237 Bacteria 6419
175 Ga0097621_100514175 3300006237 Bacteria 1086
176 Ga0097621_100551037 3300006237 Bacteria 1049
177 Ga0068871_100089073 3300006358 Bacteria 2568
178 Ga0075428_100012694 3300006844 Bacteria 9369
179 Ga0075428_100027284 3300006844 Bacteria 6321
180 Ga0075428_100064508 3300006844 Bacteria 4011
181 Ga0075428_100132510 3300006844 Bacteria 2710
182 Ga0075428_100335232 3300006844 Bacteria 1625
183 Ga0075428_100702067 3300006844 Bacteria 1078
184 Ga0075428_100790913 3300006844 Bacteria 1008
185 Ga0075430_100203948 3300006846 Bacteria 1641
186 Ga0075431_100015629 3300006847 Bacteria 7694
187 Ga0075431_100402196 3300006847 Bacteria 1370
188 Ga0075433_10034149 3300006852 Bacteria 4366
189 Ga0075433_10053283 3300006852 Bacteria 3526
190 Ga0075433_10056824 3300006852 Bacteria 3420
191 Ga0075433_10177928 3300006852 Bacteria 1893
192 Ga0075433_10224975 3300006852 Bacteria 1666
193 Ga0075434_100007170 3300006871 Bacteria 10303
194 Ga0075434_100007922 3300006871 Bacteria 9846
195 Ga0075434_100036460 3300006871 Bacteria 4865
196 Ga0075434_100112314 3300006871 Bacteria 2736
197 Ga0075434_100163948 3300006871 Bacteria 2243
198 Ga0075434_100235379 3300006871 Bacteria 1851
199 Ga0075434_100489519 3300006871 Bacteria 1251
200 Ga0075429_100051926 3300006880 Bacteria 3566
201 Ga0075429_100112039 3300006880 Bacteria 2384
202 Ga0075429_100315389 3300006880 Bacteria 1368
203 Ga0075429_100326913 3300006880 Unclassified 1342
204 Ga0075429_100396673 3300006880 Bacteria 1208
205 Ga0068865_100079019 3300006881 Unclassified 2355
206 Ga0075436_100137655 3300006914 Bacteria 1715
207 Ga0075436_100142146 3300006914 Bacteria 1687
208 Ga0075436_100165819 3300006914 Bacteria 1559
209 Ga0075436_100188960 3300006914 Bacteria 1457
210 Ga0097620_100025023 3300006931 Bacteria 5992
211 Ga0097620_100028459 3300006931 Bacteria 5602
212 Ga0097620_100090425 3300006931 Bacteria 3112
213 Ga0097620_100511449 3300006931 Bacteria 1296
214 Ga0097620_100704253 3300006931 Bacteria 1100
215 Ga0075435_100004986 3300007076 Bacteria 9217
216 Ga0075435_100138357 3300007076 Bacteria 2041
217 Ga0075435_101719420 3300007076 Bacteria 550
218 Ga0099794_10000219 3300007265 Bacteria 20487
219 Ga0099794_10006092 3300007265 Bacteria 4871
220 Ga0099794_10097943 3300007265 Unclassified 1462
221 Ga0099794_10216089 3300007265 Bacteria 984
222 Ga0111539_10000810 3300009094 Bacteria 40595
223 Ga0111539_10004662 3300009094 Bacteria 17918
224 Ga0111539_10025488 3300009094 Bacteria 7250
225 Ga0111539_10108074 3300009094 Bacteria 3264
226 Ga0111539_10244532 3300009094 Bacteria 2089
227 Ga0111539_10439985 3300009094 Bacteria 1518
228 Ga0111539_10596473 3300009094 Bacteria 1286
229 Ga0114129_10070261 3300009147 Bacteria 4882
230 Ga0114129_10074459 3300009147 Bacteria 4730
231 Ga0114129_10079705 3300009147 Bacteria 4553
232 Ga0114129_10180094 3300009147 Bacteria 2876
233 Ga0114129_10649972 3300009147 Bacteria 1361
234 Ga0114129_11772286 3300009147 Bacteria 752
235 Ga0105241_11526261 3300009174 Bacteria 644
236 Ga0105242_10001165 3300009176 Bacteria 20702
237 Ga0105242_10177865 3300009176 Bacteria 1875
238 Ga0105242_10227866 3300009176 Bacteria 1669
239 Ga0105242_11210086 3300009176 Bacteria 775
240 Ga0105248_10343478 3300009177 Bacteria 1680
241 Ga0105249_10002749 3300009553 Bacteria 15219
242 Ga0105249_10003197 3300009553 Bacteria 14178
243 Ga0105249_10020855 3300009553 Bacteria 5860
244 Ga0105249_10065121 3300009553 Bacteria 3352
245 Ga0105249_10085379 3300009553 Bacteria 2941
246 Ga0105249_10467527 3300009553 Unclassified 1302
247 Ga0105249_11710068 3300009553 Bacteria 702
248 Ga0105249_12319721 3300009553 Bacteria 609
249 Ga0105249_12615776 3300009553 Bacteria 577
250 Ga0105246_10222218 3300011119 Bacteria 1481
251 Ga0157374_10610979 3300013296 Bacteria 1101
252 Ga0157378_10081958 3300013297 Bacteria 2917
253 Ga0163162_10043360 3300013306 Bacteria 4505
254 Ga0163162_10052834 3300013306 Unclassified 4082
255 Ga0163162_10164252 3300013306 Bacteria 2344
256 Ga0157375_10020946 3300013308 Bacteria 5983
257 Ga0157375_10135361 3300013308 Unclassified 2587
258 Ga0157375_10234186 3300013308 Bacteria 1995
259 Ga0163163_10226857 3300014325 Bacteria 1917
260 Ga0163163_10326386 3300014325 Bacteria 1589
261 Ga0163163_10840723 3300014325 Bacteria 981
262 Ga0157380_10005493 3300014326 Bacteria 8859
263 Ga0157380_10017785 3300014326 Bacteria 5267
264 Ga0157380_10022727 3300014326 Bacteria 4728
265 Ga0157380_10776908 3300014326 Bacteria 972
266 Ga0157377_10000659 3300014745 Bacteria 14381
267 Ga0157377_10052214 3300014745 Bacteria 2307
268 Ga0157377_10145595 3300014745 Bacteria 1460
269 Ga0157377_10492566 3300014745 Bacteria 855
270 Ga0157379_10185046 3300014968 Bacteria 1882
271 Ga0157376_10131389 3300014969 Bacteria 2234
272 Ga0157376_12258342 3300014969 Bacteria 583
273 Ga0163161_10015165 3300017792 Bacteria 5369
274 Ga0163161_10743936 3300017792 Bacteria 820
275 Ga0163161_10831738 3300017792 Bacteria 778
276 Ga0197907_10043426 3300020069 Unclassified 577
277 Ga0206356_11365317 3300020070 Unclassified 755
278 Ga0207666_1041706 3300025271 Bacteria 718
279 Ga0207673_1037459 3300025290 Bacteria 678
280 Ga0207697_10059773 3300025315 Bacteria 1584
281 Ga0207697_10065061 3300025315 Unclassified 1521
282 Ga0207653_10000024 3300025885 Bacteria 117069
283 Ga0207682_10009872 3300025893 Bacteria 3754
284 Ga0207682_10234504 3300025893 Bacteria 851
285 Ga0207692_10133065 3300025898 Bacteria 1407
286 Ga0207642_10526589 3300025899 Bacteria 727
287 Ga0207685_10006469 3300025905 Bacteria 3192
288 Ga0207643_10004365 3300025908 Bacteria 7598
289 Ga0207643_10266344 3300025908 Unclassified 1059
290 Ga0207705_10038665 3300025909 Bacteria 3417
291 Ga0207684_10003609 3300025910 Bacteria 15062
292 Ga0207684_10028463 3300025910 Bacteria 4761
293 Ga0207684_10056081 3300025910 Bacteria 3342
294 Ga0207684_10301350 3300025910 Bacteria 1382
295 Ga0207654_11294295 3300025911 Bacteria 531
296 Ga0207693_10400123 3300025915 Bacteria 1074
297 Ga0207660_10002949 3300025917 Bacteria 11123
298 Ga0207660_10035319 3300025917 Unclassified 3470
299 Ga0207660_10462023 3300025917 Bacteria 1027
300 Ga0207662_10057520 3300025918 Bacteria 2324
301 Ga0207662_10119839 3300025918 Bacteria 1649
302 Ga0207662_10128650 3300025918 Bacteria 1594
303 Ga0207662_10134229 3300025918 Bacteria 1563
304 Ga0207662_10815578 3300025918 Bacteria 658
305 Ga0207649_11004323 3300025920 Bacteria 657
306 Ga0207646_10000076 3300025922 Bacteria 135473
307 Ga0207646_10045006 3300025922 Bacteria 3962
308 Ga0207646_10185934 3300025922 Bacteria 1877
309 Ga0207646_10355976 3300025922 Bacteria 1322
310 Ga0207681_10028135 3300025923 Bacteria 3640
311 Ga0207681_10075399 3300025923 Unclassified 2365
