F463048
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 554 | 251 | 554 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300050514|nmdc:mga08x19_82200_c1|nmdc:mga08x19_82200_c1_997_1491 |
| Length | 158 |
| Sequence | MIAEHRLEPVETKNSANRRSLIMPTSNAVATWEGKLREGKGNFKGQSGAFGTRFEGKKGSNPEELIAAAHAGCFSMALSSALEKAGHPATRIETRAAVTLEMVDGSPKITKSVLDVRGKVDGIDQAAFQQAAEGAKKNCPVSKALQGNVDVTLDAKLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 150 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 164 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 178 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 179 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 180 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 183 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 186 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 245 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 246 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 247 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 248 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 249 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 250 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 251 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.26 |
| Nodule | 0 |
| Rhizoplane | 0.18 |
| Rhizosphere | 98.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_2669138 | 2162886011 | Bacteria | 2215 |
| 2 | JGI24751J29686_10001433 | 3300002459 | Bacteria | 4992 |
| 3 | Ga0065714_10074150 | 3300005288 | Bacteria | 3077 |
| 4 | Ga0065704_10643246 | 3300005289 | Bacteria | 586 |
| 5 | Ga0065704_10752521 | 3300005289 | Bacteria | 541 |
| 6 | Ga0065712_10000393 | 3300005290 | Bacteria | 14469 |
| 7 | Ga0065712_10069663 | 3300005290 | Bacteria | 6918 |
| 8 | Ga0065712_10350542 | 3300005290 | Bacteria | 788 |
| 9 | Ga0065715_10131732 | 3300005293 | Bacteria | 2003 |
| 10 | Ga0065707_10091743 | 3300005295 | Bacteria | 3886 |
| 11 | Ga0065707_10227114 | 3300005295 | Unclassified | 1200 |
| 12 | Ga0070658_10184936 | 3300005327 | Bacteria | 1754 |
| 13 | Ga0070676_10185212 | 3300005328 | Unclassified | 1356 |
| 14 | Ga0070676_10191605 | 3300005328 | Bacteria | 1335 |
| 15 | Ga0070690_100002003 | 3300005330 | Bacteria | 10847 |
| 16 | Ga0070690_100095727 | 3300005330 | Bacteria | 1961 |
| 17 | Ga0070670_100004466 | 3300005331 | Bacteria | 11714 |
| 18 | Ga0070670_100011332 | 3300005331 | Bacteria | 7619 |
| 19 | Ga0070670_100015247 | 3300005331 | Bacteria | 6596 |
| 20 | Ga0070670_100043064 | 3300005331 | Unclassified | 3881 |
| 21 | Ga0070670_100353777 | 3300005331 | Bacteria | 1291 |
| 22 | Ga0070670_100571015 | 3300005331 | Unclassified | 1010 |
| 23 | Ga0068869_100018070 | 3300005334 | Unclassified | 4793 |
| 24 | Ga0068869_100041017 | 3300005334 | Bacteria | 3313 |
| 25 | Ga0068869_100623128 | 3300005334 | Bacteria | 913 |
| 26 | Ga0070666_10167995 | 3300005335 | Bacteria | 1535 |
| 27 | Ga0070680_100021318 | 3300005336 | Bacteria | 5148 |
| 28 | Ga0070680_100054899 | 3300005336 | Unclassified | 3254 |
| 29 | Ga0070680_100306724 | 3300005336 | Bacteria | 1346 |
| 30 | Ga0068868_100191305 | 3300005338 | Bacteria | 1702 |
| 31 | Ga0070689_100013704 | 3300005340 | Bacteria | 5873 |
| 32 | Ga0070689_100103172 | 3300005340 | Unclassified | 2260 |
| 33 | Ga0070689_100142065 | 3300005340 | Bacteria | 1931 |
| 34 | Ga0070689_101174762 | 3300005340 | Unclassified | 688 |
| 35 | Ga0070689_101228953 | 3300005340 | Bacteria | 673 |
| 36 | Ga0070687_100021291 | 3300005343 | Bacteria | 3045 |
| 37 | Ga0070687_100096694 | 3300005343 | Bacteria | 1645 |
| 38 | Ga0070687_100250323 | 3300005343 | Bacteria | 1100 |
| 39 | Ga0070687_100553224 | 3300005343 | Bacteria | 783 |
| 40 | Ga0070692_10262707 | 3300005345 | Bacteria | 1038 |
| 41 | Ga0070692_10289215 | 3300005345 | Unclassified | 996 |
| 42 | Ga0070692_10308393 | 3300005345 | Bacteria | 969 |
| 43 | Ga0070668_100067980 | 3300005347 | Unclassified | 2769 |
| 44 | Ga0070668_100630313 | 3300005347 | Bacteria | 940 |
| 45 | Ga0070669_100002549 | 3300005353 | Bacteria | 13166 |
| 46 | Ga0070669_100734582 | 3300005353 | Unclassified | 835 |
| 47 | Ga0070675_100004810 | 3300005354 | Bacteria | 10303 |
| 48 | Ga0070675_100022563 | 3300005354 | Bacteria | 5031 |
| 49 | Ga0070675_100027677 | 3300005354 | Bacteria | 4557 |
| 50 | Ga0070671_100488345 | 3300005355 | Bacteria | 1059 |
| 51 | Ga0070674_100086087 | 3300005356 | Bacteria | 2256 |
| 52 | Ga0070674_101041095 | 3300005356 | Bacteria | 720 |
| 53 | Ga0070674_101075555 | 3300005356 | Bacteria | 709 |
| 54 | Ga0070673_100003572 | 3300005364 | Bacteria | 9712 |
| 55 | Ga0070673_100011926 | 3300005364 | Bacteria | 5951 |
| 56 | Ga0070673_100029120 | 3300005364 | Bacteria | 4115 |
| 57 | Ga0070673_100051833 | 3300005364 | Bacteria | 3216 |
| 58 | Ga0070688_100007036 | 3300005365 | Bacteria | 6050 |
| 59 | Ga0070688_100016843 | 3300005365 | Bacteria | 4185 |
| 60 | Ga0070688_100022092 | 3300005365 | Bacteria | 3723 |
| 61 | Ga0070688_100027353 | 3300005365 | Bacteria | 3397 |
| 62 | Ga0070688_100881809 | 3300005365 | Bacteria | 704 |
| 63 | Ga0070703_10000245 | 3300005406 | Bacteria | 26412 |
| 64 | Ga0070714_100001866 | 3300005435 | Bacteria | 15357 |
| 65 | Ga0070714_100813718 | 3300005435 | Bacteria | 905 |
| 66 | Ga0070710_10158977 | 3300005437 | Bacteria | 1400 |
| 67 | Ga0070701_10015250 | 3300005438 | Bacteria | 3544 |
| 68 | Ga0070701_10067889 | 3300005438 | Bacteria | 1898 |
| 69 | Ga0070701_10339171 | 3300005438 | Bacteria | 935 |
| 70 | Ga0070701_10511211 | 3300005438 | Bacteria | 782 |
| 71 | Ga0070701_11219568 | 3300005438 | Bacteria | 534 |
| 72 | Ga0070705_100002366 | 3300005440 | Bacteria | 9513 |
| 73 | Ga0070705_100011027 | 3300005440 | Bacteria | 4546 |
| 74 | Ga0070705_100012344 | 3300005440 | Unclassified | 4341 |
| 75 | Ga0070700_100037548 | 3300005441 | Bacteria | 2947 |
| 76 | Ga0070700_100394143 | 3300005441 | Bacteria | 1039 |
| 77 | Ga0070700_101508128 | 3300005441 | Bacteria | 572 |
| 78 | Ga0070694_100000872 | 3300005444 | Bacteria | 16983 |
| 79 | Ga0070694_100003743 | 3300005444 | Bacteria | 9069 |
| 80 | Ga0070694_100007039 | 3300005444 | Bacteria | 6842 |
| 81 | Ga0070694_100031886 | 3300005444 | Bacteria | 3457 |
| 82 | Ga0070694_100037712 | 3300005444 | Bacteria | 3207 |
| 83 | Ga0070708_100043528 | 3300005445 | Bacteria | 3945 |
| 84 | Ga0070708_100230000 | 3300005445 | Bacteria | 1740 |
| 85 | Ga0070708_101095099 | 3300005445 | Bacteria | 746 |
| 86 | Ga0070678_100465307 | 3300005456 | Bacteria | 1110 |
| 87 | Ga0070662_100080981 | 3300005457 | Bacteria | 2418 |
| 88 | Ga0070662_100146896 | 3300005457 | Unclassified | 1832 |
| 89 | Ga0068867_100020227 | 3300005459 | Unclassified | 4743 |
| 90 | Ga0068867_100362164 | 3300005459 | Bacteria | 1213 |
| 91 | Ga0068867_100650848 | 3300005459 | Bacteria | 925 |
| 92 | Ga0068867_101107870 | 3300005459 | Bacteria | 723 |
| 93 | Ga0070685_10003193 | 3300005466 | Bacteria | 8344 |
| 94 | Ga0070685_10071027 | 3300005466 | Bacteria | 2063 |
| 95 | Ga0070685_10082608 | 3300005466 | Bacteria | 1928 |
| 96 | Ga0070706_100070138 | 3300005467 | Bacteria | 3241 |
| 97 | Ga0070706_100112000 | 3300005467 | Bacteria | 2540 |
| 98 | Ga0070706_100138025 | 3300005467 | Bacteria | 2275 |
| 99 | Ga0070706_100659111 | 3300005467 | Bacteria | 971 |
| 100 | Ga0070707_100000077 | 3300005468 | Bacteria | 86719 |
| 101 | Ga0070707_100009322 | 3300005468 | Bacteria | 9111 |
| 102 | Ga0070707_100475139 | 3300005468 | Bacteria | 1211 |
| 103 | Ga0070707_101523336 | 3300005468 | Bacteria | 635 |
| 104 | Ga0070698_100001684 | 3300005471 | Bacteria | 24662 |
| 105 | Ga0070698_100031715 | 3300005471 | Bacteria | 5478 |
| 106 | Ga0070698_100084673 | 3300005471 | Bacteria | 3158 |
| 107 | Ga0070698_100534261 | 3300005471 | Bacteria | 1111 |
| 108 | Ga0070698_101262447 | 3300005471 | Bacteria | 688 |
| 109 | Ga0070699_100087007 | 3300005518 | Bacteria | 2728 |
| 110 | Ga0070699_100093976 | 3300005518 | Bacteria | 2624 |
| 111 | Ga0070699_100240011 | 3300005518 | Bacteria | 1617 |
| 112 | Ga0070699_100826566 | 3300005518 | Bacteria | 848 |
| 113 | Ga0070697_100009133 | 3300005536 | Bacteria | 7745 |
| 114 | Ga0070697_100013996 | 3300005536 | Bacteria | 6298 |
| 115 | Ga0070697_100156401 | 3300005536 | Bacteria | 1924 |
| 116 | Ga0070697_100180502 | 3300005536 | Bacteria | 1789 |
| 117 | Ga0070672_100066056 | 3300005543 | Unclassified | 2863 |
| 118 | Ga0070672_100084227 | 3300005543 | Bacteria | 2553 |
| 119 | Ga0070672_101041989 | 3300005543 | Bacteria | 726 |
| 120 | Ga0070686_100016350 | 3300005544 | Bacteria | 4315 |
| 121 | Ga0070686_100038440 | 3300005544 | Bacteria | 2975 |
| 122 | Ga0070686_100265254 | 3300005544 | Bacteria | 1260 |
| 123 | Ga0070695_100004373 | 3300005545 | Bacteria | 8286 |
| 124 | Ga0070695_100012926 | 3300005545 | Bacteria | 5011 |
| 125 | Ga0070695_100060158 | 3300005545 | Bacteria | 2461 |
| 126 | Ga0070695_100129984 | 3300005545 | Unclassified | 1735 |
| 127 | Ga0070695_100327449 | 3300005545 | Bacteria | 1141 |
| 128 | Ga0070696_100005529 | 3300005546 | Bacteria | 8436 |
| 129 | Ga0070696_100014148 | 3300005546 | Bacteria | 5355 |
| 130 | Ga0070696_101033178 | 3300005546 | Archaea | 688 |
| 131 | Ga0070704_100001416 | 3300005549 | Bacteria | 12795 |
| 132 | Ga0070704_100007963 | 3300005549 | Bacteria | 6327 |
| 133 | Ga0070704_100051875 | 3300005549 | Unclassified | 2891 |
| 134 | Ga0070704_100073517 | 3300005549 | Bacteria | 2490 |
| 135 | Ga0070704_101534686 | 3300005549 | Bacteria | 613 |
| 136 | Ga0070664_100147240 | 3300005564 | Bacteria | 2077 |
| 137 | Ga0070664_100169021 | 3300005564 | Unclassified | 1939 |
| 138 | Ga0068857_100007129 | 3300005577 | Bacteria | 9627 |
| 139 | Ga0068854_100013145 | 3300005578 | Bacteria | 5426 |
| 140 | Ga0068854_100898909 | 3300005578 | Bacteria | 778 |
| 141 | Ga0070702_100341139 | 3300005615 | Bacteria | 1052 |
| 142 | Ga0070702_100377759 | 3300005615 | Unclassified | 1006 |
| 143 | Ga0070702_101118922 | 3300005615 | Bacteria | 630 |
| 144 | Ga0068852_101483910 | 3300005616 | Bacteria | 700 |
| 145 | Ga0068859_100025026 | 3300005617 | Bacteria | 5992 |
| 146 | Ga0068859_100028460 | 3300005617 | Bacteria | 5602 |
| 147 | Ga0068859_100090425 | 3300005617 | Bacteria | 3112 |
| 148 | Ga0068859_100511419 | 3300005617 | Bacteria | 1296 |
| 149 | Ga0068859_100704260 | 3300005617 | Bacteria | 1100 |
| 150 | Ga0068864_100010393 | 3300005618 | Bacteria | 7687 |
| 151 | Ga0068864_100029845 | 3300005618 | Bacteria | 4621 |
| 152 | Ga0068864_100082789 | 3300005618 | Bacteria | 2816 |
| 153 | Ga0068864_100798058 | 3300005618 | Bacteria | 928 |
| 154 | Ga0068866_10304594 | 3300005718 | Bacteria | 996 |
| 155 | Ga0068861_100056066 | 3300005719 | Bacteria | 3007 |
| 156 | Ga0068861_100103697 | 3300005719 | Bacteria | 2267 |
| 157 | Ga0068861_101224172 | 3300005719 | Bacteria | 727 |
| 158 | Ga0068870_10102118 | 3300005840 | Bacteria | 1622 |
| 159 | Ga0068863_100006326 | 3300005841 | Bacteria | 11612 |
| 160 | Ga0068863_100098238 | 3300005841 | Bacteria | 2780 |
| 161 | Ga0068863_100190122 | 3300005841 | Bacteria | 1973 |
| 162 | Ga0068863_100507834 | 3300005841 | Bacteria | 1187 |
| 163 | Ga0068858_100164222 | 3300005842 | Bacteria | 2092 |
| 164 | Ga0068860_100273586 | 3300005843 | Bacteria | 1649 |
| 165 | Ga0068860_100836376 | 3300005843 | Bacteria | 935 |
| 166 | Ga0068860_100927276 | 3300005843 | Unclassified | 887 |
| 167 | Ga0068862_100001278 | 3300005844 | Bacteria | 23579 |
| 168 | Ga0068862_100336309 | 3300005844 | Bacteria | 1397 |
| 169 | Ga0068862_100817665 | 3300005844 | Bacteria | 911 |
| 170 | Ga0070717_10155868 | 3300006028 | Bacteria | 1979 |
| 171 | Ga0075432_10113442 | 3300006058 | Bacteria | 1012 |
| 172 | Ga0070715_10039729 | 3300006163 | Bacteria | 1962 |
| 173 | Ga0070712_100512023 | 3300006175 | Bacteria | 1007 |
| 174 | Ga0097621_100011962 | 3300006237 | Bacteria | 6419 |
| 175 | Ga0097621_100514175 | 3300006237 | Bacteria | 1086 |
| 176 | Ga0097621_100551037 | 3300006237 | Bacteria | 1049 |
| 177 | Ga0068871_100089073 | 3300006358 | Bacteria | 2568 |
| 178 | Ga0075428_100012694 | 3300006844 | Bacteria | 9369 |
| 179 | Ga0075428_100027284 | 3300006844 | Bacteria | 6321 |
| 180 | Ga0075428_100064508 | 3300006844 | Bacteria | 4011 |
| 181 | Ga0075428_100132510 | 3300006844 | Bacteria | 2710 |
| 182 | Ga0075428_100335232 | 3300006844 | Bacteria | 1625 |
| 183 | Ga0075428_100702067 | 3300006844 | Bacteria | 1078 |
| 184 | Ga0075428_100790913 | 3300006844 | Bacteria | 1008 |
| 185 | Ga0075430_100203948 | 3300006846 | Bacteria | 1641 |
| 186 | Ga0075431_100015629 | 3300006847 | Bacteria | 7694 |
| 187 | Ga0075431_100402196 | 3300006847 | Bacteria | 1370 |
| 188 | Ga0075433_10034149 | 3300006852 | Bacteria | 4366 |
| 189 | Ga0075433_10053283 | 3300006852 | Bacteria | 3526 |
| 190 | Ga0075433_10056824 | 3300006852 | Bacteria | 3420 |
| 191 | Ga0075433_10177928 | 3300006852 | Bacteria | 1893 |
| 192 | Ga0075433_10224975 | 3300006852 | Bacteria | 1666 |
| 193 | Ga0075434_100007170 | 3300006871 | Bacteria | 10303 |
| 194 | Ga0075434_100007922 | 3300006871 | Bacteria | 9846 |
| 195 | Ga0075434_100036460 | 3300006871 | Bacteria | 4865 |
| 196 | Ga0075434_100112314 | 3300006871 | Bacteria | 2736 |
| 197 | Ga0075434_100163948 | 3300006871 | Bacteria | 2243 |
| 198 | Ga0075434_100235379 | 3300006871 | Bacteria | 1851 |
| 199 | Ga0075434_100489519 | 3300006871 | Bacteria | 1251 |
| 200 | Ga0075429_100051926 | 3300006880 | Bacteria | 3566 |
| 201 | Ga0075429_100112039 | 3300006880 | Bacteria | 2384 |
| 202 | Ga0075429_100315389 | 3300006880 | Bacteria | 1368 |
| 203 | Ga0075429_100326913 | 3300006880 | Unclassified | 1342 |
| 204 | Ga0075429_100396673 | 3300006880 | Bacteria | 1208 |
| 205 | Ga0068865_100079019 | 3300006881 | Unclassified | 2355 |
| 206 | Ga0075436_100137655 | 3300006914 | Bacteria | 1715 |
| 207 | Ga0075436_100142146 | 3300006914 | Bacteria | 1687 |
| 208 | Ga0075436_100165819 | 3300006914 | Bacteria | 1559 |
| 209 | Ga0075436_100188960 | 3300006914 | Bacteria | 1457 |
| 210 | Ga0097620_100025023 | 3300006931 | Bacteria | 5992 |
| 211 | Ga0097620_100028459 | 3300006931 | Bacteria | 5602 |
| 212 | Ga0097620_100090425 | 3300006931 | Bacteria | 3112 |
| 213 | Ga0097620_100511449 | 3300006931 | Bacteria | 1296 |
| 214 | Ga0097620_100704253 | 3300006931 | Bacteria | 1100 |
| 215 | Ga0075435_100004986 | 3300007076 | Bacteria | 9217 |
| 216 | Ga0075435_100138357 | 3300007076 | Bacteria | 2041 |
| 217 | Ga0075435_101719420 | 3300007076 | Bacteria | 550 |
| 218 | Ga0099794_10000219 | 3300007265 | Bacteria | 20487 |
| 219 | Ga0099794_10006092 | 3300007265 | Bacteria | 4871 |
| 220 | Ga0099794_10097943 | 3300007265 | Unclassified | 1462 |
| 221 | Ga0099794_10216089 | 3300007265 | Bacteria | 984 |
| 222 | Ga0111539_10000810 | 3300009094 | Bacteria | 40595 |
| 223 | Ga0111539_10004662 | 3300009094 | Bacteria | 17918 |
| 224 | Ga0111539_10025488 | 3300009094 | Bacteria | 7250 |
| 225 | Ga0111539_10108074 | 3300009094 | Bacteria | 3264 |
| 226 | Ga0111539_10244532 | 3300009094 | Bacteria | 2089 |
| 227 | Ga0111539_10439985 | 3300009094 | Bacteria | 1518 |
| 228 | Ga0111539_10596473 | 3300009094 | Bacteria | 1286 |
| 229 | Ga0114129_10070261 | 3300009147 | Bacteria | 4882 |
| 230 | Ga0114129_10074459 | 3300009147 | Bacteria | 4730 |
| 231 | Ga0114129_10079705 | 3300009147 | Bacteria | 4553 |
| 232 | Ga0114129_10180094 | 3300009147 | Bacteria | 2876 |
| 233 | Ga0114129_10649972 | 3300009147 | Bacteria | 1361 |
| 234 | Ga0114129_11772286 | 3300009147 | Bacteria | 752 |
| 235 | Ga0105241_11526261 | 3300009174 | Bacteria | 644 |
| 236 | Ga0105242_10001165 | 3300009176 | Bacteria | 20702 |
| 237 | Ga0105242_10177865 | 3300009176 | Bacteria | 1875 |
| 238 | Ga0105242_10227866 | 3300009176 | Bacteria | 1669 |
| 239 | Ga0105242_11210086 | 3300009176 | Bacteria | 775 |
| 240 | Ga0105248_10343478 | 3300009177 | Bacteria | 1680 |
| 241 | Ga0105249_10002749 | 3300009553 | Bacteria | 15219 |
| 242 | Ga0105249_10003197 | 3300009553 | Bacteria | 14178 |
| 243 | Ga0105249_10020855 | 3300009553 | Bacteria | 5860 |
| 244 | Ga0105249_10065121 | 3300009553 | Bacteria | 3352 |
| 245 | Ga0105249_10085379 | 3300009553 | Bacteria | 2941 |
| 246 | Ga0105249_10467527 | 3300009553 | Unclassified | 1302 |
| 247 | Ga0105249_11710068 | 3300009553 | Bacteria | 702 |
| 248 | Ga0105249_12319721 | 3300009553 | Bacteria | 609 |
| 249 | Ga0105249_12615776 | 3300009553 | Bacteria | 577 |
| 250 | Ga0105246_10222218 | 3300011119 | Bacteria | 1481 |
| 251 | Ga0157374_10610979 | 3300013296 | Bacteria | 1101 |
| 252 | Ga0157378_10081958 | 3300013297 | Bacteria | 2917 |
| 253 | Ga0163162_10043360 | 3300013306 | Bacteria | 4505 |
| 254 | Ga0163162_10052834 | 3300013306 | Unclassified | 4082 |
| 255 | Ga0163162_10164252 | 3300013306 | Bacteria | 2344 |
| 256 | Ga0157375_10020946 | 3300013308 | Bacteria | 5983 |
| 257 | Ga0157375_10135361 | 3300013308 | Unclassified | 2587 |
| 258 | Ga0157375_10234186 | 3300013308 | Bacteria | 1995 |
| 259 | Ga0163163_10226857 | 3300014325 | Bacteria | 1917 |
| 260 | Ga0163163_10326386 | 3300014325 | Bacteria | 1589 |
| 261 | Ga0163163_10840723 | 3300014325 | Bacteria | 981 |
| 262 | Ga0157380_10005493 | 3300014326 | Bacteria | 8859 |
| 263 | Ga0157380_10017785 | 3300014326 | Bacteria | 5267 |
| 264 | Ga0157380_10022727 | 3300014326 | Bacteria | 4728 |
| 265 | Ga0157380_10776908 | 3300014326 | Bacteria | 972 |
| 266 | Ga0157377_10000659 | 3300014745 | Bacteria | 14381 |
| 267 | Ga0157377_10052214 | 3300014745 | Bacteria | 2307 |
| 268 | Ga0157377_10145595 | 3300014745 | Bacteria | 1460 |
| 269 | Ga0157377_10492566 | 3300014745 | Bacteria | 855 |
| 270 | Ga0157379_10185046 | 3300014968 | Bacteria | 1882 |
| 271 | Ga0157376_10131389 | 3300014969 | Bacteria | 2234 |
| 272 | Ga0157376_12258342 | 3300014969 | Bacteria | 583 |
| 273 | Ga0163161_10015165 | 3300017792 | Bacteria | 5369 |
| 274 | Ga0163161_10743936 | 3300017792 | Bacteria | 820 |
| 275 | Ga0163161_10831738 | 3300017792 | Bacteria | 778 |
| 276 | Ga0197907_10043426 | 3300020069 | Unclassified | 577 |
| 277 | Ga0206356_11365317 | 3300020070 | Unclassified | 755 |
| 278 | Ga0207666_1041706 | 3300025271 | Bacteria | 718 |
| 279 | Ga0207673_1037459 | 3300025290 | Bacteria | 678 |
| 280 | Ga0207697_10059773 | 3300025315 | Bacteria | 1584 |
| 281 | Ga0207697_10065061 | 3300025315 | Unclassified | 1521 |
| 282 | Ga0207653_10000024 | 3300025885 | Bacteria | 117069 |
| 283 | Ga0207682_10009872 | 3300025893 | Bacteria | 3754 |
| 284 | Ga0207682_10234504 | 3300025893 | Bacteria | 851 |
| 285 | Ga0207692_10133065 | 3300025898 | Bacteria | 1407 |
| 286 | Ga0207642_10526589 | 3300025899 | Bacteria | 727 |
| 287 | Ga0207685_10006469 | 3300025905 | Bacteria | 3192 |
| 288 | Ga0207643_10004365 | 3300025908 | Bacteria | 7598 |
| 289 | Ga0207643_10266344 | 3300025908 | Unclassified | 1059 |
| 290 | Ga0207705_10038665 | 3300025909 | Bacteria | 3417 |
| 291 | Ga0207684_10003609 | 3300025910 | Bacteria | 15062 |
| 292 | Ga0207684_10028463 | 3300025910 | Bacteria | 4761 |
| 293 | Ga0207684_10056081 | 3300025910 | Bacteria | 3342 |
| 294 | Ga0207684_10301350 | 3300025910 | Bacteria | 1382 |