312 Ga0207681_10257455 3300025923 Bacteria 1365
313 Ga0207650_10001285 3300025925 Bacteria 18202
314 Ga0207650_10192205 3300025925 Bacteria 1631
315 Ga0207650_10236886 3300025925 Unclassified 1474
316 Ga0207650_10391284 3300025925 Bacteria 1149
317 Ga0207650_10688297 3300025925 Unclassified 863
318 Ga0207650_11221329 3300025925 Unclassified 640
319 Ga0207659_10030626 3300025926 Unclassified 3678
320 Ga0207659_10221620 3300025926 Bacteria 1521
321 Ga0207659_10294348 3300025926 Bacteria 1331
322 Ga0207700_11162853 3300025928 Bacteria 689
323 Ga0207664_10017012 3300025929 Bacteria 5319
324 Ga0207644_10601756 3300025931 Unclassified 913
325 Ga0207644_11367370 3300025931 Bacteria 595
326 Ga0207706_10036362 3300025933 Unclassified 4374
327 Ga0207706_10110390 3300025933 Bacteria 2420
328 Ga0207706_10332173 3300025933 Bacteria 1322
329 Ga0207686_10000498 3300025934 Bacteria 25770
330 Ga0207686_10032968 3300025934 Bacteria 3087
331 Ga0207670_10033390 3300025936 Bacteria 3315
332 Ga0207670_10042309 3300025936 Bacteria 3001
333 Ga0207670_10943979 3300025936 Unclassified 724
334 Ga0207704_10225253 3300025938 Bacteria 1390
335 Ga0207704_11848203 3300025938 Bacteria 519
336 Ga0207691_10014404 3300025940 Bacteria 7541
337 Ga0207691_10038893 3300025940 Bacteria 4402
338 Ga0207691_10183619 3300025940 Bacteria 1827
339 Ga0207711_10412216 3300025941 Bacteria 1256
340 Ga0207689_10045161 3300025942 Unclassified 3644
341 Ga0207689_10053634 3300025942 Bacteria 3322
342 Ga0207689_10212835 3300025942 Bacteria 1597
343 Ga0207679_10515145 3300025945 Bacteria 1069
344 Ga0207667_11401811 3300025949 Bacteria 672
345 Ga0207651_10000912 3300025960 Bacteria 12998
346 Ga0207651_10006411 3300025960 Bacteria 6157
347 Ga0207651_10020926 3300025960 Bacteria 3961
348 Ga0207651_10051114 3300025960 Bacteria 2810
349 Ga0207651_10058501 3300025960 Bacteria 2664
350 Ga0207712_10001312 3300025961 Bacteria 17052
351 Ga0207712_10001935 3300025961 Bacteria 13612
352 Ga0207712_10028489 3300025961 Bacteria 3736
353 Ga0207712_10513107 3300025961 Bacteria 1026
354 Ga0207668_10028706 3300025972 Unclassified 3641
355 Ga0207640_10024352 3300025981 Unclassified 3651
356 Ga0207640_10177516 3300025981 Bacteria 1594
357 Ga0207658_10554696 3300025986 Bacteria 1028
358 Ga0207703_10461384 3300026035 Bacteria 1188
359 Ga0207708_10303056 3300026075 Bacteria 1300
360 Ga0207708_10304159 3300026075 Bacteria 1298
361 Ga0207708_10408855 3300026075 Bacteria 1124
362 Ga0207641_10000467 3300026088 Bacteria 45772
363 Ga0207641_10086236 3300026088 Bacteria 2737
364 Ga0207641_10168910 3300026088 Bacteria 1995
365 Ga0207648_10031304 3300026089 Unclassified 4703
366 Ga0207648_10407968 3300026089 Bacteria 1232
367 Ga0207676_10017905 3300026095 Bacteria 5141
368 Ga0207676_10176165 3300026095 Bacteria 1868
369 Ga0207676_10524107 3300026095 Bacteria 1128
370 Ga0207674_10003180 3300026116 Bacteria 20225
371 Ga0207675_100000299 3300026118 Bacteria 47665
372 Ga0207675_100205800 3300026118 Bacteria 1891
373 Ga0207675_100308952 3300026118 Bacteria 1541
374 Ga0207675_101028266 3300026118 Bacteria 843
375 Ga0207683_10155017 3300026121 Bacteria 2069
376 Ga0207698_10753171 3300026142 Bacteria 973
377 Ga0209588_1000202 3300027671 Bacteria 16230
378 Ga0209588_1003286 3300027671 Bacteria 4473
379 Ga0207428_10043138 3300027907 Bacteria 3644
380 Ga0207428_10135883 3300027907 Unclassified 1879
381 Ga0207428_10148039 3300027907 Bacteria 1789
382 Ga0207428_10383608 3300027907 Bacteria 1030
383 Ga0207428_10781662 3300027907 Bacteria 679
384 Ga0268265_10028813 3300028380 Bacteria 3980
385 Ga0268265_10228365 3300028380 Bacteria 1634
386 Ga0268265_11278350 3300028380 Bacteria 733
387 Ga0268265_11409966 3300028380 Unclassified 699
388 Ga0268264_10282397 3300028381 Unclassified 1556
389 Ga0307408_101894362 3300031548 Bacteria 572
390 Ga0316576_10007772 3300031727 Bacteria 6774
391 Ga0316578_10127318 3300031728 Bacteria 1532
392 Ga0307405_10009318 3300031731 Bacteria 5027
393 Ga0316577_10038066 3300031733 Bacteria 2689
394 Ga0307413_10729486 3300031824 Bacteria 826
395 Ga0307410_10086671 3300031852 Bacteria 2212
396 Ga0307406_10456634 3300031901 Bacteria 1026
397 Ga0307407_10002547 3300031903 Bacteria 7167
398 Ga0307412_10003150 3300031911 Bacteria 9158
399 Ga0307409_100455084 3300031995 Bacteria 1236
400 Ga0307416_100018583 3300032002 Bacteria 4902
401 Ga0307416_100072544 3300032002 Unclassified 2866
402 Ga0307414_10052480 3300032004 Bacteria 2838
403 Ga0307411_10000879 3300032005 Bacteria 11358
404 Ga0307411_10158758 3300032005 Bacteria 1690
405 Ga0307415_100007727 3300032126 Bacteria 5906
406 Ga0307415_100389232 3300032126 Bacteria 1186
407 Ga0373926_0175118 3300035083 Bacteria 822
408 Ga0373940_0155942 3300035088 Bacteria 730
409 Ga0373932_0332830 3300035112 Bacteria 574
410 Ga0373956_0251129 3300035119 Bacteria 841
411 Ga0373943_0128688 3300035170 Bacteria 1353
412 Ga0373946_0451871 3300035171 Bacteria 654
413 Ga0373942_0008855 3300035207 Bacteria 2351
414 Ga0373961_0002701 3300035241 Bacteria 4538
415 Ga0316574_0206095 3300035398 Bacteria 1262
416 Ga0373935_1051708 3300035692 Unclassified 605
417 Ga0373947_0381843 3300035725 Bacteria 948
418 Ga0373937_0097898 3300036401 Bacteria 2721
419 Ga0395898_0930674 3300037466 Bacteria 807
420 Ga0451800_0818037 3300041459 Bacteria 686
421 Ga0451843_0781955 3300041509 Bacteria 2280
422 Ga0439441_031243 3300042001 Bacteria 1033
423 Ga0439445_0016842 3300042004 Bacteria 1802
424 Ga0439445_0082450 3300042004 Bacteria 900
425 Ga0439444_0028166 3300042437 Bacteria 1039
426 Ga0451577_0044384 3300042876 Bacteria 3980
427 Ga0453683_0072496 3300044673 Bacteria 2156
428 Ga0453683_0464403 3300044673 Bacteria 819
429 Ga0453683_1169307 3300044673 Unclassified 514
430 Ga0453684_0825487 3300044712 Bacteria 998
431 Ga0451576_0003131 3300045051 Bacteria 23171
432 Ga0451576_0009663 3300045051 Bacteria 11159
433 Ga0451576_0052021 3300045051 Unclassified 4292
434 Ga0451576_0124866 3300045051 Bacteria 2681
435 Ga0451576_0435148 3300045051 Bacteria 1376
436 Ga0451576_0554143 3300045051 Unclassified 1208
437 Ga0466967_0803844 3300045976 Bacteria 934
438 Ga0495627_001593 3300046453 Bacteria 12752
439 Ga0495603_0063318 3300046455 Bacteria 2182
440 Ga0495629_0834605 3300046459 Bacteria 607
441 Ga0495580_0233579 3300046472 Bacteria 1262
442 Ga0495605_0134240 3300046474 Bacteria 1114
443 Ga0495639_0026741 3300046475 Bacteria 2552
444 Ga0495584_0229946 3300046491 Bacteria 943
445 Ga0495594_0520702 3300046499 Bacteria 675
446 Ga0495596_0255523 3300046500 Bacteria 680
447 Ga0495644_0159487 3300046523 Bacteria 865
448 Ga0495663_0023367 3300046525 Bacteria 1790
449 Ga0495642_0169940 3300046528 Bacteria 947
450 Ga0495642_0338774 3300046528 Bacteria 661
451 Ga0495598_0007728 3300046537 Bacteria 2479
452 Ga0495598_0069337 3300046537 Bacteria 1107
453 Ga0495609_0034840 3300046538 Unclassified 2280
454 Ga0495621_0004188 3300046539 Bacteria 4030
455 Ga0495621_0065617 3300046539 Unclassified 1327
456 Ga0495621_0100819 3300046539 Bacteria 1098
457 Ga0495621_0111077 3300046539 Bacteria 1051
458 Ga0495622_0010974 3300046557 Bacteria 4181
459 Ga0495633_0000036 3300046558 Bacteria 184999
460 Ga0495633_0125417 3300046558 Bacteria 1188
461 Ga0495659_0107867 3300046664 Unclassified 1085
462 Ga0495658_0920191 3300046683 Bacteria 559
463 Ga0495624_0105993 3300046690 Bacteria 1730
464 Ga0495624_0256141 3300046690 Bacteria 1058
465 Ga0495670_0125293 3300046691 Bacteria 1337
466 Ga0495670_0708540 3300046691 Unclassified 549
467 Ga0495649_0104464 3300046694 Bacteria 1504
468 Ga0495589_0084375 3300046794 Bacteria 1544
469 Ga0495672_0029182 3300047320 Bacteria 3478
470 Ga0495672_0035861 3300047320 Bacteria 3051
471 Ga0495676_0132325 3300047321 Bacteria 1799
472 Ga0495677_0021142 3300047445 Bacteria 2359
473 Ga0495626_0114981 3300048091 Bacteria 1161
474 Ga0501031_0600678 3300049568 Unclassified 708
475 Ga0501032_0004687 3300049569 Bacteria 10262
476 Ga0501032_0027679 3300049569 Bacteria 3896
477 Ga0501034_0029202 3300049571 Bacteria 5605
478 Ga0501034_0094207 3300049571 Unclassified 2991
479 Ga0501034_0595746 3300049571 Bacteria 1011
480 Ga0501034_1039295 3300049571 Bacteria 702
481 Ga0501036_0003416 3300049572 Bacteria 12692
482 Ga0501036_0014802 3300049572 Bacteria 6505
483 Ga0501037_0017762 3300049573 Bacteria 5236
484 Ga0501037_0148621 3300049573 Bacteria 1675
485 Ga0501038_0010673 3300049574 Bacteria 8401
486 Ga0501038_0035197 3300049574 Bacteria 4397
487 Ga0501039_0016906 3300049575 Bacteria 5592
488 Ga0501039_0183254 3300049575 Bacteria 1646
489 Ga0501040_1334136 3300049576 Unclassified 521
490 Ga0501043_0020417 3300049579 Bacteria 5196
491 Ga0501043_0130860 3300049579 Bacteria 1966
492 Ga0501046_0003510 3300049580 Bacteria 14366
493 Ga0501046_0036206 3300049580 Bacteria 3974
494 Ga0501047_0055611 3300049581 Bacteria 3826
495 Ga0501047_0128236 3300049581 Bacteria 2417
496 Ga0501047_0875236 3300049581 Bacteria 712
497 Ga0501048_0035118 3300049582 Bacteria 3610
498 Ga0501067_0191508 3300049583 Unclassified 1139
499 Ga0501068_0035423 3300049584 Bacteria 2979
500 Ga0501070_0012717 3300049586 Bacteria 7098
501 Ga0501073_0329772 3300049589 Unclassified 1053
502 Ga0501074_0003003 3300049590 Bacteria 11870
503 Ga0501079_0133957 3300049741 Bacteria 1929
504 Ga0501083_0001228 3300049744 Bacteria 17354
505 Ga0501283_081036 3300049779 Unclassified 610
506 Ga0501035_0009147 3300049822 Bacteria 9212
507 Ga0501035_0117132 3300049822 Bacteria 2331
508 Ga0501044_0008422 3300049823 Bacteria 11308
509 Ga0501044_0200688 3300049823 Bacteria 1953
510 Ga0501044_0232454 3300049823 Bacteria 1791
511 nmdc:mga05p37_1010560_c1 3300050507 Bacteria 882
512 nmdc:mga05p37_1721450_c1 3300050507 Bacteria 610
513 nmdc:mga05p37_214160_c1 3300050507 Bacteria 2327
514 nmdc:mga09592_155092_c1 3300050508 Bacteria 1976
515 nmdc:mga09592_251377_c1 3300050508 Bacteria 1532
516 nmdc:mga09592_50342_c1 3300050508 Bacteria 3514
517 nmdc:mga09592_594457_c1 3300050508 Bacteria 948
518 nmdc:mga09592_856821_c1 3300050508 Bacteria 766
519 nmdc:mga09592_88102_c1 3300050508 Bacteria 2651
520 nmdc:mga0qj67_21761_c1 3300050509 Bacteria 4920
521 nmdc:mga06r32_44707_c1 3300050510 Bacteria 4218
522 nmdc:mga06r32_71087_c1 3300050510 Bacteria 3367
523 nmdc:mga06r32_88897_c1 3300050510 Bacteria 3016
524 nmdc:mga08y16_138339_c1 3300050511 Bacteria 2532
525 nmdc:mga08y16_2581_c1 3300050511 Bacteria 18625
526 nmdc:mga08y16_280677_c1 3300050511 Bacteria 1718
527 nmdc:mga08y16_31684_c1 3300050511 Bacteria 5559
528 nmdc:mga08y16_390725_c1 3300050511 Bacteria 1425
529 nmdc:mga0n895_136554_c1 3300050512 Unclassified 2479
530 nmdc:mga0n895_487610_c1 3300050512 Bacteria 1243
531 nmdc:mga0n895_49930_c1 3300050512 Bacteria 4101
532 nmdc:mga0n895_56595_c1 3300050512 Bacteria 3863
533 nmdc:mga0n895_675494_c1 3300050512 Bacteria 1030
534 nmdc:mga0n895_997938_c1 3300050512 Bacteria 819
535 nmdc:mga0rr50_43004_c1 3300050513 Bacteria 3303
536 nmdc:mga0rr50_46189_c1 3300050513 Bacteria 3206
537 nmdc:mga0rr50_72971_c1 3300050513 Bacteria 2623
538 nmdc:mga08x19_183293_c1 3300050514 Bacteria 1430
539 nmdc:mga08x19_48_c1 3300050514 Bacteria 141135
540 nmdc:mga08x19_65414_c1 3300050514 Bacteria 2361
541 nmdc:mga08x19_82200_c1 3300050514 Bacteria 2116
542 nmdc:mga08x19_88852_c1 3300050514 Bacteria 2037
543 nmdc:mga0a205_26342_c1 3300050515 Bacteria 5544
544 nmdc:mga0a205_718405_c1 3300050515 Bacteria 849
545 nmdc:mga0a205_75254_c1 3300050515 Bacteria 3262
546 nmdc:mga0a205_80703_c1 3300050515 Bacteria 3143
547 Ga0500635_0045680 3300053080 Bacteria 1483
548 Ga0500651_0025852 3300053093 Bacteria 3686
549 Ga0500641_0142595 3300053096 Bacteria 1035
550 Ga0500556_0029813 3300053104 Bacteria 1843
551 Ga0500568_0004673 3300053139 Bacteria 7280
552 Ga0500616_0406727 3300053153 Unclassified 543
553 Ga0500637_0061091 3300053178 Bacteria 2158
554 Ga0530510_0054690 3300061734 Bacteria 2885

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025911 Ga0207654_11294295 Ga0207654_112942952 119
2 3300005435 Ga0070714_100001866 Ga0070714_10000186615 122
3 3300025929 Ga0207664_10017012 Ga0207664_100170123 122
4 3300005719 Ga0068861_100056066 Ga0068861_1000560664 128
5 3300025918 Ga0207662_10057520 Ga0207662_100575201 128
6 3300025923 Ga0207681_10257455 Ga0207681_102574552 128
7 3300044673 Ga0453683_0464403 Ga0453683_0464403_12_440 128
8 3300005445 Ga0070708_100230000 Ga0070708_1002300003 129
9 3300005468 Ga0070707_101523336 Ga0070707_1015233361 129
10 3300005518 Ga0070699_100093976 Ga0070699_1000939763 129
11 3300005536 Ga0070697_100180502 Ga0070697_1001805022 129
12 3300006914 Ga0075436_100165819 Ga0075436_1001658191 129
13 3300025922 Ga0207646_10185934 Ga0207646_101859342 129
14 3300050514 nmdc:mga08x19_82200_c1 nmdc:mga08x19_82200_c1_997_1491 129
15 3300025949 Ga0207667_11401811 Ga0207667_114018112 133
16 3300025290 Ga0207673_1037459 Ga0207673_10374591 134
17 3300002459 JGI24751J29686_10001433 JGI24751J29686_100014336 135
18 3300005288 Ga0065714_10074150 Ga0065714_100741504 135
19 3300005327 Ga0070658_10184936 Ga0070658_101849362 135
20 3300005328 Ga0070676_10191605 Ga0070676_101916052 135
21 3300005330 Ga0070690_100002003 Ga0070690_1000020031 135
22 3300005330 Ga0070690_100095727 Ga0070690_1000957272 135
23 3300005331 Ga0070670_100004466 Ga0070670_10000446610 135
24 3300005331 Ga0070670_100043064 Ga0070670_1000430642 135
25 3300005331 Ga0070670_100571015 Ga0070670_1005710152 135
26 3300005334 Ga0068869_100623128 Ga0068869_1006231281 135