| 295 | Ga0207654_11294295 | 3300025911 | Bacteria | 531 |
| 296 | Ga0207693_10400123 | 3300025915 | Bacteria | 1074 |
| 297 | Ga0207660_10002949 | 3300025917 | Bacteria | 11123 |
| 298 | Ga0207660_10035319 | 3300025917 | Unclassified | 3470 |
| 299 | Ga0207660_10462023 | 3300025917 | Bacteria | 1027 |
| 300 | Ga0207662_10057520 | 3300025918 | Bacteria | 2324 |
| 301 | Ga0207662_10119839 | 3300025918 | Bacteria | 1649 |
| 302 | Ga0207662_10128650 | 3300025918 | Bacteria | 1594 |
| 303 | Ga0207662_10134229 | 3300025918 | Bacteria | 1563 |
| 304 | Ga0207662_10815578 | 3300025918 | Bacteria | 658 |
| 305 | Ga0207649_11004323 | 3300025920 | Bacteria | 657 |
| 306 | Ga0207646_10000076 | 3300025922 | Bacteria | 135473 |
| 307 | Ga0207646_10045006 | 3300025922 | Bacteria | 3962 |
| 308 | Ga0207646_10185934 | 3300025922 | Bacteria | 1877 |
| 309 | Ga0207646_10355976 | 3300025922 | Bacteria | 1322 |
| 310 | Ga0207681_10028135 | 3300025923 | Bacteria | 3640 |
| 311 | Ga0207681_10075399 | 3300025923 | Unclassified | 2365 |
| 312 | Ga0207681_10257455 | 3300025923 | Bacteria | 1365 |
| 313 | Ga0207650_10001285 | 3300025925 | Bacteria | 18202 |
| 314 | Ga0207650_10192205 | 3300025925 | Bacteria | 1631 |
| 315 | Ga0207650_10236886 | 3300025925 | Unclassified | 1474 |
| 316 | Ga0207650_10391284 | 3300025925 | Bacteria | 1149 |
| 317 | Ga0207650_10688297 | 3300025925 | Unclassified | 863 |
| 318 | Ga0207650_11221329 | 3300025925 | Unclassified | 640 |
| 319 | Ga0207659_10030626 | 3300025926 | Unclassified | 3678 |
| 320 | Ga0207659_10221620 | 3300025926 | Bacteria | 1521 |
| 321 | Ga0207659_10294348 | 3300025926 | Bacteria | 1331 |
| 322 | Ga0207700_11162853 | 3300025928 | Bacteria | 689 |
| 323 | Ga0207664_10017012 | 3300025929 | Bacteria | 5319 |
| 324 | Ga0207644_10601756 | 3300025931 | Unclassified | 913 |
| 325 | Ga0207644_11367370 | 3300025931 | Bacteria | 595 |
| 326 | Ga0207706_10036362 | 3300025933 | Unclassified | 4374 |
| 327 | Ga0207706_10110390 | 3300025933 | Bacteria | 2420 |
| 328 | Ga0207706_10332173 | 3300025933 | Bacteria | 1322 |
| 329 | Ga0207686_10000498 | 3300025934 | Bacteria | 25770 |
| 330 | Ga0207686_10032968 | 3300025934 | Bacteria | 3087 |
| 331 | Ga0207670_10033390 | 3300025936 | Bacteria | 3315 |
| 332 | Ga0207670_10042309 | 3300025936 | Bacteria | 3001 |
| 333 | Ga0207670_10943979 | 3300025936 | Unclassified | 724 |
| 334 | Ga0207704_10225253 | 3300025938 | Bacteria | 1390 |
| 335 | Ga0207704_11848203 | 3300025938 | Bacteria | 519 |
| 336 | Ga0207691_10014404 | 3300025940 | Bacteria | 7541 |
| 337 | Ga0207691_10038893 | 3300025940 | Bacteria | 4402 |
| 338 | Ga0207691_10183619 | 3300025940 | Bacteria | 1827 |
| 339 | Ga0207711_10412216 | 3300025941 | Bacteria | 1256 |
| 340 | Ga0207689_10045161 | 3300025942 | Unclassified | 3644 |
| 341 | Ga0207689_10053634 | 3300025942 | Bacteria | 3322 |
| 342 | Ga0207689_10212835 | 3300025942 | Bacteria | 1597 |
| 343 | Ga0207679_10515145 | 3300025945 | Bacteria | 1069 |
| 344 | Ga0207667_11401811 | 3300025949 | Bacteria | 672 |
| 345 | Ga0207651_10000912 | 3300025960 | Bacteria | 12998 |
| 346 | Ga0207651_10006411 | 3300025960 | Bacteria | 6157 |
| 347 | Ga0207651_10020926 | 3300025960 | Bacteria | 3961 |
| 348 | Ga0207651_10051114 | 3300025960 | Bacteria | 2810 |
| 349 | Ga0207651_10058501 | 3300025960 | Bacteria | 2664 |
| 350 | Ga0207712_10001312 | 3300025961 | Bacteria | 17052 |
| 351 | Ga0207712_10001935 | 3300025961 | Bacteria | 13612 |
| 352 | Ga0207712_10028489 | 3300025961 | Bacteria | 3736 |
| 353 | Ga0207712_10513107 | 3300025961 | Bacteria | 1026 |
| 354 | Ga0207668_10028706 | 3300025972 | Unclassified | 3641 |
| 355 | Ga0207640_10024352 | 3300025981 | Unclassified | 3651 |
| 356 | Ga0207640_10177516 | 3300025981 | Bacteria | 1594 |
| 357 | Ga0207658_10554696 | 3300025986 | Bacteria | 1028 |
| 358 | Ga0207703_10461384 | 3300026035 | Bacteria | 1188 |
| 359 | Ga0207708_10303056 | 3300026075 | Bacteria | 1300 |
| 360 | Ga0207708_10304159 | 3300026075 | Bacteria | 1298 |
| 361 | Ga0207708_10408855 | 3300026075 | Bacteria | 1124 |
| 362 | Ga0207641_10000467 | 3300026088 | Bacteria | 45772 |
| 363 | Ga0207641_10086236 | 3300026088 | Bacteria | 2737 |
| 364 | Ga0207641_10168910 | 3300026088 | Bacteria | 1995 |
| 365 | Ga0207648_10031304 | 3300026089 | Unclassified | 4703 |
| 366 | Ga0207648_10407968 | 3300026089 | Bacteria | 1232 |
| 367 | Ga0207676_10017905 | 3300026095 | Bacteria | 5141 |
| 368 | Ga0207676_10176165 | 3300026095 | Bacteria | 1868 |
| 369 | Ga0207676_10524107 | 3300026095 | Bacteria | 1128 |
| 370 | Ga0207674_10003180 | 3300026116 | Bacteria | 20225 |
| 371 | Ga0207675_100000299 | 3300026118 | Bacteria | 47665 |
| 372 | Ga0207675_100205800 | 3300026118 | Bacteria | 1891 |
| 373 | Ga0207675_100308952 | 3300026118 | Bacteria | 1541 |
| 374 | Ga0207675_101028266 | 3300026118 | Bacteria | 843 |
| 375 | Ga0207683_10155017 | 3300026121 | Bacteria | 2069 |
| 376 | Ga0207698_10753171 | 3300026142 | Bacteria | 973 |
| 377 | Ga0209588_1000202 | 3300027671 | Bacteria | 16230 |
| 378 | Ga0209588_1003286 | 3300027671 | Bacteria | 4473 |
| 379 | Ga0207428_10043138 | 3300027907 | Bacteria | 3644 |
| 380 | Ga0207428_10135883 | 3300027907 | Unclassified | 1879 |
| 381 | Ga0207428_10148039 | 3300027907 | Bacteria | 1789 |
| 382 | Ga0207428_10383608 | 3300027907 | Bacteria | 1030 |
| 383 | Ga0207428_10781662 | 3300027907 | Bacteria | 679 |
| 384 | Ga0268265_10028813 | 3300028380 | Bacteria | 3980 |
| 385 | Ga0268265_10228365 | 3300028380 | Bacteria | 1634 |
| 386 | Ga0268265_11278350 | 3300028380 | Bacteria | 733 |
| 387 | Ga0268265_11409966 | 3300028380 | Unclassified | 699 |
| 388 | Ga0268264_10282397 | 3300028381 | Unclassified | 1556 |
| 389 | Ga0307408_101894362 | 3300031548 | Bacteria | 572 |
| 390 | Ga0316576_10007772 | 3300031727 | Bacteria | 6774 |
| 391 | Ga0316578_10127318 | 3300031728 | Bacteria | 1532 |
| 392 | Ga0307405_10009318 | 3300031731 | Bacteria | 5027 |
| 393 | Ga0316577_10038066 | 3300031733 | Bacteria | 2689 |
| 394 | Ga0307413_10729486 | 3300031824 | Bacteria | 826 |
| 395 | Ga0307410_10086671 | 3300031852 | Bacteria | 2212 |
| 396 | Ga0307406_10456634 | 3300031901 | Bacteria | 1026 |
| 397 | Ga0307407_10002547 | 3300031903 | Bacteria | 7167 |
| 398 | Ga0307412_10003150 | 3300031911 | Bacteria | 9158 |
| 399 | Ga0307409_100455084 | 3300031995 | Bacteria | 1236 |
| 400 | Ga0307416_100018583 | 3300032002 | Bacteria | 4902 |
| 401 | Ga0307416_100072544 | 3300032002 | Unclassified | 2866 |
| 402 | Ga0307414_10052480 | 3300032004 | Bacteria | 2838 |
| 403 | Ga0307411_10000879 | 3300032005 | Bacteria | 11358 |
| 404 | Ga0307411_10158758 | 3300032005 | Bacteria | 1690 |
| 405 | Ga0307415_100007727 | 3300032126 | Bacteria | 5906 |
| 406 | Ga0307415_100389232 | 3300032126 | Bacteria | 1186 |
| 407 | Ga0373926_0175118 | 3300035083 | Bacteria | 822 |
| 408 | Ga0373940_0155942 | 3300035088 | Bacteria | 730 |
| 409 | Ga0373932_0332830 | 3300035112 | Bacteria | 574 |
| 410 | Ga0373956_0251129 | 3300035119 | Bacteria | 841 |
| 411 | Ga0373943_0128688 | 3300035170 | Bacteria | 1353 |
| 412 | Ga0373946_0451871 | 3300035171 | Bacteria | 654 |
| 413 | Ga0373942_0008855 | 3300035207 | Bacteria | 2351 |
| 414 | Ga0373961_0002701 | 3300035241 | Bacteria | 4538 |
| 415 | Ga0316574_0206095 | 3300035398 | Bacteria | 1262 |
| 416 | Ga0373935_1051708 | 3300035692 | Unclassified | 605 |
| 417 | Ga0373947_0381843 | 3300035725 | Bacteria | 948 |
| 418 | Ga0373937_0097898 | 3300036401 | Bacteria | 2721 |
| 419 | Ga0395898_0930674 | 3300037466 | Bacteria | 807 |
| 420 | Ga0451800_0818037 | 3300041459 | Bacteria | 686 |
| 421 | Ga0451843_0781955 | 3300041509 | Bacteria | 2280 |
| 422 | Ga0439441_031243 | 3300042001 | Bacteria | 1033 |
| 423 | Ga0439445_0016842 | 3300042004 | Bacteria | 1802 |
| 424 | Ga0439445_0082450 | 3300042004 | Bacteria | 900 |
| 425 | Ga0439444_0028166 | 3300042437 | Bacteria | 1039 |
| 426 | Ga0451577_0044384 | 3300042876 | Bacteria | 3980 |
| 427 | Ga0453683_0072496 | 3300044673 | Bacteria | 2156 |
| 428 | Ga0453683_0464403 | 3300044673 | Bacteria | 819 |
| 429 | Ga0453683_1169307 | 3300044673 | Unclassified | 514 |
| 430 | Ga0453684_0825487 | 3300044712 | Bacteria | 998 |
| 431 | Ga0451576_0003131 | 3300045051 | Bacteria | 23171 |
| 432 | Ga0451576_0009663 | 3300045051 | Bacteria | 11159 |
| 433 | Ga0451576_0052021 | 3300045051 | Unclassified | 4292 |
| 434 | Ga0451576_0124866 | 3300045051 | Bacteria | 2681 |
| 435 | Ga0451576_0435148 | 3300045051 | Bacteria | 1376 |
| 436 | Ga0451576_0554143 | 3300045051 | Unclassified | 1208 |
| 437 | Ga0466967_0803844 | 3300045976 | Bacteria | 934 |
| 438 | Ga0495627_001593 | 3300046453 | Bacteria | 12752 |
| 439 | Ga0495603_0063318 | 3300046455 | Bacteria | 2182 |
| 440 | Ga0495629_0834605 | 3300046459 | Bacteria | 607 |
| 441 | Ga0495580_0233579 | 3300046472 | Bacteria | 1262 |
| 442 | Ga0495605_0134240 | 3300046474 | Bacteria | 1114 |
| 443 | Ga0495639_0026741 | 3300046475 | Bacteria | 2552 |
| 444 | Ga0495584_0229946 | 3300046491 | Bacteria | 943 |
| 445 | Ga0495594_0520702 | 3300046499 | Bacteria | 675 |
| 446 | Ga0495596_0255523 | 3300046500 | Bacteria | 680 |
| 447 | Ga0495644_0159487 | 3300046523 | Bacteria | 865 |
| 448 | Ga0495663_0023367 | 3300046525 | Bacteria | 1790 |
| 449 | Ga0495642_0169940 | 3300046528 | Bacteria | 947 |
| 450 | Ga0495642_0338774 | 3300046528 | Bacteria | 661 |
| 451 | Ga0495598_0007728 | 3300046537 | Bacteria | 2479 |
| 452 | Ga0495598_0069337 | 3300046537 | Bacteria | 1107 |
| 453 | Ga0495609_0034840 | 3300046538 | Unclassified | 2280 |
| 454 | Ga0495621_0004188 | 3300046539 | Bacteria | 4030 |
| 455 | Ga0495621_0065617 | 3300046539 | Unclassified | 1327 |
| 456 | Ga0495621_0100819 | 3300046539 | Bacteria | 1098 |
| 457 | Ga0495621_0111077 | 3300046539 | Bacteria | 1051 |
| 458 | Ga0495622_0010974 | 3300046557 | Bacteria | 4181 |
| 459 | Ga0495633_0000036 | 3300046558 | Bacteria | 184999 |
| 460 | Ga0495633_0125417 | 3300046558 | Bacteria | 1188 |
| 461 | Ga0495659_0107867 | 3300046664 | Unclassified | 1085 |
| 462 | Ga0495658_0920191 | 3300046683 | Bacteria | 559 |
| 463 | Ga0495624_0105993 | 3300046690 | Bacteria | 1730 |
| 464 | Ga0495624_0256141 | 3300046690 | Bacteria | 1058 |
| 465 | Ga0495670_0125293 | 3300046691 | Bacteria | 1337 |
| 466 | Ga0495670_0708540 | 3300046691 | Unclassified | 549 |
| 467 | Ga0495649_0104464 | 3300046694 | Bacteria | 1504 |
| 468 | Ga0495589_0084375 | 3300046794 | Bacteria | 1544 |
| 469 | Ga0495672_0029182 | 3300047320 | Bacteria | 3478 |
| 470 | Ga0495672_0035861 | 3300047320 | Bacteria | 3051 |
| 471 | Ga0495676_0132325 | 3300047321 | Bacteria | 1799 |
| 472 | Ga0495677_0021142 | 3300047445 | Bacteria | 2359 |
| 473 | Ga0495626_0114981 | 3300048091 | Bacteria | 1161 |
| 474 | Ga0501031_0600678 | 3300049568 | Unclassified | 708 |
| 475 | Ga0501032_0004687 | 3300049569 | Bacteria | 10262 |
| 476 | Ga0501032_0027679 | 3300049569 | Bacteria | 3896 |
| 477 | Ga0501034_0029202 | 3300049571 | Bacteria | 5605 |
| 478 | Ga0501034_0094207 | 3300049571 | Unclassified | 2991 |
| 479 | Ga0501034_0595746 | 3300049571 | Bacteria | 1011 |
| 480 | Ga0501034_1039295 | 3300049571 | Bacteria | 702 |
| 481 | Ga0501036_0003416 | 3300049572 | Bacteria | 12692 |
| 482 | Ga0501036_0014802 | 3300049572 | Bacteria | 6505 |
| 483 | Ga0501037_0017762 | 3300049573 | Bacteria | 5236 |
| 484 | Ga0501037_0148621 | 3300049573 | Bacteria | 1675 |
| 485 | Ga0501038_0010673 | 3300049574 | Bacteria | 8401 |
| 486 | Ga0501038_0035197 | 3300049574 | Bacteria | 4397 |
| 487 | Ga0501039_0016906 | 3300049575 | Bacteria | 5592 |
| 488 | Ga0501039_0183254 | 3300049575 | Bacteria | 1646 |
| 489 | Ga0501040_1334136 | 3300049576 | Unclassified | 521 |
| 490 | Ga0501043_0020417 | 3300049579 | Bacteria | 5196 |
| 491 | Ga0501043_0130860 | 3300049579 | Bacteria | 1966 |
| 492 | Ga0501046_0003510 | 3300049580 | Bacteria | 14366 |
| 493 | Ga0501046_0036206 | 3300049580 | Bacteria | 3974 |
| 494 | Ga0501047_0055611 | 3300049581 | Bacteria | 3826 |
| 495 | Ga0501047_0128236 | 3300049581 | Bacteria | 2417 |
| 496 | Ga0501047_0875236 | 3300049581 | Bacteria | 712 |
| 497 | Ga0501048_0035118 | 3300049582 | Bacteria | 3610 |
| 498 | Ga0501067_0191508 | 3300049583 | Unclassified | 1139 |
| 499 | Ga0501068_0035423 | 3300049584 | Bacteria | 2979 |
| 500 | Ga0501070_0012717 | 3300049586 | Bacteria | 7098 |
| 501 | Ga0501073_0329772 | 3300049589 | Unclassified | 1053 |
| 502 | Ga0501074_0003003 | 3300049590 | Bacteria | 11870 |
| 503 | Ga0501079_0133957 | 3300049741 | Bacteria | 1929 |
| 504 | Ga0501083_0001228 | 3300049744 | Bacteria | 17354 |
| 505 | Ga0501283_081036 | 3300049779 | Unclassified | 610 |
| 506 | Ga0501035_0009147 | 3300049822 | Bacteria | 9212 |
| 507 | Ga0501035_0117132 | 3300049822 | Bacteria | 2331 |
| 508 | Ga0501044_0008422 | 3300049823 | Bacteria | 11308 |
| 509 | Ga0501044_0200688 | 3300049823 | Bacteria | 1953 |
| 510 | Ga0501044_0232454 | 3300049823 | Bacteria | 1791 |
| 511 | nmdc:mga05p37_1010560_c1 | 3300050507 | Bacteria | 882 |
| 512 | nmdc:mga05p37_1721450_c1 | 3300050507 | Bacteria | 610 |
| 513 | nmdc:mga05p37_214160_c1 | 3300050507 | Bacteria | 2327 |
| 514 | nmdc:mga09592_155092_c1 | 3300050508 | Bacteria | 1976 |
| 515 | nmdc:mga09592_251377_c1 | 3300050508 | Bacteria | 1532 |
| 516 | nmdc:mga09592_50342_c1 | 3300050508 | Bacteria | 3514 |
| 517 | nmdc:mga09592_594457_c1 | 3300050508 | Bacteria | 948 |
| 518 | nmdc:mga09592_856821_c1 | 3300050508 | Bacteria | 766 |
| 519 | nmdc:mga09592_88102_c1 | 3300050508 | Bacteria | 2651 |
| 520 | nmdc:mga0qj67_21761_c1 | 3300050509 | Bacteria | 4920 |
| 521 | nmdc:mga06r32_44707_c1 | 3300050510 | Bacteria | 4218 |
| 522 | nmdc:mga06r32_71087_c1 | 3300050510 | Bacteria | 3367 |
| 523 | nmdc:mga06r32_88897_c1 | 3300050510 | Bacteria | 3016 |
| 524 | nmdc:mga08y16_138339_c1 | 3300050511 | Bacteria | 2532 |
| 525 | nmdc:mga08y16_2581_c1 | 3300050511 | Bacteria | 18625 |
| 526 | nmdc:mga08y16_280677_c1 | 3300050511 | Bacteria | 1718 |
| 527 | nmdc:mga08y16_31684_c1 | 3300050511 | Bacteria | 5559 |
| 528 | nmdc:mga08y16_390725_c1 | 3300050511 | Bacteria | 1425 |
| 529 | nmdc:mga0n895_136554_c1 | 3300050512 | Unclassified | 2479 |
| 530 | nmdc:mga0n895_487610_c1 | 3300050512 | Bacteria | 1243 |
| 531 | nmdc:mga0n895_49930_c1 | 3300050512 | Bacteria | 4101 |
| 532 | nmdc:mga0n895_56595_c1 | 3300050512 | Bacteria | 3863 |
| 533 | nmdc:mga0n895_675494_c1 | 3300050512 | Bacteria | 1030 |
| 534 | nmdc:mga0n895_997938_c1 | 3300050512 | Bacteria | 819 |
| 535 | nmdc:mga0rr50_43004_c1 | 3300050513 | Bacteria | 3303 |
| 536 | nmdc:mga0rr50_46189_c1 | 3300050513 | Bacteria | 3206 |
| 537 | nmdc:mga0rr50_72971_c1 | 3300050513 | Bacteria | 2623 |
| 538 | nmdc:mga08x19_183293_c1 | 3300050514 | Bacteria | 1430 |
| 539 | nmdc:mga08x19_48_c1 | 3300050514 | Bacteria | 141135 |
| 540 | nmdc:mga08x19_65414_c1 | 3300050514 | Bacteria | 2361 |
| 541 | nmdc:mga08x19_82200_c1 | 3300050514 | Bacteria | 2116 |
| 542 | nmdc:mga08x19_88852_c1 | 3300050514 | Bacteria | 2037 |
| 543 | nmdc:mga0a205_26342_c1 | 3300050515 | Bacteria | 5544 |
| 544 | nmdc:mga0a205_718405_c1 | 3300050515 | Bacteria | 849 |
| 545 | nmdc:mga0a205_75254_c1 | 3300050515 | Bacteria | 3262 |
| 546 | nmdc:mga0a205_80703_c1 | 3300050515 | Bacteria | 3143 |
| 547 | Ga0500635_0045680 | 3300053080 | Bacteria | 1483 |
| 548 | Ga0500651_0025852 | 3300053093 | Bacteria | 3686 |
| 549 | Ga0500641_0142595 | 3300053096 | Bacteria | 1035 |
| 550 | Ga0500556_0029813 | 3300053104 | Bacteria | 1843 |
| 551 | Ga0500568_0004673 | 3300053139 | Bacteria | 7280 |
| 552 | Ga0500616_0406727 | 3300053153 | Unclassified | 543 |
| 553 | Ga0500637_0061091 | 3300053178 | Bacteria | 2158 |
| 554 | Ga0530510_0054690 | 3300061734 | Bacteria | 2885 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025911 | Ga0207654_11294295 | Ga0207654_112942952 | 119 |
| 2 | 3300005435 | Ga0070714_100001866 | Ga0070714_10000186615 | 122 |
| 3 | 3300025929 | Ga0207664_10017012 | Ga0207664_100170123 | 122 |
| 4 | 3300005719 | Ga0068861_100056066 | Ga0068861_1000560664 | 128 |
| 5 | 3300025918 | Ga0207662_10057520 | Ga0207662_100575201 | 128 |
| 6 | 3300025923 | Ga0207681_10257455 | Ga0207681_102574552 | 128 |
| 7 | 3300044673 | Ga0453683_0464403 | Ga0453683_0464403_12_440 | 128 |
| 8 | 3300005445 | Ga0070708_100230000 | Ga0070708_1002300003 | 129 |
| 9 | 3300005468 | Ga0070707_101523336 | Ga0070707_1015233361 | 129 |
| 10 | 3300005518 | Ga0070699_100093976 | Ga0070699_1000939763 | 129 |
| 11 | 3300005536 | Ga0070697_100180502 | Ga0070697_1001805022 | 129 |
| 12 | 3300006914 | Ga0075436_100165819 | Ga0075436_1001658191 | 129 |
| 13 | 3300025922 | Ga0207646_10185934 | Ga0207646_101859342 | 129 |
| 14 | 3300050514 | nmdc:mga08x19_82200_c1 | nmdc:mga08x19_82200_c1_997_1491 | 129 |
| 15 | 3300025949 | Ga0207667_11401811 | Ga0207667_114018112 | 133 |
| 16 | 3300025290 | Ga0207673_1037459 | Ga0207673_10374591 | 134 |
| 17 | 3300002459 | JGI24751J29686_10001433 | JGI24751J29686_100014336 | 135 |
| 18 | 3300005288 | Ga0065714_10074150 | Ga0065714_100741504 | 135 |
| 19 | 3300005327 | Ga0070658_10184936 | Ga0070658_101849362 | 135 |
| 20 | 3300005328 | Ga0070676_10191605 | Ga0070676_101916052 | 135 |
| 21 | 3300005330 | Ga0070690_100002003 | Ga0070690_1000020031 | 135 |
| 22 | 3300005330 | Ga0070690_100095727 | Ga0070690_1000957272 | 135 |
| 23 | 3300005331 | Ga0070670_100004466 | Ga0070670_10000446610 | 135 |
| 24 | 3300005331 | Ga0070670_100043064 | Ga0070670_1000430642 | 135 |
| 25 | 3300005331 | Ga0070670_100571015 | Ga0070670_1005710152 | 135 |
| 26 | 3300005334 | Ga0068869_100623128 | Ga0068869_1006231281 | 135 |
| 27 | 3300005335 | Ga0070666_10167995 | Ga0070666_101679952 | 135 |
| 28 | 3300005336 | Ga0070680_100021318 | Ga0070680_1000213186 | 135 |
| 29 | 3300005336 | Ga0070680_100054899 | Ga0070680_1000548995 | 135 |
| 30 | 3300005336 | Ga0070680_100306724 | Ga0070680_1003067242 | 135 |
| 31 | 3300005340 | Ga0070689_100142065 | Ga0070689_1001420652 | 135 |
| 32 | 3300005340 | Ga0070689_101174762 | Ga0070689_1011747622 | 135 |
| 33 | 3300005340 | Ga0070689_101228953 | Ga0070689_1012289531 | 135 |
| 34 | 3300005343 | Ga0070687_100021291 | Ga0070687_1000212913 | 135 |
| 35 | 3300005343 | Ga0070687_100250323 | Ga0070687_1002503232 | 135 |
| 36 | 3300005345 | Ga0070692_10262707 | Ga0070692_102627072 | 135 |
| 37 | 3300005345 | Ga0070692_10308393 | Ga0070692_103083932 | 135 |
| 38 | 3300005347 | Ga0070668_100630313 | Ga0070668_1006303132 | 135 |
| 39 | 3300005354 | Ga0070675_100022563 | Ga0070675_1000225633 | 135 |
| 40 | 3300005356 | Ga0070674_101041095 | Ga0070674_1010410951 | 135 |
| 41 | 3300005356 | Ga0070674_101075555 | Ga0070674_1010755552 | 135 |
| 42 | 3300005364 | Ga0070673_100011926 | Ga0070673_1000119267 | 135 |
| 43 | 3300005365 | Ga0070688_100022092 | Ga0070688_1000220922 | 135 |
| 44 | 3300005406 | Ga0070703_10000245 | Ga0070703_1000024519 | 135 |
| 45 | 3300005435 | Ga0070714_100813718 | Ga0070714_1008137182 | 135 |
| 46 | 3300005437 | Ga0070710_10158977 | Ga0070710_101589771 | 135 |
| 47 | 3300005438 | Ga0070701_10015250 | Ga0070701_100152503 | 135 |
| 48 | 3300005438 | Ga0070701_10067889 | Ga0070701_100678894 | 135 |