27 3300005335 Ga0070666_10167995 Ga0070666_101679952 135
28 3300005336 Ga0070680_100021318 Ga0070680_1000213186 135
29 3300005336 Ga0070680_100054899 Ga0070680_1000548995 135
30 3300005336 Ga0070680_100306724 Ga0070680_1003067242 135
31 3300005340 Ga0070689_100142065 Ga0070689_1001420652 135
32 3300005340 Ga0070689_101174762 Ga0070689_1011747622 135
33 3300005340 Ga0070689_101228953 Ga0070689_1012289531 135
34 3300005343 Ga0070687_100021291 Ga0070687_1000212913 135
35 3300005343 Ga0070687_100250323 Ga0070687_1002503232 135
36 3300005345 Ga0070692_10262707 Ga0070692_102627072 135
37 3300005345 Ga0070692_10308393 Ga0070692_103083932 135
38 3300005347 Ga0070668_100630313 Ga0070668_1006303132 135
39 3300005354 Ga0070675_100022563 Ga0070675_1000225633 135
40 3300005356 Ga0070674_101041095 Ga0070674_1010410951 135
41 3300005356 Ga0070674_101075555 Ga0070674_1010755552 135
42 3300005364 Ga0070673_100011926 Ga0070673_1000119267 135
43 3300005365 Ga0070688_100022092 Ga0070688_1000220922 135
44 3300005406 Ga0070703_10000245 Ga0070703_1000024519 135
45 3300005435 Ga0070714_100813718 Ga0070714_1008137182 135
46 3300005437 Ga0070710_10158977 Ga0070710_101589771 135
47 3300005438 Ga0070701_10015250 Ga0070701_100152503 135
48 3300005438 Ga0070701_10067889 Ga0070701_100678894 135
49 3300005438 Ga0070701_11219568 Ga0070701_112195681 135
50 3300005440 Ga0070705_100002366 Ga0070705_1000023667 135
51 3300005440 Ga0070705_100011027 Ga0070705_1000110273 135
52 3300005440 Ga0070705_100012344 Ga0070705_1000123447 135
53 3300005441 Ga0070700_101508128 Ga0070700_1015081281 135
54 3300005444 Ga0070694_100000872 Ga0070694_1000008728 135
55 3300005444 Ga0070694_100003743 Ga0070694_1000037436 135
56 3300005444 Ga0070694_100007039 Ga0070694_1000070394 135
57 3300005444 Ga0070694_100031886 Ga0070694_1000318862 135
58 3300005444 Ga0070694_100037712 Ga0070694_1000377122 135
59 3300005445 Ga0070708_100043528 Ga0070708_1000435282 135
60 3300005457 Ga0070662_100080981 Ga0070662_1000809813 135
61 3300005459 Ga0068867_101107870 Ga0068867_1011078702 135
62 3300005466 Ga0070685_10071027 Ga0070685_100710273 135
63 3300005467 Ga0070706_100070138 Ga0070706_1000701382 135
64 3300005467 Ga0070706_100112000 Ga0070706_1001120003 135
65 3300005467 Ga0070706_100138025 Ga0070706_1001380252 135
66 3300005467 Ga0070706_100659111 Ga0070706_1006591112 135
67 3300005468 Ga0070707_100000077 Ga0070707_10000007749 135
68 3300005468 Ga0070707_100009322 Ga0070707_1000093227 135
69 3300005468 Ga0070707_100475139 Ga0070707_1004751392 135
70 3300005471 Ga0070698_100031715 Ga0070698_1000317153 135
71 3300005471 Ga0070698_100534261 Ga0070698_1005342612 135
72 3300005471 Ga0070698_101262447 Ga0070698_1012624472 135
73 3300005518 Ga0070699_100087007 Ga0070699_1000870073 135
74 3300005518 Ga0070699_100240011 Ga0070699_1002400112 135
75 3300005518 Ga0070699_100826566 Ga0070699_1008265662 135
76 3300005536 Ga0070697_100009133 Ga0070697_1000091337 135
77 3300005536 Ga0070697_100013996 Ga0070697_1000139963 135
78 3300005536 Ga0070697_100156401 Ga0070697_1001564012 135
79 3300005543 Ga0070672_100084227 Ga0070672_1000842274 135
80 3300005543 Ga0070672_101041989 Ga0070672_1010419891 135
81 3300005544 Ga0070686_100016350 Ga0070686_1000163503 135
82 3300005544 Ga0070686_100038440 Ga0070686_1000384404 135
83 3300005545 Ga0070695_100004373 Ga0070695_1000043735 135
84 3300005545 Ga0070695_100012926 Ga0070695_1000129265 135
85 3300005545 Ga0070695_100060158 Ga0070695_1000601582 135
86 3300005545 Ga0070695_100129984 Ga0070695_1001299842 135
87 3300005545 Ga0070695_100327449 Ga0070695_1003274492 135
88 3300005546 Ga0070696_100005529 Ga0070696_1000055294 135
89 3300005546 Ga0070696_100014148 Ga0070696_1000141483 135
90 3300005546 Ga0070696_101033178 Ga0070696_1010331781 135
91 3300005549 Ga0070704_100001416 Ga0070704_1000014167 135
92 3300005549 Ga0070704_100007963 Ga0070704_1000079636 135
93 3300005549 Ga0070704_100051875 Ga0070704_1000518752 135
94 3300005549 Ga0070704_100073517 Ga0070704_1000735173 135
95 3300005564 Ga0070664_100147240 Ga0070664_1001472402 135
96 3300005578 Ga0068854_100898909 Ga0068854_1008989092 135
97 3300005615 Ga0070702_100377759 Ga0070702_1003777592 135
98 3300005617 Ga0068859_100025026 Ga0068859_1000250265 135
99 3300005617 Ga0068859_100511419 Ga0068859_1005114192 135
100 3300005618 Ga0068864_100010393 Ga0068864_1000103937 135
101 3300005618 Ga0068864_100029845 Ga0068864_1000298455 135
102 3300005718 Ga0068866_10304594 Ga0068866_103045942 135
103 3300005719 Ga0068861_100103697 Ga0068861_1001036972 135
104 3300005719 Ga0068861_101224172 Ga0068861_1012241722 135
105 3300005840 Ga0068870_10102118 Ga0068870_101021183 135
106 3300005841 Ga0068863_100190122 Ga0068863_1001901223 135
107 3300005842 Ga0068858_100164222 Ga0068858_1001642223 135
108 3300005843 Ga0068860_100273586 Ga0068860_1002735862 135
109 3300005843 Ga0068860_100836376 Ga0068860_1008363762 135
110 3300006028 Ga0070717_10155868 Ga0070717_101558682 135
111 3300006163 Ga0070715_10039729 Ga0070715_100397293 135
112 3300006175 Ga0070712_100512023 Ga0070712_1005120232 135
113 3300006237 Ga0097621_100514175 Ga0097621_1005141752 135
114 3300006237 Ga0097621_100551037 Ga0097621_1005510372 135
115 3300006844 Ga0075428_100012694 Ga0075428_1000126942 135
116 3300006844 Ga0075428_100132510 Ga0075428_1001325103 135
117 3300006844 Ga0075428_100335232 Ga0075428_1003352322 135
118 3300006844 Ga0075428_100702067 Ga0075428_1007020672 135
119 3300006846 Ga0075430_100203948 Ga0075430_1002039481 135
120 3300006847 Ga0075431_100015629 Ga0075431_1000156293 135
121 3300006847 Ga0075431_100402196 Ga0075431_1004021962 135
122 3300006852 Ga0075433_10034149 Ga0075433_100341494 135
123 3300006852 Ga0075433_10053283 Ga0075433_100532834 135
124 3300006852 Ga0075433_10056824 Ga0075433_100568244 135
125 3300006852 Ga0075433_10177928 Ga0075433_101779282 135
126 3300006852 Ga0075433_10224975 Ga0075433_102249753 135
127 3300006871 Ga0075434_100007170 Ga0075434_1000071707 135
128 3300006871 Ga0075434_100007922 Ga0075434_1000079228 135
129 3300006871 Ga0075434_100036460 Ga0075434_1000364603 135
130 3300006871 Ga0075434_100112314 Ga0075434_1001123144 135
131 3300006871 Ga0075434_100163948 Ga0075434_1001639483 135
132 3300006871 Ga0075434_100235379 Ga0075434_1002353792 135
133 3300006871 Ga0075434_100489519 Ga0075434_1004895193 135
134 3300006880 Ga0075429_100112039 Ga0075429_1001120391 135
135 3300006880 Ga0075429_100315389 Ga0075429_1003153891 135
136 3300006914 Ga0075436_100137655 Ga0075436_1001376554 135
137 3300006914 Ga0075436_100142146 Ga0075436_1001421463 135
138 3300006914 Ga0075436_100188960 Ga0075436_1001889602 135
139 3300006931 Ga0097620_100025023 Ga0097620_1000250235 135