| 49 | 3300005438 | Ga0070701_11219568 | Ga0070701_112195681 | 135 |
| 50 | 3300005440 | Ga0070705_100002366 | Ga0070705_1000023667 | 135 |
| 51 | 3300005440 | Ga0070705_100011027 | Ga0070705_1000110273 | 135 |
| 52 | 3300005440 | Ga0070705_100012344 | Ga0070705_1000123447 | 135 |
| 53 | 3300005441 | Ga0070700_101508128 | Ga0070700_1015081281 | 135 |
| 54 | 3300005444 | Ga0070694_100000872 | Ga0070694_1000008728 | 135 |
| 55 | 3300005444 | Ga0070694_100003743 | Ga0070694_1000037436 | 135 |
| 56 | 3300005444 | Ga0070694_100007039 | Ga0070694_1000070394 | 135 |
| 57 | 3300005444 | Ga0070694_100031886 | Ga0070694_1000318862 | 135 |
| 58 | 3300005444 | Ga0070694_100037712 | Ga0070694_1000377122 | 135 |
| 59 | 3300005445 | Ga0070708_100043528 | Ga0070708_1000435282 | 135 |
| 60 | 3300005457 | Ga0070662_100080981 | Ga0070662_1000809813 | 135 |
| 61 | 3300005459 | Ga0068867_101107870 | Ga0068867_1011078702 | 135 |
| 62 | 3300005466 | Ga0070685_10071027 | Ga0070685_100710273 | 135 |
| 63 | 3300005467 | Ga0070706_100070138 | Ga0070706_1000701382 | 135 |
| 64 | 3300005467 | Ga0070706_100112000 | Ga0070706_1001120003 | 135 |
| 65 | 3300005467 | Ga0070706_100138025 | Ga0070706_1001380252 | 135 |
| 66 | 3300005467 | Ga0070706_100659111 | Ga0070706_1006591112 | 135 |
| 67 | 3300005468 | Ga0070707_100000077 | Ga0070707_10000007749 | 135 |
| 68 | 3300005468 | Ga0070707_100009322 | Ga0070707_1000093227 | 135 |
| 69 | 3300005468 | Ga0070707_100475139 | Ga0070707_1004751392 | 135 |
| 70 | 3300005471 | Ga0070698_100031715 | Ga0070698_1000317153 | 135 |
| 71 | 3300005471 | Ga0070698_100534261 | Ga0070698_1005342612 | 135 |
| 72 | 3300005471 | Ga0070698_101262447 | Ga0070698_1012624472 | 135 |
| 73 | 3300005518 | Ga0070699_100087007 | Ga0070699_1000870073 | 135 |
| 74 | 3300005518 | Ga0070699_100240011 | Ga0070699_1002400112 | 135 |
| 75 | 3300005518 | Ga0070699_100826566 | Ga0070699_1008265662 | 135 |
| 76 | 3300005536 | Ga0070697_100009133 | Ga0070697_1000091337 | 135 |
| 77 | 3300005536 | Ga0070697_100013996 | Ga0070697_1000139963 | 135 |
| 78 | 3300005536 | Ga0070697_100156401 | Ga0070697_1001564012 | 135 |
| 79 | 3300005543 | Ga0070672_100084227 | Ga0070672_1000842274 | 135 |
| 80 | 3300005543 | Ga0070672_101041989 | Ga0070672_1010419891 | 135 |
| 81 | 3300005544 | Ga0070686_100016350 | Ga0070686_1000163503 | 135 |
| 82 | 3300005544 | Ga0070686_100038440 | Ga0070686_1000384404 | 135 |
| 83 | 3300005545 | Ga0070695_100004373 | Ga0070695_1000043735 | 135 |
| 84 | 3300005545 | Ga0070695_100012926 | Ga0070695_1000129265 | 135 |
| 85 | 3300005545 | Ga0070695_100060158 | Ga0070695_1000601582 | 135 |
| 86 | 3300005545 | Ga0070695_100129984 | Ga0070695_1001299842 | 135 |
| 87 | 3300005545 | Ga0070695_100327449 | Ga0070695_1003274492 | 135 |
| 88 | 3300005546 | Ga0070696_100005529 | Ga0070696_1000055294 | 135 |
| 89 | 3300005546 | Ga0070696_100014148 | Ga0070696_1000141483 | 135 |
| 90 | 3300005546 | Ga0070696_101033178 | Ga0070696_1010331781 | 135 |
| 91 | 3300005549 | Ga0070704_100001416 | Ga0070704_1000014167 | 135 |
| 92 | 3300005549 | Ga0070704_100007963 | Ga0070704_1000079636 | 135 |
| 93 | 3300005549 | Ga0070704_100051875 | Ga0070704_1000518752 | 135 |
| 94 | 3300005549 | Ga0070704_100073517 | Ga0070704_1000735173 | 135 |
| 95 | 3300005564 | Ga0070664_100147240 | Ga0070664_1001472402 | 135 |
| 96 | 3300005578 | Ga0068854_100898909 | Ga0068854_1008989092 | 135 |
| 97 | 3300005615 | Ga0070702_100377759 | Ga0070702_1003777592 | 135 |
| 98 | 3300005617 | Ga0068859_100025026 | Ga0068859_1000250265 | 135 |
| 99 | 3300005617 | Ga0068859_100511419 | Ga0068859_1005114192 | 135 |
| 100 | 3300005618 | Ga0068864_100010393 | Ga0068864_1000103937 | 135 |
| 101 | 3300005618 | Ga0068864_100029845 | Ga0068864_1000298455 | 135 |
| 102 | 3300005718 | Ga0068866_10304594 | Ga0068866_103045942 | 135 |
| 103 | 3300005719 | Ga0068861_100103697 | Ga0068861_1001036972 | 135 |
| 104 | 3300005719 | Ga0068861_101224172 | Ga0068861_1012241722 | 135 |
| 105 | 3300005840 | Ga0068870_10102118 | Ga0068870_101021183 | 135 |
| 106 | 3300005841 | Ga0068863_100190122 | Ga0068863_1001901223 | 135 |
| 107 | 3300005842 | Ga0068858_100164222 | Ga0068858_1001642223 | 135 |
| 108 | 3300005843 | Ga0068860_100273586 | Ga0068860_1002735862 | 135 |
| 109 | 3300005843 | Ga0068860_100836376 | Ga0068860_1008363762 | 135 |
| 110 | 3300006028 | Ga0070717_10155868 | Ga0070717_101558682 | 135 |
| 111 | 3300006163 | Ga0070715_10039729 | Ga0070715_100397293 | 135 |
| 112 | 3300006175 | Ga0070712_100512023 | Ga0070712_1005120232 | 135 |
| 113 | 3300006237 | Ga0097621_100514175 | Ga0097621_1005141752 | 135 |
| 114 | 3300006237 | Ga0097621_100551037 | Ga0097621_1005510372 | 135 |
| 115 | 3300006844 | Ga0075428_100012694 | Ga0075428_1000126942 | 135 |
| 116 | 3300006844 | Ga0075428_100132510 | Ga0075428_1001325103 | 135 |
| 117 | 3300006844 | Ga0075428_100335232 | Ga0075428_1003352322 | 135 |
| 118 | 3300006844 | Ga0075428_100702067 | Ga0075428_1007020672 | 135 |
| 119 | 3300006846 | Ga0075430_100203948 | Ga0075430_1002039481 | 135 |
| 120 | 3300006847 | Ga0075431_100015629 | Ga0075431_1000156293 | 135 |
| 121 | 3300006847 | Ga0075431_100402196 | Ga0075431_1004021962 | 135 |
| 122 | 3300006852 | Ga0075433_10034149 | Ga0075433_100341494 | 135 |
| 123 | 3300006852 | Ga0075433_10053283 | Ga0075433_100532834 | 135 |
| 124 | 3300006852 | Ga0075433_10056824 | Ga0075433_100568244 | 135 |
| 125 | 3300006852 | Ga0075433_10177928 | Ga0075433_101779282 | 135 |
| 126 | 3300006852 | Ga0075433_10224975 | Ga0075433_102249753 | 135 |
| 127 | 3300006871 | Ga0075434_100007170 | Ga0075434_1000071707 | 135 |
| 128 | 3300006871 | Ga0075434_100007922 | Ga0075434_1000079228 | 135 |
| 129 | 3300006871 | Ga0075434_100036460 | Ga0075434_1000364603 | 135 |
| 130 | 3300006871 | Ga0075434_100112314 | Ga0075434_1001123144 | 135 |
| 131 | 3300006871 | Ga0075434_100163948 | Ga0075434_1001639483 | 135 |
| 132 | 3300006871 | Ga0075434_100235379 | Ga0075434_1002353792 | 135 |
| 133 | 3300006871 | Ga0075434_100489519 | Ga0075434_1004895193 | 135 |
| 134 | 3300006880 | Ga0075429_100112039 | Ga0075429_1001120391 | 135 |
| 135 | 3300006880 | Ga0075429_100315389 | Ga0075429_1003153891 | 135 |
| 136 | 3300006914 | Ga0075436_100137655 | Ga0075436_1001376554 | 135 |
| 137 | 3300006914 | Ga0075436_100142146 | Ga0075436_1001421463 | 135 |
| 138 | 3300006914 | Ga0075436_100188960 | Ga0075436_1001889602 | 135 |
| 139 | 3300006931 | Ga0097620_100025023 | Ga0097620_1000250235 | 135 |
| 140 | 3300006931 | Ga0097620_100511449 | Ga0097620_1005114492 | 135 |
| 141 | 3300007076 | Ga0075435_100004986 | Ga0075435_1000049868 | 135 |
| 142 | 3300007076 | Ga0075435_100138357 | Ga0075435_1001383573 | 135 |
| 143 | 3300007076 | Ga0075435_101719420 | Ga0075435_1017194201 | 135 |
| 144 | 3300007265 | Ga0099794_10000219 | Ga0099794_100002193 | 135 |
| 145 | 3300007265 | Ga0099794_10006092 | Ga0099794_100060923 | 135 |
| 146 | 3300007265 | Ga0099794_10097943 | Ga0099794_100979432 | 135 |
| 147 | 3300007265 | Ga0099794_10216089 | Ga0099794_102160893 | 135 |
| 148 | 3300009094 | Ga0111539_10000810 | Ga0111539_1000081021 | 135 |
| 149 | 3300009094 | Ga0111539_10025488 | Ga0111539_100254887 | 135 |
| 150 | 3300009094 | Ga0111539_10108074 | Ga0111539_101080744 | 135 |
| 151 | 3300009094 | Ga0111539_10439985 | Ga0111539_104399852 | 135 |
| 152 | 3300009094 | Ga0111539_10596473 | Ga0111539_105964732 | 135 |
| 153 | 3300009147 | Ga0114129_10070261 | Ga0114129_100702613 | 135 |
| 154 | 3300009147 | Ga0114129_10180094 | Ga0114129_101800943 | 135 |
| 155 | 3300009147 | Ga0114129_10649972 | Ga0114129_106499721 | 135 |
| 156 | 3300009147 | Ga0114129_11772286 | Ga0114129_117722861 | 135 |
| 157 | 3300009176 | Ga0105242_11210086 | Ga0105242_112100862 | 135 |
| 158 | 3300009553 | Ga0105249_10003197 | Ga0105249_100031976 | 135 |
| 159 | 3300009553 | Ga0105249_10065121 | Ga0105249_100651213 | 135 |
| 160 | 3300009553 | Ga0105249_12319721 | Ga0105249_123197211 | 135 |
| 161 | 3300013297 | Ga0157378_10081958 | Ga0157378_100819583 | 135 |
| 162 | 3300014325 | Ga0163163_10326386 | Ga0163163_103263861 | 135 |
| 163 | 3300014326 | Ga0157380_10022727 | Ga0157380_100227273 | 135 |
| 164 | 3300014745 | Ga0157377_10052214 | Ga0157377_100522143 | 135 |
| 165 | 3300017792 | Ga0163161_10831738 | Ga0163161_108317382 | 135 |
| 166 | 3300020069 | Ga0197907_10043426 | Ga0197907_100434261 | 135 |
| 167 | 3300020070 | Ga0206356_11365317 | Ga0206356_113653171 | 135 |
| 168 | 3300025315 | Ga0207697_10059773 | Ga0207697_100597732 | 135 |
| 169 | 3300025885 | Ga0207653_10000024 | Ga0207653_1000002436 | 135 |
| 170 | 3300025893 | Ga0207682_10234504 | Ga0207682_102345042 | 135 |
| 171 | 3300025898 | Ga0207692_10133065 | Ga0207692_101330653 | 135 |
| 172 | 3300025905 | Ga0207685_10006469 | Ga0207685_100064693 | 135 |
| 173 | 3300025909 | Ga0207705_10038665 | Ga0207705_100386653 | 135 |
| 174 | 3300025910 | Ga0207684_10003609 | Ga0207684_1000360912 | 135 |
| 175 | 3300025910 | Ga0207684_10028463 | Ga0207684_100284632 | 135 |
| 176 | 3300025910 | Ga0207684_10056081 | Ga0207684_100560813 | 135 |
| 177 | 3300025915 | Ga0207693_10400123 | Ga0207693_104001232 | 135 |
| 178 | 3300025917 | Ga0207660_10002949 | Ga0207660_1000294912 | 135 |
| 179 | 3300025917 | Ga0207660_10035319 | Ga0207660_100353192 | 135 |
| 180 | 3300025917 | Ga0207660_10462023 | Ga0207660_104620232 | 135 |
| 181 | 3300025918 | Ga0207662_10128650 | Ga0207662_101286502 | 135 |
| 182 | 3300025918 | Ga0207662_10134229 | Ga0207662_101342293 | 135 |
| 183 | 3300025920 | Ga0207649_11004323 | Ga0207649_110043231 | 135 |