140 3300006931 Ga0097620_100511449 Ga0097620_1005114492 135
141 3300007076 Ga0075435_100004986 Ga0075435_1000049868 135
142 3300007076 Ga0075435_100138357 Ga0075435_1001383573 135
143 3300007076 Ga0075435_101719420 Ga0075435_1017194201 135
144 3300007265 Ga0099794_10000219 Ga0099794_100002193 135
145 3300007265 Ga0099794_10006092 Ga0099794_100060923 135
146 3300007265 Ga0099794_10097943 Ga0099794_100979432 135
147 3300007265 Ga0099794_10216089 Ga0099794_102160893 135
148 3300009094 Ga0111539_10000810 Ga0111539_1000081021 135
149 3300009094 Ga0111539_10025488 Ga0111539_100254887 135
150 3300009094 Ga0111539_10108074 Ga0111539_101080744 135
151 3300009094 Ga0111539_10439985 Ga0111539_104399852 135
152 3300009094 Ga0111539_10596473 Ga0111539_105964732 135
153 3300009147 Ga0114129_10070261 Ga0114129_100702613 135
154 3300009147 Ga0114129_10180094 Ga0114129_101800943 135
155 3300009147 Ga0114129_10649972 Ga0114129_106499721 135
156 3300009147 Ga0114129_11772286 Ga0114129_117722861 135
157 3300009176 Ga0105242_11210086 Ga0105242_112100862 135
158 3300009553 Ga0105249_10003197 Ga0105249_100031976 135
159 3300009553 Ga0105249_10065121 Ga0105249_100651213 135
160 3300009553 Ga0105249_12319721 Ga0105249_123197211 135
161 3300013297 Ga0157378_10081958 Ga0157378_100819583 135
162 3300014325 Ga0163163_10326386 Ga0163163_103263861 135
163 3300014326 Ga0157380_10022727 Ga0157380_100227273 135
164 3300014745 Ga0157377_10052214 Ga0157377_100522143 135
165 3300017792 Ga0163161_10831738 Ga0163161_108317382 135
166 3300020069 Ga0197907_10043426 Ga0197907_100434261 135
167 3300020070 Ga0206356_11365317 Ga0206356_113653171 135
168 3300025315 Ga0207697_10059773 Ga0207697_100597732 135
169 3300025885 Ga0207653_10000024 Ga0207653_1000002436 135
170 3300025893 Ga0207682_10234504 Ga0207682_102345042 135
171 3300025898 Ga0207692_10133065 Ga0207692_101330653 135
172 3300025905 Ga0207685_10006469 Ga0207685_100064693 135
173 3300025909 Ga0207705_10038665 Ga0207705_100386653 135
174 3300025910 Ga0207684_10003609 Ga0207684_1000360912 135
175 3300025910 Ga0207684_10028463 Ga0207684_100284632 135
176 3300025910 Ga0207684_10056081 Ga0207684_100560813 135
177 3300025915 Ga0207693_10400123 Ga0207693_104001232 135
178 3300025917 Ga0207660_10002949 Ga0207660_1000294912 135
179 3300025917 Ga0207660_10035319 Ga0207660_100353192 135
180 3300025917 Ga0207660_10462023 Ga0207660_104620232 135
181 3300025918 Ga0207662_10128650 Ga0207662_101286502 135
182 3300025918 Ga0207662_10134229 Ga0207662_101342293 135
183 3300025920 Ga0207649_11004323 Ga0207649_110043231 135
184 3300025922 Ga0207646_10000076 Ga0207646_1000007664 135
185 3300025922 Ga0207646_10045006 Ga0207646_100450065 135
186 3300025922 Ga0207646_10355976 Ga0207646_103559762 135
187 3300025925 Ga0207650_10001285 Ga0207650_1000128521 135
188 3300025925 Ga0207650_10236886 Ga0207650_102368862 135
189 3300025925 Ga0207650_10688297 Ga0207650_106882972 135
190 3300025926 Ga0207659_10294348 Ga0207659_102943482 135
191 3300025928 Ga0207700_11162853 Ga0207700_111628532 135
192 3300025931 Ga0207644_10601756 Ga0207644_106017561 135
193 3300025931 Ga0207644_11367370 Ga0207644_113673701 135
194 3300025933 Ga0207706_10110390 Ga0207706_101103903 135
195 3300025933 Ga0207706_10332173 Ga0207706_103321732 135
196 3300025936 Ga0207670_10033390 Ga0207670_100333905 135
197 3300025936 Ga0207670_10943979 Ga0207670_109439792 135
198 3300025940 Ga0207691_10038893 Ga0207691_100388934 135
199 3300025942 Ga0207689_10212835 Ga0207689_102128353 135
200 3300025945 Ga0207679_10515145 Ga0207679_105151452 135
201 3300025960 Ga0207651_10000912 Ga0207651_100009129 135
202 3300025961 Ga0207712_10028489 Ga0207712_100284892 135
203 3300026075 Ga0207708_10303056 Ga0207708_103030562 135
204 3300026088 Ga0207641_10168910 Ga0207641_101689102 135
205 3300026095 Ga0207676_10017905 Ga0207676_100179055 135
206 3300026118 Ga0207675_100205800 Ga0207675_1002058003 135
207 3300026118 Ga0207675_100308952 Ga0207675_1003089523 135
208 3300026142 Ga0207698_10753171 Ga0207698_107531712 135
209 3300027671 Ga0209588_1000202 Ga0209588_10002028 135
210 3300027671 Ga0209588_1003286 Ga0209588_10032864 135
211 3300027907 Ga0207428_10043138 Ga0207428_100431382 135
212 3300027907 Ga0207428_10148039 Ga0207428_101480392 135
213 3300027907 Ga0207428_10383608 Ga0207428_103836082 135
214 3300027907 Ga0207428_10781662 Ga0207428_107816621 135
215 3300031548 Ga0307408_101894362 Ga0307408_1018943621 135
216 3300031727 Ga0316576_10007772 Ga0316576_100077727 135
217 3300031728 Ga0316578_10127318 Ga0316578_101273182 135
218 3300031731 Ga0307405_10009318 Ga0307405_100093186 135
219 3300031733 Ga0316577_10038066 Ga0316577_100380662 135
220 3300031824 Ga0307413_10729486 Ga0307413_107294862 135
221 3300031852 Ga0307410_10086671 Ga0307410_100866712 135
222 3300031901 Ga0307406_10456634 Ga0307406_104566342 135
223 3300031903 Ga0307407_10002547 Ga0307407_100025478 135
224 3300031911 Ga0307412_10003150 Ga0307412_100031508 135
225 3300031995 Ga0307409_100455084 Ga0307409_1004550842 135
226 3300032002 Ga0307416_100018583 Ga0307416_1000185835 135
227 3300032002 Ga0307416_100072544 Ga0307416_1000725444 135
228 3300032005 Ga0307411_10000879 Ga0307411_100008799 135
229 3300032005 Ga0307411_10158758 Ga0307411_101587582 135
230 3300032126 Ga0307415_100007727 Ga0307415_1000077272 135
231 3300032126 Ga0307415_100389232 Ga0307415_1003892322 135
232 3300035083 Ga0373926_0175118 Ga0373926_0175118_297_725 135
233 3300035088 Ga0373940_0155942 Ga0373940_0155942_227_658 135
234 3300035112 Ga0373932_0332830 Ga0373932_0332830_24_455 135
235 3300035170 Ga0373943_0128688 Ga0373943_0128688_866_1294 135
236 3300035171 Ga0373946_0451871 Ga0373946_0451871_68_496 135
237 3300035207 Ga0373942_0008855 Ga0373942_0008855_412_837 135
238 3300035241 Ga0373961_0002701 Ga0373961_0002701_3800_4228 135
239 3300035398 Ga0316574_0206095 Ga0316574_0206095_60_488 135
240 3300035692 Ga0373935_1051708 Ga0373935_1051708_119_571 135
241 3300035725 Ga0373947_0381843 Ga0373947_0381843_99_527 135
242 3300037466 Ga0395898_0930674 Ga0395898_0930674_205_720 135
243 3300042001 Ga0439441_031243 Ga0439441_031243_34_522 135
244 3300042437 Ga0439444_0028166 Ga0439444_0028166_245_733 135
245 3300042876 Ga0451577_0044384 Ga0451577_0044384_3411_3854 135
246 3300044673 Ga0453683_0072496 Ga0453683_0072496_1219_1662 135
247 3300045051 Ga0451576_0003131 Ga0451576_0003131_20167_20610 135
248 3300045051 Ga0451576_0009663 Ga0451576_0009663_10119_10571 135
249 3300045051 Ga0451576_0052021 Ga0451576_0052021_3842_4270 135
250 3300045051 Ga0451576_0124866 Ga0451576_0124866_49_477 135
251 3300045051 Ga0451576_0435148 Ga0451576_0435148_607_1035 135
252 3300045051 Ga0451576_0554143 Ga0451576_0554143_567_995 135