| 184 | 3300025922 | Ga0207646_10000076 | Ga0207646_1000007664 | 135 |
| 185 | 3300025922 | Ga0207646_10045006 | Ga0207646_100450065 | 135 |
| 186 | 3300025922 | Ga0207646_10355976 | Ga0207646_103559762 | 135 |
| 187 | 3300025925 | Ga0207650_10001285 | Ga0207650_1000128521 | 135 |
| 188 | 3300025925 | Ga0207650_10236886 | Ga0207650_102368862 | 135 |
| 189 | 3300025925 | Ga0207650_10688297 | Ga0207650_106882972 | 135 |
| 190 | 3300025926 | Ga0207659_10294348 | Ga0207659_102943482 | 135 |
| 191 | 3300025928 | Ga0207700_11162853 | Ga0207700_111628532 | 135 |
| 192 | 3300025931 | Ga0207644_10601756 | Ga0207644_106017561 | 135 |
| 193 | 3300025931 | Ga0207644_11367370 | Ga0207644_113673701 | 135 |
| 194 | 3300025933 | Ga0207706_10110390 | Ga0207706_101103903 | 135 |
| 195 | 3300025933 | Ga0207706_10332173 | Ga0207706_103321732 | 135 |
| 196 | 3300025936 | Ga0207670_10033390 | Ga0207670_100333905 | 135 |
| 197 | 3300025936 | Ga0207670_10943979 | Ga0207670_109439792 | 135 |
| 198 | 3300025940 | Ga0207691_10038893 | Ga0207691_100388934 | 135 |
| 199 | 3300025942 | Ga0207689_10212835 | Ga0207689_102128353 | 135 |
| 200 | 3300025945 | Ga0207679_10515145 | Ga0207679_105151452 | 135 |
| 201 | 3300025960 | Ga0207651_10000912 | Ga0207651_100009129 | 135 |
| 202 | 3300025961 | Ga0207712_10028489 | Ga0207712_100284892 | 135 |
| 203 | 3300026075 | Ga0207708_10303056 | Ga0207708_103030562 | 135 |
| 204 | 3300026088 | Ga0207641_10168910 | Ga0207641_101689102 | 135 |
| 205 | 3300026095 | Ga0207676_10017905 | Ga0207676_100179055 | 135 |
| 206 | 3300026118 | Ga0207675_100205800 | Ga0207675_1002058003 | 135 |
| 207 | 3300026118 | Ga0207675_100308952 | Ga0207675_1003089523 | 135 |
| 208 | 3300026142 | Ga0207698_10753171 | Ga0207698_107531712 | 135 |
| 209 | 3300027671 | Ga0209588_1000202 | Ga0209588_10002028 | 135 |
| 210 | 3300027671 | Ga0209588_1003286 | Ga0209588_10032864 | 135 |
| 211 | 3300027907 | Ga0207428_10043138 | Ga0207428_100431382 | 135 |
| 212 | 3300027907 | Ga0207428_10148039 | Ga0207428_101480392 | 135 |
| 213 | 3300027907 | Ga0207428_10383608 | Ga0207428_103836082 | 135 |
| 214 | 3300027907 | Ga0207428_10781662 | Ga0207428_107816621 | 135 |
| 215 | 3300031548 | Ga0307408_101894362 | Ga0307408_1018943621 | 135 |
| 216 | 3300031727 | Ga0316576_10007772 | Ga0316576_100077727 | 135 |
| 217 | 3300031728 | Ga0316578_10127318 | Ga0316578_101273182 | 135 |
| 218 | 3300031731 | Ga0307405_10009318 | Ga0307405_100093186 | 135 |
| 219 | 3300031733 | Ga0316577_10038066 | Ga0316577_100380662 | 135 |
| 220 | 3300031824 | Ga0307413_10729486 | Ga0307413_107294862 | 135 |
| 221 | 3300031852 | Ga0307410_10086671 | Ga0307410_100866712 | 135 |
| 222 | 3300031901 | Ga0307406_10456634 | Ga0307406_104566342 | 135 |
| 223 | 3300031903 | Ga0307407_10002547 | Ga0307407_100025478 | 135 |
| 224 | 3300031911 | Ga0307412_10003150 | Ga0307412_100031508 | 135 |
| 225 | 3300031995 | Ga0307409_100455084 | Ga0307409_1004550842 | 135 |
| 226 | 3300032002 | Ga0307416_100018583 | Ga0307416_1000185835 | 135 |
| 227 | 3300032002 | Ga0307416_100072544 | Ga0307416_1000725444 | 135 |
| 228 | 3300032005 | Ga0307411_10000879 | Ga0307411_100008799 | 135 |
| 229 | 3300032005 | Ga0307411_10158758 | Ga0307411_101587582 | 135 |
| 230 | 3300032126 | Ga0307415_100007727 | Ga0307415_1000077272 | 135 |
| 231 | 3300032126 | Ga0307415_100389232 | Ga0307415_1003892322 | 135 |
| 232 | 3300035083 | Ga0373926_0175118 | Ga0373926_0175118_297_725 | 135 |
| 233 | 3300035088 | Ga0373940_0155942 | Ga0373940_0155942_227_658 | 135 |
| 234 | 3300035112 | Ga0373932_0332830 | Ga0373932_0332830_24_455 | 135 |
| 235 | 3300035170 | Ga0373943_0128688 | Ga0373943_0128688_866_1294 | 135 |
| 236 | 3300035171 | Ga0373946_0451871 | Ga0373946_0451871_68_496 | 135 |
| 237 | 3300035207 | Ga0373942_0008855 | Ga0373942_0008855_412_837 | 135 |
| 238 | 3300035241 | Ga0373961_0002701 | Ga0373961_0002701_3800_4228 | 135 |
| 239 | 3300035398 | Ga0316574_0206095 | Ga0316574_0206095_60_488 | 135 |
| 240 | 3300035692 | Ga0373935_1051708 | Ga0373935_1051708_119_571 | 135 |
| 241 | 3300035725 | Ga0373947_0381843 | Ga0373947_0381843_99_527 | 135 |
| 242 | 3300037466 | Ga0395898_0930674 | Ga0395898_0930674_205_720 | 135 |
| 243 | 3300042001 | Ga0439441_031243 | Ga0439441_031243_34_522 | 135 |
| 244 | 3300042437 | Ga0439444_0028166 | Ga0439444_0028166_245_733 | 135 |
| 245 | 3300042876 | Ga0451577_0044384 | Ga0451577_0044384_3411_3854 | 135 |
| 246 | 3300044673 | Ga0453683_0072496 | Ga0453683_0072496_1219_1662 | 135 |
| 247 | 3300045051 | Ga0451576_0003131 | Ga0451576_0003131_20167_20610 | 135 |
| 248 | 3300045051 | Ga0451576_0009663 | Ga0451576_0009663_10119_10571 | 135 |
| 249 | 3300045051 | Ga0451576_0052021 | Ga0451576_0052021_3842_4270 | 135 |
| 250 | 3300045051 | Ga0451576_0124866 | Ga0451576_0124866_49_477 | 135 |
| 251 | 3300045051 | Ga0451576_0435148 | Ga0451576_0435148_607_1035 | 135 |
| 252 | 3300045051 | Ga0451576_0554143 | Ga0451576_0554143_567_995 | 135 |
| 253 | 3300045976 | Ga0466967_0803844 | Ga0466967_0803844_466_891 | 135 |
| 254 | 3300046455 | Ga0495603_0063318 | Ga0495603_0063318_1698_2123 | 135 |
| 255 | 3300046459 | Ga0495629_0834605 | Ga0495629_0834605_112_561 | 135 |
| 256 | 3300046472 | Ga0495580_0233579 | Ga0495580_0233579_810_1238 | 135 |
| 257 | 3300046474 | Ga0495605_0134240 | Ga0495605_0134240_356_781 | 135 |
| 258 | 3300046475 | Ga0495639_0026741 | Ga0495639_0026741_1366_1794 | 135 |
| 259 | 3300046491 | Ga0495584_0229946 | Ga0495584_0229946_500_928 | 135 |
| 260 | 3300046500 | Ga0495596_0255523 | Ga0495596_0255523_14_442 | 135 |
| 261 | 3300046523 | Ga0495644_0159487 | Ga0495644_0159487_43_471 | 135 |
| 262 | 3300046525 | Ga0495663_0023367 | Ga0495663_0023367_1332_1760 | 135 |
| 263 | 3300046528 | Ga0495642_0169940 | Ga0495642_0169940_93_518 | 135 |
| 264 | 3300046537 | Ga0495598_0007728 | Ga0495598_0007728_191_619 | 135 |
| 265 | 3300046538 | Ga0495609_0034840 | Ga0495609_0034840_737_1165 | 135 |
| 266 | 3300046539 | Ga0495621_0100819 | Ga0495621_0100819_594_1073 | 135 |
| 267 | 3300046539 | Ga0495621_0111077 | Ga0495621_0111077_87_515 | 135 |
| 268 | 3300046557 | Ga0495622_0010974 | Ga0495622_0010974_381_806 | 135 |
| 269 | 3300046558 | Ga0495633_0125417 | Ga0495633_0125417_408_836 | 135 |
| 270 | 3300046664 | Ga0495659_0107867 | Ga0495659_0107867_46_474 | 135 |
| 271 | 3300046683 | Ga0495658_0920191 | Ga0495658_0920191_66_515 | 135 |
| 272 | 3300046690 | Ga0495624_0105993 | Ga0495624_0105993_522_950 | 135 |
| 273 | 3300046690 | Ga0495624_0256141 | Ga0495624_0256141_597_1022 | 135 |
| 274 | 3300046691 | Ga0495670_0125293 | Ga0495670_0125293_72_500 | 135 |
| 275 | 3300046691 | Ga0495670_0708540 | Ga0495670_0708540_101_529 | 135 |
| 276 | 3300046694 | Ga0495649_0104464 | Ga0495649_0104464_960_1385 | 135 |
| 277 | 3300046794 | Ga0495589_0084375 | Ga0495589_0084375_666_1091 | 135 |
| 278 | 3300047320 | Ga0495672_0029182 | Ga0495672_0029182_1186_1611 | 135 |
| 279 | 3300047321 | Ga0495676_0132325 | Ga0495676_0132325_488_916 | 135 |
| 280 | 3300047445 | Ga0495677_0021142 | Ga0495677_0021142_902_1330 | 135 |
| 281 | 3300048091 | Ga0495626_0114981 | Ga0495626_0114981_611_1036 | 135 |
| 282 | 3300049571 | Ga0501034_0595746 | Ga0501034_0595746_33_461 | 135 |
| 283 | 3300049576 | Ga0501040_1334136 | Ga0501040_1334136_51_479 | 135 |
| 284 | 3300049581 | Ga0501047_0128236 | Ga0501047_0128236_837_1268 | 135 |
| 285 | 3300049779 | Ga0501283_081036 | Ga0501283_081036_113_541 | 135 |
| 286 | 3300050507 | nmdc:mga05p37_1721450_c1 | nmdc:mga05p37_1721450_c1_61_579 | 135 |
| 287 | 3300050508 | nmdc:mga09592_155092_c1 | nmdc:mga09592_155092_c1_1054_1533 | 135 |
| 288 | 3300050508 | nmdc:mga09592_251377_c1 | nmdc:mga09592_251377_c1_476_904 | 135 |
| 289 | 3300050510 | nmdc:mga06r32_71087_c1 | nmdc:mga06r32_71087_c1_2680_3108 | 135 |
| 290 | 3300050510 | nmdc:mga06r32_88897_c1 | nmdc:mga06r32_88897_c1_2556_2984 | 135 |
| 291 | 3300050511 | nmdc:mga08y16_138339_c1 | nmdc:mga08y16_138339_c1_1777_2208 | 135 |
| 292 | 3300050511 | nmdc:mga08y16_2581_c1 | nmdc:mga08y16_2581_c1_2520_2948 | 135 |
| 293 | 3300050511 | nmdc:mga08y16_280677_c1 | nmdc:mga08y16_280677_c1_126_554 | 135 |
| 294 | 3300050511 | nmdc:mga08y16_390725_c1 | nmdc:mga08y16_390725_c1_493_942 | 135 |
| 295 | 3300050512 | nmdc:mga0n895_136554_c1 | nmdc:mga0n895_136554_c1_1932_2360 | 135 |
| 296 | 3300050512 | nmdc:mga0n895_487610_c1 | nmdc:mga0n895_487610_c1_692_1135 | 135 |
| 297 | 3300050512 | nmdc:mga0n895_49930_c1 | nmdc:mga0n895_49930_c1_478_906 | 135 |
| 298 | 3300050512 | nmdc:mga0n895_56595_c1 | nmdc:mga0n895_56595_c1_667_1095 | 135 |
| 299 | 3300050512 | nmdc:mga0n895_675494_c1 | nmdc:mga0n895_675494_c1_86_517 | 135 |
| 300 | 3300050512 | nmdc:mga0n895_997938_c1 | nmdc:mga0n895_997938_c1_157_585 | 135 |
| 301 | 3300050513 | nmdc:mga0rr50_43004_c1 | nmdc:mga0rr50_43004_c1_1047_1475 | 135 |
| 302 | 3300050513 | nmdc:mga0rr50_46189_c1 | nmdc:mga0rr50_46189_c1_388_816 | 135 |
| 303 | 3300050513 | nmdc:mga0rr50_72971_c1 | nmdc:mga0rr50_72971_c1_2067_2510 | 135 |
| 304 | 3300050514 | nmdc:mga08x19_183293_c1 | nmdc:mga08x19_183293_c1_924_1352 | 135 |
| 305 | 3300050514 | nmdc:mga08x19_48_c1 | nmdc:mga08x19_48_c1_83254_83739 | 135 |
| 306 | 3300050514 | nmdc:mga08x19_65414_c1 | nmdc:mga08x19_65414_c1_1176_1604 | 135 |
| 307 | 3300050514 | nmdc:mga08x19_88852_c1 | nmdc:mga08x19_88852_c1_1474_1902 | 135 |
| 308 | 3300050515 | nmdc:mga0a205_26342_c1 | nmdc:mga0a205_26342_c1_3425_3853 | 135 |
| 309 | 3300050515 | nmdc:mga0a205_718405_c1 | nmdc:mga0a205_718405_c1_11_439 | 135 |
| 310 | 3300050515 | nmdc:mga0a205_75254_c1 | nmdc:mga0a205_75254_c1_1613_2056 | 135 |
| 311 | 3300050515 | nmdc:mga0a205_80703_c1 | nmdc:mga0a205_80703_c1_367_810 | 135 |
| 312 | 3300053080 | Ga0500635_0045680 | Ga0500635_0045680_792_1217 | 135 |
| 313 | 3300053104 | Ga0500556_0029813 | Ga0500556_0029813_199_627 | 135 |
| 314 | 3300053178 | Ga0500637_0061091 | Ga0500637_0061091_18_443 | 135 |
| 315 | 3300061734 | Ga0530510_0054690 | Ga0530510_0054690_1803_2231 | 135 |
| 316 | 2162886011 | MRS1b_contig_2669138 | MRS1b_0030.00001180 | 136 |
| 317 | 3300005289 | Ga0065704_10643246 | Ga0065704_106432461 | 136 |
| 318 | 3300005289 | Ga0065704_10752521 | Ga0065704_107525211 | 136 |
| 319 | 3300005290 | Ga0065712_10000393 | Ga0065712_1000039310 | 136 |
| 320 | 3300005290 | Ga0065712_10069663 | Ga0065712_100696635 | 136 |
| 321 | 3300005290 | Ga0065712_10350542 | Ga0065712_103505421 | 136 |
| 322 | 3300005293 | Ga0065715_10131732 | Ga0065715_101317321 | 136 |
| 323 | 3300005295 | Ga0065707_10091743 | Ga0065707_100917435 | 136 |
| 324 | 3300005295 | Ga0065707_10227114 | Ga0065707_102271142 | 136 |
| 325 | 3300005328 | Ga0070676_10185212 | Ga0070676_101852122 | 136 |
| 326 | 3300005331 | Ga0070670_100011332 | Ga0070670_1000113325 | 136 |
| 327 | 3300005331 | Ga0070670_100015247 | Ga0070670_1000152476 | 136 |
| 328 | 3300005331 | Ga0070670_100353777 | Ga0070670_1003537771 | 136 |
| 329 | 3300005334 | Ga0068869_100018070 | Ga0068869_1000180707 | 136 |
| 330 | 3300005334 | Ga0068869_100041017 | Ga0068869_1000410172 | 136 |
| 331 | 3300005338 | Ga0068868_100191305 | Ga0068868_1001913052 | 136 |
| 332 | 3300005340 | Ga0070689_100013704 | Ga0070689_1000137042 | 136 |
| 333 | 3300005340 | Ga0070689_100103172 | Ga0070689_1001031722 | 136 |
| 334 | 3300005343 | Ga0070687_100096694 | Ga0070687_1000966942 | 136 |
| 335 | 3300005343 | Ga0070687_100553224 | Ga0070687_1005532242 | 136 |
| 336 | 3300005345 | Ga0070692_10289215 | Ga0070692_102892151 | 136 |
| 337 | 3300005347 | Ga0070668_100067980 | Ga0070668_1000679801 | 136 |
| 338 | 3300005353 | Ga0070669_100002549 | Ga0070669_1000025496 | 136 |
| 339 | 3300005353 | Ga0070669_100734582 | Ga0070669_1007345821 | 136 |
| 340 | 3300005354 | Ga0070675_100004810 | Ga0070675_1000048105 | 136 |
| 341 | 3300005354 | Ga0070675_100027677 | Ga0070675_1000276775 | 136 |
| 342 | 3300005355 | Ga0070671_100488345 | Ga0070671_1004883451 | 136 |
| 343 | 3300005356 | Ga0070674_100086087 | Ga0070674_1000860871 | 136 |
| 344 | 3300005364 | Ga0070673_100003572 | Ga0070673_1000035725 | 136 |
| 345 | 3300005364 | Ga0070673_100029120 | Ga0070673_1000291203 | 136 |
| 346 | 3300005364 | Ga0070673_100051833 | Ga0070673_1000518332 | 136 |
| 347 | 3300005365 | Ga0070688_100007036 | Ga0070688_1000070363 | 136 |
| 348 | 3300005365 | Ga0070688_100016843 | Ga0070688_1000168433 | 136 |
| 349 | 3300005365 | Ga0070688_100027353 | Ga0070688_1000273532 | 136 |
| 350 | 3300005365 | Ga0070688_100881809 | Ga0070688_1008818092 | 136 |
| 351 | 3300005438 | Ga0070701_10339171 | Ga0070701_103391712 | 136 |
| 352 | 3300005438 | Ga0070701_10511211 | Ga0070701_105112111 | 136 |
| 353 | 3300005441 | Ga0070700_100037548 | Ga0070700_1000375482 | 136 |
| 354 | 3300005441 | Ga0070700_100394143 | Ga0070700_1003941432 | 136 |
| 355 | 3300005445 | Ga0070708_101095099 | Ga0070708_1010950992 | 136 |
| 356 | 3300005456 | Ga0070678_100465307 | Ga0070678_1004653071 | 136 |
| 357 | 3300005457 | Ga0070662_100146896 | Ga0070662_1001468962 | 136 |
| 358 | 3300005459 | Ga0068867_100020227 | Ga0068867_1000202275 | 136 |
| 359 | 3300005459 | Ga0068867_100362164 | Ga0068867_1003621642 | 136 |
| 360 | 3300005459 | Ga0068867_100650848 | Ga0068867_1006508482 | 136 |
| 361 | 3300005466 | Ga0070685_10003193 | Ga0070685_100031933 | 136 |
| 362 | 3300005466 | Ga0070685_10082608 | Ga0070685_100826082 | 136 |
| 363 | 3300005471 | Ga0070698_100001684 | Ga0070698_1000016849 | 136 |
| 364 | 3300005471 | Ga0070698_100084673 | Ga0070698_1000846734 | 136 |
| 365 | 3300005543 | Ga0070672_100066056 | Ga0070672_1000660565 | 136 |
| 366 | 3300005544 | Ga0070686_100265254 | Ga0070686_1002652542 | 136 |
| 367 | 3300005549 | Ga0070704_101534686 | Ga0070704_1015346861 | 136 |
| 368 | 3300005564 | Ga0070664_100169021 | Ga0070664_1001690212 | 136 |
| 369 | 3300005577 | Ga0068857_100007129 | Ga0068857_1000071295 | 136 |
| 370 | 3300005578 | Ga0068854_100013145 | Ga0068854_1000131455 | 136 |
| 371 | 3300005615 | Ga0070702_100341139 | Ga0070702_1003411391 | 136 |
| 372 | 3300005615 | Ga0070702_101118922 | Ga0070702_1011189221 | 136 |
| 373 | 3300005616 | Ga0068852_101483910 | Ga0068852_1014839102 | 136 |
| 374 | 3300005617 | Ga0068859_100028460 | Ga0068859_1000284605 | 136 |
| 375 | 3300005617 | Ga0068859_100090425 | Ga0068859_1000904252 | 136 |
| 376 | 3300005617 | Ga0068859_100704260 | Ga0068859_1007042601 | 136 |
| 377 | 3300005618 | Ga0068864_100082789 | Ga0068864_1000827891 | 136 |
| 378 | 3300005618 | Ga0068864_100798058 | Ga0068864_1007980581 | 136 |
| 379 | 3300005841 | Ga0068863_100006326 | Ga0068863_1000063268 | 136 |
| 380 | 3300005841 | Ga0068863_100098238 | Ga0068863_1000982382 | 136 |
| 381 | 3300005841 | Ga0068863_100507834 | Ga0068863_1005078341 | 136 |
| 382 | 3300005843 | Ga0068860_100927276 | Ga0068860_1009272762 | 136 |
| 383 | 3300005844 | Ga0068862_100001278 | Ga0068862_10000127812 | 136 |
| 384 | 3300005844 | Ga0068862_100336309 | Ga0068862_1003363091 | 136 |
| 385 | 3300005844 | Ga0068862_100817665 | Ga0068862_1008176652 | 136 |
| 386 | 3300006058 | Ga0075432_10113442 | Ga0075432_101134422 | 136 |
| 387 | 3300006237 | Ga0097621_100011962 | Ga0097621_1000119626 | 136 |
| 388 | 3300006358 | Ga0068871_100089073 | Ga0068871_1000890732 | 136 |
| 389 | 3300006844 | Ga0075428_100027284 | Ga0075428_1000272849 | 136 |
| 390 | 3300006844 | Ga0075428_100064508 | Ga0075428_1000645081 | 136 |
| 391 | 3300006844 | Ga0075428_100790913 | Ga0075428_1007909132 | 136 |
| 392 | 3300006880 | Ga0075429_100051926 | Ga0075429_1000519264 | 136 |
| 393 | 3300006880 | Ga0075429_100326913 | Ga0075429_1003269132 | 136 |
| 394 | 3300006880 | Ga0075429_100396673 | Ga0075429_1003966732 | 136 |
| 395 | 3300006881 | Ga0068865_100079019 | Ga0068865_1000790192 | 136 |
| 396 | 3300006931 | Ga0097620_100028459 | Ga0097620_1000284592 | 136 |
| 397 | 3300006931 | Ga0097620_100090425 | Ga0097620_1000904252 | 136 |
| 398 | 3300006931 | Ga0097620_100704253 | Ga0097620_1007042531 | 136 |
| 399 | 3300009094 | Ga0111539_10004662 | Ga0111539_100046629 | 136 |
| 400 | 3300009094 | Ga0111539_10244532 | Ga0111539_102445322 | 136 |
| 401 | 3300009147 | Ga0114129_10074459 | Ga0114129_100744596 | 136 |
| 402 | 3300009147 | Ga0114129_10079705 | Ga0114129_100797052 | 136 |
| 403 | 3300009174 | Ga0105241_11526261 | Ga0105241_115262611 | 136 |
| 404 | 3300009176 | Ga0105242_10001165 | Ga0105242_1000116515 | 136 |
| 405 | 3300009176 | Ga0105242_10177865 | Ga0105242_101778653 | 136 |
| 406 | 3300009176 | Ga0105242_10227866 | Ga0105242_102278662 | 136 |
| 407 | 3300009177 | Ga0105248_10343478 | Ga0105248_103434783 | 136 |
| 408 | 3300009553 | Ga0105249_10002749 | Ga0105249_1000274912 | 136 |
| 409 | 3300009553 | Ga0105249_10020855 | Ga0105249_100208556 | 136 |
| 410 | 3300009553 | Ga0105249_10085379 | Ga0105249_100853793 | 136 |
| 411 | 3300009553 | Ga0105249_10467527 | Ga0105249_104675272 | 136 |
| 412 | 3300009553 | Ga0105249_11710068 | Ga0105249_117100681 | 136 |
| 413 | 3300009553 | Ga0105249_12615776 | Ga0105249_126157762 | 136 |
| 414 | 3300011119 | Ga0105246_10222218 | Ga0105246_102222182 | 136 |
| 415 | 3300013296 | Ga0157374_10610979 | Ga0157374_106109791 | 136 |
| 416 | 3300013306 | Ga0163162_10043360 | Ga0163162_100433606 | 136 |
| 417 | 3300013306 | Ga0163162_10052834 | Ga0163162_100528342 | 136 |
| 418 | 3300013306 | Ga0163162_10164252 | Ga0163162_101642523 | 136 |
| 419 | 3300013308 | Ga0157375_10020946 | Ga0157375_100209466 | 136 |
| 420 | 3300013308 | Ga0157375_10135361 | Ga0157375_101353614 | 136 |
| 421 | 3300013308 | Ga0157375_10234186 | Ga0157375_102341861 | 136 |
| 422 | 3300014325 | Ga0163163_10226857 | Ga0163163_102268573 | 136 |
| 423 | 3300014325 | Ga0163163_10840723 | Ga0163163_108407231 | 136 |
| 424 | 3300014326 | Ga0157380_10005493 | Ga0157380_100054935 | 136 |
| 425 | 3300014326 | Ga0157380_10017785 | Ga0157380_100177853 | 136 |
| 426 | 3300014326 | Ga0157380_10776908 | Ga0157380_107769082 | 136 |
| 427 | 3300014745 | Ga0157377_10000659 | Ga0157377_100006597 | 136 |
| 428 | 3300014745 | Ga0157377_10145595 | Ga0157377_101455952 | 136 |
| 429 | 3300014745 | Ga0157377_10492566 | Ga0157377_104925662 | 136 |
| 430 | 3300014968 | Ga0157379_10185046 | Ga0157379_101850463 | 136 |
| 431 | 3300014969 | Ga0157376_10131389 | Ga0157376_101313892 | 136 |
| 432 | 3300014969 | Ga0157376_12258342 | Ga0157376_122583421 | 136 |
| 433 | 3300017792 | Ga0163161_10015165 | Ga0163161_100151652 | 136 |
| 434 | 3300017792 | Ga0163161_10743936 | Ga0163161_107439361 | 136 |
| 435 | 3300025271 | Ga0207666_1041706 | Ga0207666_10417061 | 136 |
| 436 | 3300025315 | Ga0207697_10065061 | Ga0207697_100650612 | 136 |
| 437 | 3300025893 | Ga0207682_10009872 | Ga0207682_100098722 | 136 |
| 438 | 3300025899 | Ga0207642_10526589 | Ga0207642_105265891 | 136 |
| 439 | 3300025908 | Ga0207643_10004365 | Ga0207643_100043659 | 136 |
| 440 | 3300025908 | Ga0207643_10266344 | Ga0207643_102663442 | 136 |
| 441 | 3300025910 | Ga0207684_10301350 | Ga0207684_103013502 | 136 |
| 442 | 3300025918 | Ga0207662_10119839 | Ga0207662_101198392 | 136 |
| 443 | 3300025918 | Ga0207662_10815578 | Ga0207662_108155782 | 136 |
| 444 | 3300025923 | Ga0207681_10028135 | Ga0207681_100281352 | 136 |