253 3300045976 Ga0466967_0803844 Ga0466967_0803844_466_891 135
254 3300046455 Ga0495603_0063318 Ga0495603_0063318_1698_2123 135
255 3300046459 Ga0495629_0834605 Ga0495629_0834605_112_561 135
256 3300046472 Ga0495580_0233579 Ga0495580_0233579_810_1238 135
257 3300046474 Ga0495605_0134240 Ga0495605_0134240_356_781 135
258 3300046475 Ga0495639_0026741 Ga0495639_0026741_1366_1794 135
259 3300046491 Ga0495584_0229946 Ga0495584_0229946_500_928 135
260 3300046500 Ga0495596_0255523 Ga0495596_0255523_14_442 135
261 3300046523 Ga0495644_0159487 Ga0495644_0159487_43_471 135
262 3300046525 Ga0495663_0023367 Ga0495663_0023367_1332_1760 135
263 3300046528 Ga0495642_0169940 Ga0495642_0169940_93_518 135
264 3300046537 Ga0495598_0007728 Ga0495598_0007728_191_619 135
265 3300046538 Ga0495609_0034840 Ga0495609_0034840_737_1165 135
266 3300046539 Ga0495621_0100819 Ga0495621_0100819_594_1073 135
267 3300046539 Ga0495621_0111077 Ga0495621_0111077_87_515 135
268 3300046557 Ga0495622_0010974 Ga0495622_0010974_381_806 135
269 3300046558 Ga0495633_0125417 Ga0495633_0125417_408_836 135
270 3300046664 Ga0495659_0107867 Ga0495659_0107867_46_474 135
271 3300046683 Ga0495658_0920191 Ga0495658_0920191_66_515 135
272 3300046690 Ga0495624_0105993 Ga0495624_0105993_522_950 135
273 3300046690 Ga0495624_0256141 Ga0495624_0256141_597_1022 135
274 3300046691 Ga0495670_0125293 Ga0495670_0125293_72_500 135
275 3300046691 Ga0495670_0708540 Ga0495670_0708540_101_529 135
276 3300046694 Ga0495649_0104464 Ga0495649_0104464_960_1385 135
277 3300046794 Ga0495589_0084375 Ga0495589_0084375_666_1091 135
278 3300047320 Ga0495672_0029182 Ga0495672_0029182_1186_1611 135
279 3300047321 Ga0495676_0132325 Ga0495676_0132325_488_916 135
280 3300047445 Ga0495677_0021142 Ga0495677_0021142_902_1330 135
281 3300048091 Ga0495626_0114981 Ga0495626_0114981_611_1036 135
282 3300049571 Ga0501034_0595746 Ga0501034_0595746_33_461 135
283 3300049576 Ga0501040_1334136 Ga0501040_1334136_51_479 135
284 3300049581 Ga0501047_0128236 Ga0501047_0128236_837_1268 135
285 3300049779 Ga0501283_081036 Ga0501283_081036_113_541 135
286 3300050507 nmdc:mga05p37_1721450_c1 nmdc:mga05p37_1721450_c1_61_579 135
287 3300050508 nmdc:mga09592_155092_c1 nmdc:mga09592_155092_c1_1054_1533 135
288 3300050508 nmdc:mga09592_251377_c1 nmdc:mga09592_251377_c1_476_904 135
289 3300050510 nmdc:mga06r32_71087_c1 nmdc:mga06r32_71087_c1_2680_3108 135
290 3300050510 nmdc:mga06r32_88897_c1 nmdc:mga06r32_88897_c1_2556_2984 135
291 3300050511 nmdc:mga08y16_138339_c1 nmdc:mga08y16_138339_c1_1777_2208 135
292 3300050511 nmdc:mga08y16_2581_c1 nmdc:mga08y16_2581_c1_2520_2948 135
293 3300050511 nmdc:mga08y16_280677_c1 nmdc:mga08y16_280677_c1_126_554 135
294 3300050511 nmdc:mga08y16_390725_c1 nmdc:mga08y16_390725_c1_493_942 135
295 3300050512 nmdc:mga0n895_136554_c1 nmdc:mga0n895_136554_c1_1932_2360 135
296 3300050512 nmdc:mga0n895_487610_c1 nmdc:mga0n895_487610_c1_692_1135 135
297 3300050512 nmdc:mga0n895_49930_c1 nmdc:mga0n895_49930_c1_478_906 135
298 3300050512 nmdc:mga0n895_56595_c1 nmdc:mga0n895_56595_c1_667_1095 135
299 3300050512 nmdc:mga0n895_675494_c1 nmdc:mga0n895_675494_c1_86_517 135
300 3300050512 nmdc:mga0n895_997938_c1 nmdc:mga0n895_997938_c1_157_585 135
301 3300050513 nmdc:mga0rr50_43004_c1 nmdc:mga0rr50_43004_c1_1047_1475 135
302 3300050513 nmdc:mga0rr50_46189_c1 nmdc:mga0rr50_46189_c1_388_816 135
303 3300050513 nmdc:mga0rr50_72971_c1 nmdc:mga0rr50_72971_c1_2067_2510 135
304 3300050514 nmdc:mga08x19_183293_c1 nmdc:mga08x19_183293_c1_924_1352 135
305 3300050514 nmdc:mga08x19_48_c1 nmdc:mga08x19_48_c1_83254_83739 135
306 3300050514 nmdc:mga08x19_65414_c1 nmdc:mga08x19_65414_c1_1176_1604 135
307 3300050514 nmdc:mga08x19_88852_c1 nmdc:mga08x19_88852_c1_1474_1902 135
308 3300050515 nmdc:mga0a205_26342_c1 nmdc:mga0a205_26342_c1_3425_3853 135
309 3300050515 nmdc:mga0a205_718405_c1 nmdc:mga0a205_718405_c1_11_439 135
310 3300050515 nmdc:mga0a205_75254_c1 nmdc:mga0a205_75254_c1_1613_2056 135
311 3300050515 nmdc:mga0a205_80703_c1 nmdc:mga0a205_80703_c1_367_810 135
312 3300053080 Ga0500635_0045680 Ga0500635_0045680_792_1217 135
313 3300053104 Ga0500556_0029813 Ga0500556_0029813_199_627 135
314 3300053178 Ga0500637_0061091 Ga0500637_0061091_18_443 135
315 3300061734 Ga0530510_0054690 Ga0530510_0054690_1803_2231 135
316 2162886011 MRS1b_contig_2669138 MRS1b_0030.00001180 136
317 3300005289 Ga0065704_10643246 Ga0065704_106432461 136
318 3300005289 Ga0065704_10752521 Ga0065704_107525211 136
319 3300005290 Ga0065712_10000393 Ga0065712_1000039310 136
320 3300005290 Ga0065712_10069663 Ga0065712_100696635 136
321 3300005290 Ga0065712_10350542 Ga0065712_103505421 136
322 3300005293 Ga0065715_10131732 Ga0065715_101317321 136
323 3300005295 Ga0065707_10091743 Ga0065707_100917435 136
324 3300005295 Ga0065707_10227114 Ga0065707_102271142 136
325 3300005328 Ga0070676_10185212 Ga0070676_101852122 136
326 3300005331 Ga0070670_100011332 Ga0070670_1000113325 136
327 3300005331 Ga0070670_100015247 Ga0070670_1000152476 136
328 3300005331 Ga0070670_100353777 Ga0070670_1003537771 136
329 3300005334 Ga0068869_100018070 Ga0068869_1000180707 136
330 3300005334 Ga0068869_100041017 Ga0068869_1000410172 136
331 3300005338 Ga0068868_100191305 Ga0068868_1001913052 136
332 3300005340 Ga0070689_100013704 Ga0070689_1000137042 136
333 3300005340 Ga0070689_100103172 Ga0070689_1001031722 136
334 3300005343 Ga0070687_100096694 Ga0070687_1000966942 136
335 3300005343 Ga0070687_100553224 Ga0070687_1005532242 136
336 3300005345 Ga0070692_10289215 Ga0070692_102892151 136
337 3300005347 Ga0070668_100067980 Ga0070668_1000679801 136
338 3300005353 Ga0070669_100002549 Ga0070669_1000025496 136
339 3300005353 Ga0070669_100734582 Ga0070669_1007345821 136
340 3300005354 Ga0070675_100004810 Ga0070675_1000048105 136
341 3300005354 Ga0070675_100027677 Ga0070675_1000276775 136
342 3300005355 Ga0070671_100488345 Ga0070671_1004883451 136
343 3300005356 Ga0070674_100086087 Ga0070674_1000860871 136
344 3300005364 Ga0070673_100003572 Ga0070673_1000035725 136
345 3300005364 Ga0070673_100029120 Ga0070673_1000291203 136
346 3300005364 Ga0070673_100051833 Ga0070673_1000518332 136
347 3300005365 Ga0070688_100007036 Ga0070688_1000070363 136
348 3300005365 Ga0070688_100016843 Ga0070688_1000168433 136
349 3300005365 Ga0070688_100027353 Ga0070688_1000273532 136
350 3300005365 Ga0070688_100881809 Ga0070688_1008818092 136
351 3300005438 Ga0070701_10339171 Ga0070701_103391712 136
352 3300005438 Ga0070701_10511211 Ga0070701_105112111 136
353 3300005441 Ga0070700_100037548 Ga0070700_1000375482 136
354 3300005441 Ga0070700_100394143 Ga0070700_1003941432 136
355 3300005445 Ga0070708_101095099 Ga0070708_1010950992 136
356 3300005456 Ga0070678_100465307 Ga0070678_1004653071 136
357 3300005457 Ga0070662_100146896 Ga0070662_1001468962 136
358 3300005459 Ga0068867_100020227 Ga0068867_1000202275 136
359 3300005459 Ga0068867_100362164 Ga0068867_1003621642 136
360 3300005459 Ga0068867_100650848 Ga0068867_1006508482 136
361 3300005466 Ga0070685_10003193 Ga0070685_100031933 136
362 3300005466 Ga0070685_10082608 Ga0070685_100826082 136
363 3300005471 Ga0070698_100001684 Ga0070698_1000016849 136
364 3300005471 Ga0070698_100084673 Ga0070698_1000846734 136
365 3300005543 Ga0070672_100066056 Ga0070672_1000660565 136
366 3300005544 Ga0070686_100265254 Ga0070686_1002652542 136
367 3300005549 Ga0070704_101534686 Ga0070704_1015346861 136
368 3300005564 Ga0070664_100169021 Ga0070664_1001690212 136
369 3300005577 Ga0068857_100007129 Ga0068857_1000071295 136
370 3300005578 Ga0068854_100013145 Ga0068854_1000131455 136
371 3300005615 Ga0070702_100341139 Ga0070702_1003411391 136
372 3300005615 Ga0070702_101118922 Ga0070702_1011189221 136
373 3300005616 Ga0068852_101483910 Ga0068852_1014839102 136
374 3300005617 Ga0068859_100028460 Ga0068859_1000284605 136
375 3300005617 Ga0068859_100090425 Ga0068859_1000904252 136
376 3300005617 Ga0068859_100704260 Ga0068859_1007042601 136
377 3300005618 Ga0068864_100082789 Ga0068864_1000827891 136
378 3300005618 Ga0068864_100798058 Ga0068864_1007980581 136
379 3300005841 Ga0068863_100006326 Ga0068863_1000063268 136
380 3300005841 Ga0068863_100098238 Ga0068863_1000982382 136
381 3300005841 Ga0068863_100507834 Ga0068863_1005078341 136
382 3300005843 Ga0068860_100927276 Ga0068860_1009272762 136
383 3300005844 Ga0068862_100001278 Ga0068862_10000127812 136
384 3300005844 Ga0068862_100336309 Ga0068862_1003363091 136
385 3300005844 Ga0068862_100817665 Ga0068862_1008176652 136
386 3300006058 Ga0075432_10113442 Ga0075432_101134422 136
387 3300006237 Ga0097621_100011962 Ga0097621_1000119626 136
388 3300006358 Ga0068871_100089073 Ga0068871_1000890732 136
389 3300006844 Ga0075428_100027284 Ga0075428_1000272849 136
390 3300006844 Ga0075428_100064508 Ga0075428_1000645081 136
391 3300006844 Ga0075428_100790913 Ga0075428_1007909132 136
392 3300006880 Ga0075429_100051926 Ga0075429_1000519264 136
393 3300006880 Ga0075429_100326913 Ga0075429_1003269132 136
394 3300006880 Ga0075429_100396673 Ga0075429_1003966732 136
395 3300006881 Ga0068865_100079019 Ga0068865_1000790192 136
396 3300006931 Ga0097620_100028459 Ga0097620_1000284592 136
397 3300006931 Ga0097620_100090425 Ga0097620_1000904252 136
398 3300006931 Ga0097620_100704253 Ga0097620_1007042531 136
399 3300009094 Ga0111539_10004662 Ga0111539_100046629 136
400 3300009094 Ga0111539_10244532 Ga0111539_102445322 136
401 3300009147 Ga0114129_10074459 Ga0114129_100744596 136
402 3300009147 Ga0114129_10079705 Ga0114129_100797052 136
403 3300009174 Ga0105241_11526261 Ga0105241_115262611 136
404 3300009176 Ga0105242_10001165 Ga0105242_1000116515 136
405 3300009176 Ga0105242_10177865 Ga0105242_101778653 136
406 3300009176 Ga0105242_10227866 Ga0105242_102278662 136
407 3300009177 Ga0105248_10343478 Ga0105248_103434783 136
408 3300009553 Ga0105249_10002749 Ga0105249_1000274912 136
409 3300009553 Ga0105249_10020855 Ga0105249_100208556 136
410 3300009553 Ga0105249_10085379 Ga0105249_100853793 136
411 3300009553 Ga0105249_10467527 Ga0105249_104675272 136
412 3300009553 Ga0105249_11710068 Ga0105249_117100681 136
413 3300009553 Ga0105249_12615776 Ga0105249_126157762 136
414 3300011119 Ga0105246_10222218 Ga0105246_102222182 136
415 3300013296 Ga0157374_10610979 Ga0157374_106109791 136
416 3300013306 Ga0163162_10043360 Ga0163162_100433606 136
417 3300013306 Ga0163162_10052834 Ga0163162_100528342 136
418 3300013306 Ga0163162_10164252 Ga0163162_101642523 136
419 3300013308 Ga0157375_10020946 Ga0157375_100209466 136
420 3300013308 Ga0157375_10135361 Ga0157375_101353614 136
421 3300013308 Ga0157375_10234186 Ga0157375_102341861 136
422 3300014325 Ga0163163_10226857 Ga0163163_102268573 136
423 3300014325 Ga0163163_10840723 Ga0163163_108407231 136
424 3300014326 Ga0157380_10005493 Ga0157380_100054935 136
425 3300014326 Ga0157380_10017785 Ga0157380_100177853 136
426 3300014326 Ga0157380_10776908 Ga0157380_107769082 136
427 3300014745 Ga0157377_10000659 Ga0157377_100006597 136
428 3300014745 Ga0157377_10145595 Ga0157377_101455952 136
429 3300014745 Ga0157377_10492566 Ga0157377_104925662 136
430 3300014968 Ga0157379_10185046 Ga0157379_101850463 136
431 3300014969 Ga0157376_10131389 Ga0157376_101313892 136
432 3300014969 Ga0157376_12258342 Ga0157376_122583421 136
433 3300017792 Ga0163161_10015165 Ga0163161_100151652 136
434 3300017792 Ga0163161_10743936 Ga0163161_107439361 136
435 3300025271 Ga0207666_1041706 Ga0207666_10417061 136
436 3300025315 Ga0207697_10065061 Ga0207697_100650612 136
437 3300025893 Ga0207682_10009872 Ga0207682_100098722 136
438 3300025899 Ga0207642_10526589 Ga0207642_105265891 136
439 3300025908 Ga0207643_10004365 Ga0207643_100043659 136
440 3300025908 Ga0207643_10266344 Ga0207643_102663442 136
441 3300025910 Ga0207684_10301350 Ga0207684_103013502 136
442 3300025918 Ga0207662_10119839 Ga0207662_101198392 136
443 3300025918 Ga0207662_10815578 Ga0207662_108155782 136
444 3300025923 Ga0207681_10028135 Ga0207681_100281352 136
445 3300025923 Ga0207681_10075399 Ga0207681_100753992 136
446 3300025925 Ga0207650_10192205 Ga0207650_101922052 136
447 3300025925 Ga0207650_10391284 Ga0207650_103912842 136
448 3300025925 Ga0207650_11221329 Ga0207650_112213291 136
449 3300025926 Ga0207659_10030626 Ga0207659_100306266 136
450 3300025926 Ga0207659_10221620 Ga0207659_102216202 136
451 3300025933 Ga0207706_10036362 Ga0207706_100363622 136
452 3300025934 Ga0207686_10000498 Ga0207686_100004989 136
453 3300025934 Ga0207686_10032968 Ga0207686_100329683 136
454 3300025936 Ga0207670_10042309 Ga0207670_100423093 136
455 3300025938 Ga0207704_10225253 Ga0207704_102252531 136
456 3300025938 Ga0207704_11848203 Ga0207704_118482031 136
457 3300025940 Ga0207691_10014404 Ga0207691_100144045 136
458 3300025940 Ga0207691_10183619 Ga0207691_101836191 136
459 3300025941 Ga0207711_10412216 Ga0207711_104122162 136
460 3300025942 Ga0207689_10045161 Ga0207689_100451612 136
461 3300025942 Ga0207689_10053634 Ga0207689_100536343 136
462 3300025960 Ga0207651_10006411 Ga0207651_100064111 136
463 3300025960 Ga0207651_10020926 Ga0207651_100209261 136
464 3300025960 Ga0207651_10051114 Ga0207651_100511144 136
465 3300025960 Ga0207651_10058501 Ga0207651_100585012 136
466 3300025961 Ga0207712_10001312 Ga0207712_100013127 136
467 3300025961 Ga0207712_10001935 Ga0207712_1000193511 136
468 3300025961 Ga0207712_10513107 Ga0207712_105131072 136
469 3300025972 Ga0207668_10028706 Ga0207668_100287065 136
470 3300025981 Ga0207640_10024352 Ga0207640_100243524 136
471 3300025981 Ga0207640_10177516 Ga0207640_101775163 136
472 3300025986 Ga0207658_10554696 Ga0207658_105546961 136
473 3300026035 Ga0207703_10461384 Ga0207703_104613842 136
474 3300026075 Ga0207708_10304159 Ga0207708_103041592 136
475 3300026075 Ga0207708_10408855 Ga0207708_104088552 136
476 3300026088 Ga0207641_10000467 Ga0207641_1000046712 136
477 3300026088 Ga0207641_10086236 Ga0207641_100862363 136
478 3300026089 Ga0207648_10031304 Ga0207648_100313042 136
479 3300026089 Ga0207648_10407968 Ga0207648_104079682 136
480 3300026095 Ga0207676_10176165 Ga0207676_101761652 136
481 3300026095 Ga0207676_10524107 Ga0207676_105241071 136
482 3300026116 Ga0207674_10003180 Ga0207674_1000318018 136
483 3300026118 Ga0207675_100000299 Ga0207675_10000029911 136
484 3300026118 Ga0207675_101028266 Ga0207675_1010282662 136
485 3300026121 Ga0207683_10155017 Ga0207683_101550173 136
486 3300027907 Ga0207428_10135883 Ga0207428_101358832 136
487 3300028380 Ga0268265_10028813 Ga0268265_100288132 136
488 3300028380 Ga0268265_10228365 Ga0268265_102283652 136
489 3300028380 Ga0268265_11278350 Ga0268265_112783502 136
490 3300028380 Ga0268265_11409966 Ga0268265_114099662 136
491 3300028381 Ga0268264_10282397 Ga0268264_102823973 136
492 3300032004 Ga0307414_10052480 Ga0307414_100524802 136
493 3300035119 Ga0373956_0251129 Ga0373956_0251129_265_714 136
494 3300036401 Ga0373937_0097898 Ga0373937_0097898_30_479 136
495 3300041459 Ga0451800_0818037 Ga0451800_0818037_139_549 136
496 3300041509 Ga0451843_0781955 Ga0451843_0781955_1625_2035 136
497 3300042004 Ga0439445_0016842 Ga0439445_0016842_292_702 136
498 3300042004 Ga0439445_0082450 Ga0439445_0082450_350_760 136
499 3300044673 Ga0453683_1169307 Ga0453683_1169307_33_482 136
500 3300044712 Ga0453684_0825487 Ga0453684_0825487_185_661 136
501 3300046453 Ga0495627_001593 Ga0495627_001593_7579_7989 136
502 3300046499 Ga0495594_0520702 Ga0495594_0520702_43_495 136
503 3300046528 Ga0495642_0338774 Ga0495642_0338774_117_566 136
504 3300046537 Ga0495598_0069337 Ga0495598_0069337_348_800 136
505 3300046539 Ga0495621_0004188 Ga0495621_0004188_429_881 136
506 3300046539 Ga0495621_0065617 Ga0495621_0065617_864_1313 136
507 3300046558 Ga0495633_0000036 Ga0495633_0000036_2044_2454 136
508 3300047320 Ga0495672_0035861 Ga0495672_0035861_1242_1652 136
509 3300049568 Ga0501031_0600678 Ga0501031_0600678_204_614 136
510 3300049569 Ga0501032_0004687 Ga0501032_0004687_628_1038 136
511 3300049569 Ga0501032_0027679 Ga0501032_0027679_2882_3340 136
512 3300049571 Ga0501034_0029202 Ga0501034_0029202_2162_2572 136
513 3300049571 Ga0501034_0094207 Ga0501034_0094207_1206_1616 136
514 3300049571 Ga0501034_1039295 Ga0501034_1039295_237_674 136
515 3300049572 Ga0501036_0003416 Ga0501036_0003416_3267_3677 136
516 3300049572 Ga0501036_0014802 Ga0501036_0014802_5361_5771 136
517 3300049573 Ga0501037_0017762 Ga0501037_0017762_4335_4745 136
518 3300049573 Ga0501037_0148621 Ga0501037_0148621_42_500 136
519 3300049574 Ga0501038_0010673 Ga0501038_0010673_2446_2904 136
520 3300049574 Ga0501038_0035197 Ga0501038_0035197_2271_2681 136
521 3300049575 Ga0501039_0016906 Ga0501039_0016906_4971_5381 136
522 3300049575 Ga0501039_0183254 Ga0501039_0183254_1030_1440 136
523 3300049579 Ga0501043_0020417 Ga0501043_0020417_4009_4419 136
524 3300049579 Ga0501043_0130860 Ga0501043_0130860_614_1024 136
525 3300049580 Ga0501046_0003510 Ga0501046_0003510_6368_6778 136
526 3300049580 Ga0501046_0036206 Ga0501046_0036206_2576_3034 136
527 3300049581 Ga0501047_0055611 Ga0501047_0055611_2749_3159 136
528 3300049581 Ga0501047_0875236 Ga0501047_0875236_25_435 136
529 3300049582 Ga0501048_0035118 Ga0501048_0035118_627_1037 136
530 3300049583 Ga0501067_0191508 Ga0501067_0191508_568_978 136
531 3300049584 Ga0501068_0035423 Ga0501068_0035423_2541_2951 136
532 3300049586 Ga0501070_0012717 Ga0501070_0012717_1376_1786 136
533 3300049589 Ga0501073_0329772 Ga0501073_0329772_601_1011 136
534 3300049590 Ga0501074_0003003 Ga0501074_0003003_9508_9918 136
535 3300049741 Ga0501079_0133957 Ga0501079_0133957_1386_1796 136
536 3300049744 Ga0501083_0001228 Ga0501083_0001228_10304_10714 136
537 3300049822 Ga0501035_0009147 Ga0501035_0009147_8503_8913 136
538 3300049822 Ga0501035_0117132 Ga0501035_0117132_108_566 136
539 3300049823 Ga0501044_0008422 Ga0501044_0008422_1845_2255 136
540 3300049823 Ga0501044_0200688 Ga0501044_0200688_299_736 136
541 3300049823 Ga0501044_0232454 Ga0501044_0232454_998_1408 136
542 3300050507 nmdc:mga05p37_1010560_c1 nmdc:mga05p37_1010560_c1_220_714 136
543 3300050507 nmdc:mga05p37_214160_c1 nmdc:mga05p37_214160_c1_707_1243 136
544 3300050508 nmdc:mga09592_50342_c1 nmdc:mga09592_50342_c1_1362_1898 136
545 3300050508 nmdc:mga09592_594457_c1 nmdc:mga09592_594457_c1_505_915 136
546 3300050508 nmdc:mga09592_856821_c1 nmdc:mga09592_856821_c1_205_651 136
547 3300050508 nmdc:mga09592_88102_c1 nmdc:mga09592_88102_c1_2010_2456 136
548 3300050509 nmdc:mga0qj67_21761_c1 nmdc:mga0qj67_21761_c1_1694_2230 136
549 3300050510 nmdc:mga06r32_44707_c1 nmdc:mga06r32_44707_c1_3546_4082 136
550 3300050511 nmdc:mga08y16_31684_c1 nmdc:mga08y16_31684_c1_3514_3924 136
551 3300053093 Ga0500651_0025852 Ga0500651_0025852_155_565 136
552 3300053096 Ga0500641_0142595 Ga0500641_0142595_432_842 136
553 3300053139 Ga0500568_0004673 Ga0500568_0004673_507_917 136
554 3300053153 Ga0500616_0406727 Ga0500616_0406727_97_507 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

55

154

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9802 1 136
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9736 1 135
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9732 1 136
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9663 1 135
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9656 1 136
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.958 1 135 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9445 1 135 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9254 6 136 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9173 4 136 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9064 45 136 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A258Y8I4-F1-model_v4 OsmC family peroxiredoxin 1.003 51 136 GO:0004601
GO:0006979
AF-A0A2W5FXT9-F1-model_v4 OsmC family peroxiredoxin 1.001 44 136 GO:0004601
GO:0006979
AF-A0A257KYW8-F1-model_v4 OsmC family peroxiredoxin 0.9994 42 136 GO:0004601
GO:0006979
AF-A0A522GH03-F1-model_v4 OsmC family peroxiredoxin 0.9969 41 136 GO:0004601
GO:0006979
AF-A0A4P5TX77-F1-model_v4 Peroxiredoxin 0.9967 1 136 GO:0004601
GO:0006979

Feature Viewer

pLDDT pTM Quality
96.3 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map