| 445 | 3300025923 | Ga0207681_10075399 | Ga0207681_100753992 | 136 |
| 446 | 3300025925 | Ga0207650_10192205 | Ga0207650_101922052 | 136 |
| 447 | 3300025925 | Ga0207650_10391284 | Ga0207650_103912842 | 136 |
| 448 | 3300025925 | Ga0207650_11221329 | Ga0207650_112213291 | 136 |
| 449 | 3300025926 | Ga0207659_10030626 | Ga0207659_100306266 | 136 |
| 450 | 3300025926 | Ga0207659_10221620 | Ga0207659_102216202 | 136 |
| 451 | 3300025933 | Ga0207706_10036362 | Ga0207706_100363622 | 136 |
| 452 | 3300025934 | Ga0207686_10000498 | Ga0207686_100004989 | 136 |
| 453 | 3300025934 | Ga0207686_10032968 | Ga0207686_100329683 | 136 |
| 454 | 3300025936 | Ga0207670_10042309 | Ga0207670_100423093 | 136 |
| 455 | 3300025938 | Ga0207704_10225253 | Ga0207704_102252531 | 136 |
| 456 | 3300025938 | Ga0207704_11848203 | Ga0207704_118482031 | 136 |
| 457 | 3300025940 | Ga0207691_10014404 | Ga0207691_100144045 | 136 |
| 458 | 3300025940 | Ga0207691_10183619 | Ga0207691_101836191 | 136 |
| 459 | 3300025941 | Ga0207711_10412216 | Ga0207711_104122162 | 136 |
| 460 | 3300025942 | Ga0207689_10045161 | Ga0207689_100451612 | 136 |
| 461 | 3300025942 | Ga0207689_10053634 | Ga0207689_100536343 | 136 |
| 462 | 3300025960 | Ga0207651_10006411 | Ga0207651_100064111 | 136 |
| 463 | 3300025960 | Ga0207651_10020926 | Ga0207651_100209261 | 136 |
| 464 | 3300025960 | Ga0207651_10051114 | Ga0207651_100511144 | 136 |
| 465 | 3300025960 | Ga0207651_10058501 | Ga0207651_100585012 | 136 |
| 466 | 3300025961 | Ga0207712_10001312 | Ga0207712_100013127 | 136 |
| 467 | 3300025961 | Ga0207712_10001935 | Ga0207712_1000193511 | 136 |
| 468 | 3300025961 | Ga0207712_10513107 | Ga0207712_105131072 | 136 |
| 469 | 3300025972 | Ga0207668_10028706 | Ga0207668_100287065 | 136 |
| 470 | 3300025981 | Ga0207640_10024352 | Ga0207640_100243524 | 136 |
| 471 | 3300025981 | Ga0207640_10177516 | Ga0207640_101775163 | 136 |
| 472 | 3300025986 | Ga0207658_10554696 | Ga0207658_105546961 | 136 |
| 473 | 3300026035 | Ga0207703_10461384 | Ga0207703_104613842 | 136 |
| 474 | 3300026075 | Ga0207708_10304159 | Ga0207708_103041592 | 136 |
| 475 | 3300026075 | Ga0207708_10408855 | Ga0207708_104088552 | 136 |
| 476 | 3300026088 | Ga0207641_10000467 | Ga0207641_1000046712 | 136 |
| 477 | 3300026088 | Ga0207641_10086236 | Ga0207641_100862363 | 136 |
| 478 | 3300026089 | Ga0207648_10031304 | Ga0207648_100313042 | 136 |
| 479 | 3300026089 | Ga0207648_10407968 | Ga0207648_104079682 | 136 |
| 480 | 3300026095 | Ga0207676_10176165 | Ga0207676_101761652 | 136 |
| 481 | 3300026095 | Ga0207676_10524107 | Ga0207676_105241071 | 136 |
| 482 | 3300026116 | Ga0207674_10003180 | Ga0207674_1000318018 | 136 |
| 483 | 3300026118 | Ga0207675_100000299 | Ga0207675_10000029911 | 136 |
| 484 | 3300026118 | Ga0207675_101028266 | Ga0207675_1010282662 | 136 |
| 485 | 3300026121 | Ga0207683_10155017 | Ga0207683_101550173 | 136 |
| 486 | 3300027907 | Ga0207428_10135883 | Ga0207428_101358832 | 136 |
| 487 | 3300028380 | Ga0268265_10028813 | Ga0268265_100288132 | 136 |
| 488 | 3300028380 | Ga0268265_10228365 | Ga0268265_102283652 | 136 |
| 489 | 3300028380 | Ga0268265_11278350 | Ga0268265_112783502 | 136 |
| 490 | 3300028380 | Ga0268265_11409966 | Ga0268265_114099662 | 136 |
| 491 | 3300028381 | Ga0268264_10282397 | Ga0268264_102823973 | 136 |
| 492 | 3300032004 | Ga0307414_10052480 | Ga0307414_100524802 | 136 |
| 493 | 3300035119 | Ga0373956_0251129 | Ga0373956_0251129_265_714 | 136 |
| 494 | 3300036401 | Ga0373937_0097898 | Ga0373937_0097898_30_479 | 136 |
| 495 | 3300041459 | Ga0451800_0818037 | Ga0451800_0818037_139_549 | 136 |
| 496 | 3300041509 | Ga0451843_0781955 | Ga0451843_0781955_1625_2035 | 136 |
| 497 | 3300042004 | Ga0439445_0016842 | Ga0439445_0016842_292_702 | 136 |
| 498 | 3300042004 | Ga0439445_0082450 | Ga0439445_0082450_350_760 | 136 |
| 499 | 3300044673 | Ga0453683_1169307 | Ga0453683_1169307_33_482 | 136 |
| 500 | 3300044712 | Ga0453684_0825487 | Ga0453684_0825487_185_661 | 136 |
| 501 | 3300046453 | Ga0495627_001593 | Ga0495627_001593_7579_7989 | 136 |
| 502 | 3300046499 | Ga0495594_0520702 | Ga0495594_0520702_43_495 | 136 |
| 503 | 3300046528 | Ga0495642_0338774 | Ga0495642_0338774_117_566 | 136 |
| 504 | 3300046537 | Ga0495598_0069337 | Ga0495598_0069337_348_800 | 136 |
| 505 | 3300046539 | Ga0495621_0004188 | Ga0495621_0004188_429_881 | 136 |
| 506 | 3300046539 | Ga0495621_0065617 | Ga0495621_0065617_864_1313 | 136 |
| 507 | 3300046558 | Ga0495633_0000036 | Ga0495633_0000036_2044_2454 | 136 |
| 508 | 3300047320 | Ga0495672_0035861 | Ga0495672_0035861_1242_1652 | 136 |
| 509 | 3300049568 | Ga0501031_0600678 | Ga0501031_0600678_204_614 | 136 |
| 510 | 3300049569 | Ga0501032_0004687 | Ga0501032_0004687_628_1038 | 136 |
| 511 | 3300049569 | Ga0501032_0027679 | Ga0501032_0027679_2882_3340 | 136 |
| 512 | 3300049571 | Ga0501034_0029202 | Ga0501034_0029202_2162_2572 | 136 |
| 513 | 3300049571 | Ga0501034_0094207 | Ga0501034_0094207_1206_1616 | 136 |
| 514 | 3300049571 | Ga0501034_1039295 | Ga0501034_1039295_237_674 | 136 |
| 515 | 3300049572 | Ga0501036_0003416 | Ga0501036_0003416_3267_3677 | 136 |
| 516 | 3300049572 | Ga0501036_0014802 | Ga0501036_0014802_5361_5771 | 136 |
| 517 | 3300049573 | Ga0501037_0017762 | Ga0501037_0017762_4335_4745 | 136 |
| 518 | 3300049573 | Ga0501037_0148621 | Ga0501037_0148621_42_500 | 136 |
| 519 | 3300049574 | Ga0501038_0010673 | Ga0501038_0010673_2446_2904 | 136 |
| 520 | 3300049574 | Ga0501038_0035197 | Ga0501038_0035197_2271_2681 | 136 |
| 521 | 3300049575 | Ga0501039_0016906 | Ga0501039_0016906_4971_5381 | 136 |
| 522 | 3300049575 | Ga0501039_0183254 | Ga0501039_0183254_1030_1440 | 136 |
| 523 | 3300049579 | Ga0501043_0020417 | Ga0501043_0020417_4009_4419 | 136 |
| 524 | 3300049579 | Ga0501043_0130860 | Ga0501043_0130860_614_1024 | 136 |
| 525 | 3300049580 | Ga0501046_0003510 | Ga0501046_0003510_6368_6778 | 136 |
| 526 | 3300049580 | Ga0501046_0036206 | Ga0501046_0036206_2576_3034 | 136 |
| 527 | 3300049581 | Ga0501047_0055611 | Ga0501047_0055611_2749_3159 | 136 |
| 528 | 3300049581 | Ga0501047_0875236 | Ga0501047_0875236_25_435 | 136 |
| 529 | 3300049582 | Ga0501048_0035118 | Ga0501048_0035118_627_1037 | 136 |
| 530 | 3300049583 | Ga0501067_0191508 | Ga0501067_0191508_568_978 | 136 |
| 531 | 3300049584 | Ga0501068_0035423 | Ga0501068_0035423_2541_2951 | 136 |
| 532 | 3300049586 | Ga0501070_0012717 | Ga0501070_0012717_1376_1786 | 136 |
| 533 | 3300049589 | Ga0501073_0329772 | Ga0501073_0329772_601_1011 | 136 |
| 534 | 3300049590 | Ga0501074_0003003 | Ga0501074_0003003_9508_9918 | 136 |
| 535 | 3300049741 | Ga0501079_0133957 | Ga0501079_0133957_1386_1796 | 136 |
| 536 | 3300049744 | Ga0501083_0001228 | Ga0501083_0001228_10304_10714 | 136 |
| 537 | 3300049822 | Ga0501035_0009147 | Ga0501035_0009147_8503_8913 | 136 |
| 538 | 3300049822 | Ga0501035_0117132 | Ga0501035_0117132_108_566 | 136 |
| 539 | 3300049823 | Ga0501044_0008422 | Ga0501044_0008422_1845_2255 | 136 |
| 540 | 3300049823 | Ga0501044_0200688 | Ga0501044_0200688_299_736 | 136 |
| 541 | 3300049823 | Ga0501044_0232454 | Ga0501044_0232454_998_1408 | 136 |
| 542 | 3300050507 | nmdc:mga05p37_1010560_c1 | nmdc:mga05p37_1010560_c1_220_714 | 136 |
| 543 | 3300050507 | nmdc:mga05p37_214160_c1 | nmdc:mga05p37_214160_c1_707_1243 | 136 |
| 544 | 3300050508 | nmdc:mga09592_50342_c1 | nmdc:mga09592_50342_c1_1362_1898 | 136 |
| 545 | 3300050508 | nmdc:mga09592_594457_c1 | nmdc:mga09592_594457_c1_505_915 | 136 |
| 546 | 3300050508 | nmdc:mga09592_856821_c1 | nmdc:mga09592_856821_c1_205_651 | 136 |
| 547 | 3300050508 | nmdc:mga09592_88102_c1 | nmdc:mga09592_88102_c1_2010_2456 | 136 |
| 548 | 3300050509 | nmdc:mga0qj67_21761_c1 | nmdc:mga0qj67_21761_c1_1694_2230 | 136 |
| 549 | 3300050510 | nmdc:mga06r32_44707_c1 | nmdc:mga06r32_44707_c1_3546_4082 | 136 |
| 550 | 3300050511 | nmdc:mga08y16_31684_c1 | nmdc:mga08y16_31684_c1_3514_3924 | 136 |
| 551 | 3300053093 | Ga0500651_0025852 | Ga0500651_0025852_155_565 | 136 |
| 552 | 3300053096 | Ga0500641_0142595 | Ga0500641_0142595_432_842 | 136 |
| 553 | 3300053139 | Ga0500568_0004673 | Ga0500568_0004673_507_917 | 136 |
| 554 | 3300053153 | Ga0500616_0406727 | Ga0500616_0406727_97_507 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9802 | 1 | 136 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.9736 | 1 | 135 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9732 | 1 | 136 |
| 1nye-assembly2.cif.gz_D | crystal structure of osmc from e. coli | 0.9663 | 1 | 135 |
| 1nye-assembly2.cif.gz_C | crystal structure of osmc from e. coli | 0.9656 | 1 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.958 | 1 | 135 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9445 | 1 | 135 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9254 | 6 | 136 | 3.30.300.20 |
| af_Q55EI4_11_156_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9173 | 4 | 136 | 3.30.300.20 |
| 1ml8A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9064 | 45 | 136 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258Y8I4-F1-model_v4 | OsmC family peroxiredoxin | 1.003 | 51 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A2W5FXT9-F1-model_v4 | OsmC family peroxiredoxin | 1.001 | 44 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A257KYW8-F1-model_v4 | OsmC family peroxiredoxin | 0.9994 | 42 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A522GH03-F1-model_v4 | OsmC family peroxiredoxin | 0.9969 | 41 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A4P5TX77-F1-model_v4 | Peroxiredoxin | 0.9967 | 1 | 136 |
GO:0004601
GO:0006979 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar