F463064

General Info

Members Datasets Scaffolds Average Seq Length
555 253 419 324

Family's Representative Sequence

Representative Sequence 3300003856|Ga0058692_1000624|Ga0058692_10006242
Length 333
Sequence MIERIWSGRSPLWLLLWPLSLLYGAITWLIRLSYQRGWRTRWRAPCPVIVVGNLTAGGNGKTPLVIWLVQALQQQGLRPGVVSRGYGGKAERYPLLVNQDSATEQAGDEPVLIAQRTQVPVAVAPQRRLAIEALLAAHPLDVIVTDDGLQHYALERDREIVVVDGVRRFGNGWWLPAGPMRERASRLEQVDAVVVNGGSAQAGEIAMTLQPGLAVNLLTGEQAALTQLPPIVAMAGIGHPPRFFTTLQQQGVQPVAEIAFADHHAYSEEELRSLTQDAQCLLMTEKDAVKCRHFARANWWYLPVDAHLAGAPLAALLADLTQLCTAARDARSR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
3 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
4 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
5 2547132181 Kosakonia sacchari SP1 Isolate Stem
6 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
7 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
8 2561511199 Enterobacter sp. R4-368 Isolate Nodule
9 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
10 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
11 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
12 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
13 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
14 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
15 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
16 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
17 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
18 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
19 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
20 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
21 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
22 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
23 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
24 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
25 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
26 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
27 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
28 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
29 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
30 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
31 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
32 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
33 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
34 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
35 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
36 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
37 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
38 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
39 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
40 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
41 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
42 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
43 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
44 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
45 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
46 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
47 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
48 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
49 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
50 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
51 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
52 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
53 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
54 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
55 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
56 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
57 2636415599 Klebsiella variicola DX120E Isolate Unclassified
58 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
59 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
60 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
61 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
62 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
63 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
64 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
65 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
66 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
67 2751185917 Enterobacter sp. HK169 Isolate Unclassified
68 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
69 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
70 2775507074 Klebsiella sp. D5A Isolate Unclassified
71 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
72 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
73 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
74 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
75 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
76 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
77 2821118458 Enterobacter asburiae 609 Isolate Unclassified
78 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
79 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
80 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
81 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
82 2847085930 Erwinia persicina B64 Isolate Bulb
83 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
84 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
85 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
86 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
87 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
88 2865014394 Pantoea sp. R-71966 Isolate Unclassified
89 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
90 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
91 2876601092 Pantoea endophytica 596 Isolate Unclassified
92 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
93 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
94 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
95 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
96 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
97 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
98 2904504865 Serratia marcescens 1822 Isolate Unclassified
99 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
100 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
101 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
102 2919150387 Rahnella aceris 1817 Isolate Unclassified
103 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
104 2927143783 Rahnella sp. 2050 Isolate Unclassified
105 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
106 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
107 2937539931 Pantoea sp. LS15 Isolate Unclassified
108 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
109 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
110 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
111 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
112 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
113 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
114 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
115 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
116 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
117 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
118 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
119 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
120 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
121 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
122 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
123 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
124 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
125 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
126 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
127 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
128 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
129 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
130 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
131 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
132 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
133 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
134 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
135 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
136 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
137 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
138 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
139 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
140 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
141 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
142 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
143 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
153 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
154 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
155 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
156 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
167 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
175 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
180 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
186 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
187 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
239 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
242 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
243 8018221730 Enterobacter sp. CM29 Isolate Unclassified
244 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
245 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
246 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
247 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
248 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
249 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
250 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
251 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
252 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
253 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.5
Metatranscriptomes 0
Isolates 24.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0.18
Endosphere 5.05
Nodule 3.6
Rhizoplane 12.25
Rhizosphere 46.85
Stem 0.18
Stem Tuber 1.08
Unclassified 30.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1623572 2162886007 Bacteria 3958
2 JGI25162J39368_1000035 3300002737 Bacteria 180993
3 JGI25162J39368_1003630 3300002737 Bacteria 4251
4 JGI25163J39215_1000086 3300002771 Bacteria 39925
5 JGI25164J39214_1000019 3300002772 Bacteria 180993
6 Ga0055538_1000039 3300003751 Bacteria 180993
7 Ga0055539_1000050 3300003752 Bacteria 180993
8 Ga0055533_1000062 3300003756 Bacteria 180993
9 Ga0055525_1000072 3300003759 Bacteria 180993
10 Ga0055541_1000038 3300003841 Bacteria 180993
11 Ga0058692_1000325 3300003856 Bacteria 23621
12 Ga0058692_1000343 3300003856 Bacteria 22754
13 Ga0058692_1000624 3300003856 Bacteria 14661
14 Ga0058692_1000877 3300003856 Bacteria 11820
15 Ga0058692_1001394 3300003856 Bacteria 8935
16 Ga0058692_1002130 3300003856 Bacteria 6828
17 Ga0058692_1002141 3300003856 Bacteria 6793
18 Ga0058692_1002748 3300003856 Bacteria 5786
19 Ga0058692_1004889 3300003856 Bacteria 3896
20 Ga0058692_1004890 3300003856 Bacteria 3896
21 Ga0058692_1008201 3300003856 Bacteria 2705
22 Ga0065704_10000532 3300005289 Bacteria 25473
23 Ga0065704_10000557 3300005289 Bacteria 36666
24 Ga0065704_10001424 3300005289 Bacteria 8170
25 Ga0065704_10005301 3300005289 Bacteria 5218
26 Ga0070659_100011704 3300005366 Bacteria 6494
27 Ga0070662_100180389 3300005457 Bacteria 1664
28 Ga0070665_100000345 3300005548 Bacteria 70001
29 Ga0075364_10013931 3300006051 Bacteria 4956
30 Ga0075364_10020360 3300006051 Bacteria 4172
31 Ga0075364_10029314 3300006051 Bacteria 3529
32 Ga0075364_10052539 3300006051 Bacteria 2663
33 Ga0079104_1000035 3300006946 Bacteria 198709
34 Ga0079104_1000114 3300006946 Bacteria 115700
35 Ga0079104_1000196 3300006946 Bacteria 84941
36 Ga0079104_1000951 3300006946 Bacteria 22972
37 Ga0079104_1001118 3300006946 Bacteria 19685
38 Ga0079104_1001121 3300006946 Bacteria 19668
39 Ga0079104_1001833 3300006946 Bacteria 13025
40 Ga0079104_1002535 3300006946 Bacteria 9652
41 Ga0079104_1003633 3300006946 Bacteria 7037
42 Ga0105251_10000351 3300009011 Bacteria 45565
43 Ga0105251_10003547 3300009011 Bacteria 11266
44 Ga0105251_10004692 3300009011 Bacteria 9188
45 Ga0105251_10005127 3300009011 Bacteria 8664
46 Ga0105251_10005282 3300009011 Bacteria 8496
47 Ga0105251_10005665 3300009011 Bacteria 8111
48 Ga0105251_10007051 3300009011 Bacteria 7008
49 Ga0105251_10010854 3300009011 Bacteria 5246
50 Ga0105251_10062101 3300009011 Bacteria 1755
51 Ga0105251_10078524 3300009011 Bacteria 1529
52 Ga0105251_10119808 3300009011 Bacteria 1195
53 Ga0105244_10000034 3300009036 Bacteria 168462
54 Ga0105244_10000085 3300009036 Bacteria 102531
55 Ga0105244_10000094 3300009036 Bacteria 94550
56 Ga0105244_10002226 3300009036 Bacteria 14776
57 Ga0105244_10003814 3300009036 Bacteria 10636
58 Ga0105244_10005729 3300009036 Bacteria 8198
59 Ga0105244_10005793 3300009036 Bacteria 8133
60 Ga0105244_10006144 3300009036 Bacteria 7839
61 Ga0105244_10012549 3300009036 Bacteria 4998
62 Ga0105244_10020328 3300009036 Bacteria 3692
63 Ga0105244_10024994 3300009036 Bacteria 3252
64 Ga0105244_10042448 3300009036 Bacteria 2351
65 Ga0105244_10056550 3300009036 Bacteria 1985
66 Ga0105250_10000003 3300009092 Bacteria 547770
67 Ga0105250_10000168 3300009092 Bacteria 56841
68 Ga0105250_10000206 3300009092 Bacteria 49617
69 Ga0105250_10000360 3300009092 Bacteria 34622
70 Ga0105250_10001692 3300009092 Bacteria 11648
71 Ga0105250_10013792 3300009092 Bacteria 3329
72 Ga0105250_10016315 3300009092 Bacteria 3029
73 Ga0105243_10054597 3300009148 Bacteria 3172
74 Ga0105243_10124099 3300009148 Bacteria 2182
75 Ga0105246_10015720 3300011119 Bacteria 4783
76 Ga0157373_10001881 3300013100 Bacteria 15923
77 Ga0157373_10126574 3300013100 Bacteria 1797
78 Ga0157371_10000288 3300013102 Bacteria 68107
79 Ga0157371_10003619 3300013102 Bacteria 13911
80 Ga0157371_10009135 3300013102 Bacteria 7830
81 Ga0157371_10091391 3300013102 Bacteria 2156
82 Ga0157370_10000147 3300013104 Bacteria 86286
83 Ga0157370_10004586 3300013104 Bacteria 15814
84 Ga0157370_10030467 3300013104 Bacteria 5285
85 Ga0157369_10021301 3300013105 Bacteria 7249
86 Ga0157369_10023393 3300013105 Bacteria 6881
87 Ga0163162_10039479 3300013306 Bacteria 4718
88 Ga0163162_10225951 3300013306 Bacteria 2002
89 Ga0157372_10016181 3300013307 Bacteria 8003
90 Ga0157372_10020464 3300013307 Bacteria 7140
91 Ga0157372_10034555 3300013307 Bacteria 5559
92 Ga0157372_10061352 3300013307 Bacteria 4210
93 Ga0157372_10065256 3300013307 Bacteria 4087
94 Ga0157372_10087521 3300013307 Bacteria 3535
95 Ga0157372_10237216 3300013307 Bacteria 2115
96 Ga0182006_1000022 3300015261 Bacteria 275350
97 Ga0182006_1011538 3300015261 Bacteria 3886
98 Ga0183366_1001 3300015679 Bacteria 2743932
99 Ga0183370_1001 3300015680 Bacteria 2743932
100 Ga0183369_1001 3300015685 Bacteria 2743932
101 Ga0183368_1001 3300015687 Bacteria 2743932
102 Ga0163161_10010170 3300017792 Bacteria 6512
103 Ga0213876_10000061 3300021384 Bacteria 130591
104 Ga0209760_100002 3300025207 Bacteria 274743
105 Ga0209784_100001 3300025224 Bacteria 3600592
106 Ga0209566_100001 3300025225 Bacteria 3600765
107 Ga0209674_100002 3300025226 Bacteria 3600592
108 Ga0209563_100002 3300025230 Bacteria 2045675
109 Ga0207427_100012 3300025231 Bacteria 585657
110 Ga0209437_100001 3300025233 Bacteria 2045675
111 Ga0209437_100035 3300025233 Bacteria 481110
112 Ga0207425_1013567 3300025245 Bacteria 1879
113 Ga0209677_100002 3300025253 Bacteria 2045675
114 Ga0209129_1000018 3300025258 Bacteria 469298
115 Ga0207696_1000003 3300025711 Bacteria 860639
116 Ga0207696_1000004 3300025711 Bacteria 671626
117 Ga0207696_1000070 3300025711 Bacteria 227242
118 Ga0207696_1000077 3300025711 Bacteria 209611
119 Ga0207696_1000287 3300025711 Bacteria 59175
120 Ga0207696_1000610 3300025711 Bacteria 26676
121 Ga0207696_1006926 3300025711 Bacteria 4498
122 Ga0207696_1017821 3300025711 Bacteria 2344
123 Ga0207655_1000001 3300025728 Bacteria 1866413
124 Ga0207655_1000046 3300025728 Bacteria 309474
125 Ga0207655_1000102 3300025728 Bacteria 185859
126 Ga0207655_1000132 3300025728 Bacteria 146767
127 Ga0207655_1000155 3300025728 Bacteria 125949
128 Ga0207655_1000194 3300025728 Bacteria 107189
129 Ga0207655_1000280 3300025728 Bacteria 78923
130 Ga0207655_1005792 3300025728 Bacteria 8320
131 Ga0207655_1013040 3300025728 Bacteria 4798
132 Ga0207655_1021963 3300025728 Bacteria 3217
133 Ga0207655_1022522 3300025728 Bacteria 3155
134 Ga0207655_1025096 3300025728 Bacteria 2901
135 Ga0207655_1037177 3300025728 Bacteria 2147
136 Ga0207655_1048040 3300025728 Bacteria 1755
137 Ga0207713_1000001 3300025735 Bacteria 2295391
138 Ga0207713_1000012 3300025735 Bacteria 501860
139 Ga0207713_1000040 3300025735 Bacteria 245322
140 Ga0207713_1000346 3300025735 Bacteria 50868
141 Ga0207713_1005255 3300025735 Bacteria 8160
142 Ga0207713_1007632 3300025735 Bacteria 6337
143 Ga0207713_1013132 3300025735 Bacteria 4384
144 Ga0207713_1018003 3300025735 Bacteria 3515
145 Ga0207713_1028984 3300025735 Bacteria 2488
146 Ga0207690_10011211 3300025932 Bacteria 5352
147 Ga0207709_10037121 3300025935 Bacteria 2893
148 Ga0209281_1000001 3300027111 Bacteria 1933496
149 Ga0209281_1000114 3300027111 Bacteria 210536
150 Ga0209281_1000180 3300027111 Bacteria 147099
151 Ga0209281_1000234 3300027111 Bacteria 115401
152 Ga0209281_1000525 3300027111 Bacteria 49178
153 Ga0209281_1000535 3300027111 Bacteria 48029
154 Ga0209281_1000690 3300027111 Bacteria 34682
155 Ga0209281_1000967 3300027111 Bacteria 23113
156 Ga0209281_1001023 3300027111 Bacteria 21591
157 Ga0209281_1004281 3300027111 Bacteria 4325
158 Ga0209371_1000001 3300027312 Bacteria 2771503
159 Ga0209371_1000010 3300027312 Bacteria 922021
160 Ga0209371_1000085 3300027312 Bacteria 179586
161 Ga0209371_1000086 3300027312 Bacteria 175099
162 Ga0209371_1000269 3300027312 Bacteria 60878
163 Ga0209371_1000785 3300027312 Bacteria 26235
164 Ga0209371_1000914 3300027312 Bacteria 23378
165 Ga0209371_1001171 3300027312 Bacteria 19170
166 Ga0209371_1002141 3300027312 Bacteria 11624
167 Ga0209371_1002196 3300027312 Bacteria 11370
168 Ga0209371_1002215 3300027312 Bacteria 11283
169 Ga0209371_1005372 3300027312 Bacteria 5116
170 Ga0209371_1013161 3300027312 Bacteria 2343
171 Ga0209371_1013912 3300027312 Bacteria 2231
172 Ga0209371_1022816 3300027312 Bacteria 1488
173 Ga0268266_10000100 3300028379 Bacteria 180900
174 Ga0268266_10031307 3300028379 Bacteria 4517
175 Ga0268256_1000001 3300030500 Bacteria 2771065
176 Ga0268256_1000003 3300030500 Bacteria 1289401
177 Ga0268256_1000048 3300030500 Bacteria 312298
178 Ga0268256_1000073 3300030500 Bacteria 184170
179 Ga0268256_1000092 3300030500 Bacteria 144061
180 Ga0268256_1000126 3300030500 Bacteria 109559
181 Ga0268256_1000639 3300030500 Bacteria 26788
182 Ga0268256_1001002 3300030500 Bacteria 19170
183 Ga0268256_1001526 3300030500 Bacteria 13687
184 Ga0268256_1001951 3300030500 Bacteria 11283
185 Ga0268256_1003750 3300030500 Bacteria 6670
186 Ga0268256_1003951 3300030500 Bacteria 6395
187 Ga0268256_1010532 3300030500 Bacteria 2989
188 Ga0268256_1015413 3300030500 Bacteria 2231
189 Ga0268256_1021807 3300030500 Bacteria 1694
190 Ga0268256_1023492 3300030500 Bacteria 1599
191 Ga0268256_1023598 3300030500 Bacteria 1593
192 Ga0436365_1910565 3300039437 Bacteria 475219
193 Ga0439438_000001 3300041405 Bacteria 1263568
194 Ga0439438_002382 3300041405 Bacteria 8017
195 Ga0439438_010591 3300041405 Bacteria 2907
196 Ga0439438_013730 3300041405 Bacteria 2433
197 Ga0439447_003600 3300041407 Bacteria 5484
198 Ga0439447_004934 3300041407 Bacteria 4513
199 Ga0439447_009133 3300041407 Bacteria 3022
200 Ga0439466_0000003 3300041411 Bacteria 486229
201 Ga0451853_2726652 3300041512 Bacteria 4207
202 Ga0439432_000943 3300042006 Bacteria 10951
203 Ga0439432_010974 3300042006 Bacteria 3125
204 Ga0439432_024183 3300042006 Bacteria 1997
205 Ga0439449_0038204 3300042007 Bacteria 1786
206 Ga0439452_000001 3300042010 Bacteria 1725439
207 Ga0439452_000003 3300042010 Bacteria 942815
208 Ga0439452_000008 3300042010 Bacteria 569877
209 Ga0439452_000061 3300042010 Bacteria 101240
210 Ga0439452_000839 3300042010 Bacteria 14263
211 Ga0439452_011669 3300042010 Bacteria 2517
212 Ga0439452_027170 3300042010 Bacteria 1438
213 Ga0450900_005018 3300042136 Bacteria 1547
214 Ga0450907_000165 3300042146 Bacteria 24249
215 Ga0439464_0010993 3300042439 Bacteria 2393
216 Ga0466981_0000005 3300044669 Bacteria 165643
217 Ga0495617_050496 3300046452 Bacteria 1384
218 Ga0495591_000014 3300046458 Bacteria 254281
219 Ga0495591_000022 3300046458 Bacteria 199449
220 Ga0495591_004696 3300046458 Bacteria 6560
221 Ga0495591_035742 3300046458 Bacteria 1451
222 Ga0495638_0001516 3300046460 Bacteria 20889
223 Ga0495650_0000018 3300046471 Bacteria 538888
224 Ga0495650_0000021 3300046471 Bacteria 531242
225 Ga0495650_0000032 3300046471 Bacteria 425389
226 Ga0495605_0070436 3300046474 Bacteria 1653
227 Ga0495584_0007620 3300046491 Bacteria 5642
228 Ga0495585_0016808 3300046492 Bacteria 4239
229 Ga0495596_0051390 3300046500 Bacteria 1614
230 Ga0495607_0096533 3300046501 Bacteria 1591
231 Ga0495606_0039523 3300046507 Bacteria 3178
232 Ga0495616_0023653 3300046513 Bacteria 3303
233 Ga0495620_0006909 3300046515 Bacteria 6202
234 Ga0495643_0026456 3300046522 Bacteria 3275
235 Ga0495643_0129537 3300046522 Bacteria 1268
236 Ga0495644_0001396 3300046523 Bacteria 9863
237 Ga0495648_0011917 3300046524 Bacteria 6522
238 Ga0495648_0016012 3300046524 Bacteria 5416
239 Ga0495654_0000049 3300046530 Bacteria 147151
240 Ga0495654_0000052 3300046530 Bacteria 145382
241 Ga0495654_0033011 3300046530 Bacteria 2622
242 Ga0495654_0034596 3300046530 Bacteria 2547
243 Ga0495597_0000744 3300046542 Bacteria 25762
244 Ga0495668_0018329 3300046616 Bacteria 4045
245 Ga0495625_0003049 3300046660 Bacteria 17181
246 Ga0495588_0001484 3300046674 Bacteria 10065
247 Ga0495671_0045461 3300046692 Bacteria 2198
248 Ga0495649_0023761 3300046694 Bacteria 3423
249 Ga0495649_0024248 3300046694 Bacteria 3383
250 Ga0495649_0070585 3300046694 Bacteria 1872
251 Ga0495649_0116819 3300046694 Bacteria 1412
252 Ga0495589_0023999 3300046794 Bacteria 3101
253 Ga0495660_0000004 3300046810 Bacteria 1003183
254 Ga0495660_0000038 3300046810 Bacteria 188167
255 Ga0495672_0000002 3300047320 Bacteria 740116
256 Ga0495672_0000012 3300047320 Bacteria 519975
257 Ga0495672_0000249 3300047320 Bacteria 75347
258 Ga0495683_0026201 3300047323 Bacteria 2983
259 Ga0495683_0062691 3300047323 Bacteria 1839
260 Ga0495679_000020 3300047446 Bacteria 228413
261 Ga0495679_003688 3300047446 Bacteria 7299
262 Ga0495679_009928 3300047446 Bacteria 3774
263 Ga0495673_0000022 3300047469 Bacteria 544086
264 Ga0495673_0000095 3300047469 Bacteria 183429
265 Ga0495681_0032917 3300047470 Bacteria 2603
266 Ga0496100_0033980 3300048903 Bacteria 3195
267 Ga0496100_0177317 3300048903 Bacteria 1539
268 Ga0496101_0000863 3300048904 Bacteria 17915
269 Ga0496102_0017387 3300048905 Bacteria 6299
270 Ga0496102_0131230 3300048905 Bacteria 2345
271 Ga0496103_0048592 3300048906 Bacteria 2622
272 Ga0496104_0000148 3300048907 Bacteria 64805
273 Ga0496104_0009616 3300048907 Bacteria 8610
274 Ga0496104_0045572 3300048907 Bacteria 4125
275 Ga0496105_0001519 3300048908 Bacteria 16403
276 Ga0496105_0006001 3300048908 Bacteria 9278
277 Ga0496106_0185595 3300048909 Bacteria 1652
278 Ga0496110_0063245 3300048913 Bacteria 3270
279 Ga0496116_0000083 3300048919 Bacteria 220955
280 Ga0496116_0000245 3300048919 Bacteria 98583
281 Ga0496116_0006660 3300048919 Bacteria 10427
282 Ga0496116_0007716 3300048919 Bacteria 9478
283 Ga0496116_0010533 3300048919 Bacteria 7732
284 Ga0496116_0030148 3300048919 Bacteria 3901
285 Ga0496116_0045985 3300048919 Bacteria 2949
286 Ga0496116_0058733 3300048919 Bacteria 2505
287 Ga0496116_0067245 3300048919 Bacteria 2289
288 Ga0496116_0128383 3300048919 Bacteria 1450
289 Ga0496117_0000004 3300048920 Bacteria 877131
290 Ga0496117_0000164 3300048920 Bacteria 140349
291 Ga0496117_0004573 3300048920 Bacteria 15144
292 Ga0496117_0010020 3300048920 Bacteria 8708
293 Ga0496117_0010330 3300048920 Bacteria 8531
294 Ga0496117_0013386 3300048920 Bacteria 7159
295 Ga0496117_0018733 3300048920 Bacteria 5717
296 Ga0496117_0022427 3300048920 Bacteria 5063
297 Ga0496117_0030312 3300048920 Bacteria 4153
298 Ga0496117_0038369 3300048920 Bacteria 3553
299 Ga0496117_0057692 3300048920 Bacteria 2694
300 Ga0496117_0072723 3300048920 Bacteria 2296
301 Ga0496117_0129058 3300048920 Bacteria 1536
302 Ga0496118_0000921 3300048921 Bacteria 46017
303 Ga0496118_0001371 3300048921 Bacteria 36724
304 Ga0496118_0002474 3300048921 Bacteria 24795
305 Ga0496118_0003989 3300048921 Bacteria 17986
306 Ga0496118_0020003 3300048921 Bacteria 5957
307 Ga0496118_0022134 3300048921 Bacteria 5568
308 Ga0496118_0026416 3300048921 Bacteria 4948
309 Ga0496118_0026417 3300048921 Bacteria 4948
310 Ga0496118_0028396 3300048921 Bacteria 4711
311 Ga0496118_0031449 3300048921 Bacteria 4399
312 Ga0496118_0067272 3300048921 Bacteria 2609
313 Ga0496118_0167116 3300048921 Bacteria 1350
314 Ga0496118_0240407 3300048921 Bacteria 1037
315 Ga0496119_0000008 3300048922 Bacteria 446822
316 Ga0496119_0000124 3300048922 Bacteria 108620
317 Ga0496119_0000919 3300048922 Bacteria 38076
318 Ga0496119_0004820 3300048922 Bacteria 13230
319 Ga0496119_0005573 3300048922 Bacteria 11978
320 Ga0496119_0007724 3300048922 Bacteria 9610
321 Ga0496119_0010973 3300048922 Bacteria 7562
322 Ga0496119_0012903 3300048922 Bacteria 6727
323 Ga0496119_0013238 3300048922 Bacteria 6592
324 Ga0496119_0075061 3300048922 Bacteria 1966
325 Ga0496119_0100610 3300048922 Bacteria 1623
326 Ga0496119_0106706 3300048922 Bacteria 1562
327 Ga0496120_0000040 3300048923 Bacteria 201554
328 Ga0496120_0000062 3300048923 Bacteria 172365
329 Ga0496120_0000075 3300048923 Bacteria 163540
330 Ga0496120_0001509 3300048923 Bacteria 27517
331 Ga0496120_0001758 3300048923 Bacteria 24515
332 Ga0496120_0002562 3300048923 Bacteria 18115
333 Ga0496120_0004359 3300048923 Bacteria 11937
334 Ga0496120_0005168 3300048923 Bacteria 10538
335 Ga0496120_0006005 3300048923 Bacteria 9454
336 Ga0496120_0009294 3300048923 Bacteria 6991
337 Ga0496120_0012676 3300048923 Bacteria 5720
338 Ga0496120_0013175 3300048923 Bacteria 5580
339 Ga0496120_0029444 3300048923 Bacteria 3351
340 Ga0496121_0000047 3300048924 Bacteria 335768
341 Ga0496121_0003618 3300048924 Bacteria 21808
342 Ga0496121_0011414 3300048924 Bacteria 9869
343 Ga0496121_0021893 3300048924 Bacteria 6237
344 Ga0496121_0022861 3300048924 Bacteria 6043
345 Ga0496121_0026488 3300048924 Bacteria 5461
346 Ga0496121_0105795 3300048924 Bacteria 2158
347 Ga0496121_0106463 3300048924 Bacteria 2149
348 Ga0496121_0120866 3300048924 Bacteria 1978
349 Ga0496122_0000007 3300048925 Bacteria 606493
350 Ga0496122_0000340 3300048925 Bacteria 100894
351 Ga0496122_0000623 3300048925 Bacteria 72623
352 Ga0496122_0000645 3300048925 Bacteria 70755
353 Ga0496122_0004791 3300048925 Bacteria 16545
354 Ga0496122_0005363 3300048925 Bacteria 15314
355 Ga0496122_0009988 3300048925 Bacteria 9880
356 Ga0496122_0018840 3300048925 Bacteria 6344
357 Ga0496122_0056065 3300048925 Bacteria 2942
358 Ga0496122_0070639 3300048925 Bacteria 2492
359 Ga0496122_0100569 3300048925 Bacteria 1934
360 Ga0496122_0152124 3300048925 Bacteria 1426
361 Ga0496122_0228441 3300048925 Bacteria 1060
362 Ga0496123_0000004 3300048926 Bacteria 777230
363 Ga0496123_0000005 3300048926 Bacteria 658131
364 Ga0496123_0000425 3300048926 Bacteria 76122
365 Ga0496123_0000469 3300048926 Bacteria 70755
366 Ga0496123_0002313 3300048926 Bacteria 23929
367 Ga0496123_0005065 3300048926 Bacteria 13463
368 Ga0496123_0007619 3300048926 Bacteria 10135
369 Ga0496123_0012070 3300048926 Bacteria 7409
370 Ga0496123_0019753 3300048926 Bacteria 5298
371 Ga0496123_0047735 3300048926 Bacteria 2888
372 Ga0496123_0051279 3300048926 Bacteria 2748
373 Ga0496123_0076501 3300048926 Bacteria 2060
374 Ga0496123_0081944 3300048926 Bacteria 1958
375 Ga0496124_0000101 3300048927 Bacteria 180325
376 Ga0496124_0000369 3300048927 Bacteria 82290
377 Ga0496124_0000399 3300048927 Bacteria 79230
378 Ga0496124_0000797 3300048927 Bacteria 51324
379 Ga0496124_0000999 3300048927 Bacteria 44845
380 Ga0496124_0003356 3300048927 Bacteria 19678
381 Ga0496124_0010183 3300048927 Bacteria 9562
382 Ga0496124_0023206 3300048927 Bacteria 5669
383 Ga0496124_0025074 3300048927 Bacteria 5407
384 Ga0496124_0035015 3300048927 Bacteria 4397
385 Ga0496124_0049363 3300048927 Bacteria 3590
386 Ga0496124_0053101 3300048927 Bacteria 3438
387 Ga0496124_0073353 3300048927 Bacteria 2832
388 Ga0496124_0119174 3300048927 Bacteria 2111
389 Ga0496125_0000013 3300048928 Bacteria 628761
390 Ga0496125_0000055 3300048928 Bacteria 278140
391 Ga0496125_0002788 3300048928 Bacteria 22089
392 Ga0496125_0008148 3300048928 Bacteria 11030
393 Ga0496125_0019034 3300048928 Bacteria 6496
394 Ga0496125_0023776 3300048928 Bacteria 5649
395 Ga0496125_0031612 3300048928 Bacteria 4715
396 Ga0496125_0041090 3300048928 Bacteria 3957
397 Ga0496125_0067796 3300048928 Bacteria 2809
398 Ga0496125_0106694 3300048928 Bacteria 2043
399 Ga0496125_0142264 3300048928 Bacteria 1665
400 Ga0496126_0000562 3300048929 Bacteria 71336
401 Ga0496126_0014961 3300048929 Bacteria 7821
402 Ga0496126_0021809 3300048929 Bacteria 6248
403 Ga0496126_0037666 3300048929 Bacteria 4510
404 Ga0496126_0040602 3300048929 Bacteria 4312
405 Ga0496126_0050473 3300048929 Bacteria 3790
406 Ga0496126_0052612 3300048929 Bacteria 3699
407 Ga0496126_0079769 3300048929 Bacteria 2897
408 Ga0496126_0136047 3300048929 Bacteria 2119
409 Ga0496126_0149799 3300048929 Bacteria 2000
410 Ga0496126_0150691 3300048929 Bacteria 1993
411 Ga0496126_0224674 3300048929 Bacteria 1575
412 Ga0496126_0262965 3300048929 Bacteria 1434
413 Ga0496126_0306398 3300048929 Bacteria 1308
414 Ga0495678_000118 3300049459 Bacteria 93371
415 Ga0495682_0000015 3300049460 Bacteria 235048
416 nmdc:mga00v17_35324_c1 3300050491 Bacteria 2973
417 nmdc:mga00v17_37448_c1 3300050491 Bacteria 2897
418 nmdc:mga00v17_39239_c1 3300050491 Bacteria 2835
419 Ga0500621_000001 3300053126 Bacteria 1049698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0056065 Ga0496122_0056065_1128_1961 277
2 3300048926 Ga0496123_0076501 Ga0496123_0076501_1084_1917 277
3 3300048927 Ga0496124_0035015 Ga0496124_0035015_2775_3608 277
4 3300048928 Ga0496125_0000055 Ga0496125_0000055_15314_16147 277
5 3300048929 Ga0496126_0079769 Ga0496126_0079769_1821_2654 277
6 3300013104 Ga0157370_10000147 Ga0157370_1000014758 278
7 3300046458 Ga0495591_035742 Ga0495591_035742_537_1379 280
8 3300013307 Ga0157372_10020464 Ga0157372_100204642 296
9 3300041407 Ga0439447_009133 Ga0439447_009133_57_1037 296
10 3300009011 Ga0105251_10010854 Ga0105251_100108542 299
11 3300025735 Ga0207713_1000040 Ga0207713_1000040217 299
12 3300050491 nmdc:mga00v17_39239_c1 nmdc:mga00v17_39239_c1_1916_2818 300
13 3300048919 Ga0496116_0030148 Ga0496116_0030148_225_1205 306
14 3300009036 Ga0105244_10000094 Ga0105244_1000009480 308
15 3300025728 Ga0207655_1000102 Ga0207655_1000102110 308
16 3300048927 Ga0496124_0000999 Ga0496124_0000999_1536_2516 308
17 3300042006 Ga0439432_010974 Ga0439432_010974_142_1083 309
18 3300042010 Ga0439452_000001 Ga0439452_000001_266443_267384 309
19 3300048919 Ga0496116_0000245 Ga0496116_0000245_5042_5983 309
20 3300048920 Ga0496117_0000164 Ga0496117_0000164_134375_135316 309
21 3300048921 Ga0496118_0026416 Ga0496118_0026416_296_1237 309
22 3300048927 Ga0496124_0010183 Ga0496124_0010183_8409_9350 309
23 3300048927 Ga0496124_0119174 Ga0496124_0119174_35_964 309
24 3300005366 Ga0070659_100011704 Ga0070659_1000117045 313
25 3300006946 Ga0079104_1001833 Ga0079104_10018335 313
26 3300025932 Ga0207690_10011211 Ga0207690_100112112 313
27 3300027111 Ga0209281_1004281 Ga0209281_10042813 313
28 3300046458 Ga0495591_004696 Ga0495591_004696_5477_6457 313
29 3300046460 Ga0495638_0001516 Ga0495638_0001516_16080_17060 313
30 3300046515 Ga0495620_0006909 Ga0495620_0006909_1571_2551 313
31 3300046694 Ga0495649_0023761 Ga0495649_0023761_1253_2233 313
32 3300046694 Ga0495649_0024248 Ga0495649_0024248_1253_2233 313
33 3300047446 Ga0495679_003688 Ga0495679_003688_1830_2810 313
34 3300003856 Ga0058692_1000877 Ga0058692_10008774 314
35 3300027312 Ga0209371_1000001 Ga0209371_1000001646 314
36 3300027312 Ga0209371_1000914 Ga0209371_100091417 314
37 3300027312 Ga0209371_1002196 Ga0209371_10021968 314
38 3300030500 Ga0268256_1000001 Ga0268256_10000011995 314
39 3300030500 Ga0268256_1000073 Ga0268256_100007317 314
40 3300030500 Ga0268256_1001526 Ga0268256_10015268 314
41 3300048921 Ga0496118_0000921 Ga0496118_0000921_41744_42730 315
42 3300048922 Ga0496119_0000919 Ga0496119_0000919_5534_6514 317
43 3300048923 Ga0496120_0001509 Ga0496120_0001509_5015_5995 317
44 3300002737 JGI25162J39368_1003630 JGI25162J39368_10036303 319
45 3300003856 Ga0058692_1002748 Ga0058692_10027484 319
46 3300005457 Ga0070662_100180389 Ga0070662_1001803892 319
47 3300006051 Ga0075364_10052539 Ga0075364_100525392 319
48 3300013100 Ga0157373_10126574 Ga0157373_101265742 319
49 3300013105 Ga0157369_10023393 Ga0157369_100233932 319
50 3300013306 Ga0163162_10225951 Ga0163162_102259512 319
51 3300013307 Ga0157372_10034555 Ga0157372_100345552 319
52 3300013307 Ga0157372_10087521 Ga0157372_100875212 319
53 3300015261 Ga0182006_1011538 Ga0182006_10115382 319
54 3300017792 Ga0163161_10010170 Ga0163161_100101703 319
55 3300025233 Ga0209437_100035 Ga0209437_100035172 319
56 3300025711 Ga0207696_1000610 Ga0207696_10006105 319
57 3300025728 Ga0207655_1022522 Ga0207655_10225222 319
58 3300025728 Ga0207655_1037177 Ga0207655_10371772 319
59 3300027312 Ga0209371_1005372 Ga0209371_10053723 319
60 3300028379 Ga0268266_10031307 Ga0268266_100313073 319
61 3300030500 Ga0268256_1021807 Ga0268256_10218072 319
62 3300041405 Ga0439438_013730 Ga0439438_013730_712_1698 319
63 3300041407 Ga0439447_004934 Ga0439447_004934_2406_3392 319
64 3300041411 Ga0439466_0000003 Ga0439466_0000003_183770_184756 319
65 3300042006 Ga0439432_024183 Ga0439432_024183_204_1190 319
66 3300042007 Ga0439449_0038204 Ga0439449_0038204_609_1595 319
67 3300042010 Ga0439452_027170 Ga0439452_027170_54_1040 319
68 3300042146 Ga0450907_000165 Ga0450907_000165_21814_22800 319
69 3300046492 Ga0495585_0016808 Ga0495585_0016808_2112_3098 319
70 3300046522 Ga0495643_0026456 Ga0495643_0026456_2081_3067 319
71 3300046524 Ga0495648_0016012 Ga0495648_0016012_3152_4138 319
72 3300047320 Ga0495672_0000012 Ga0495672_0000012_327379_328365 319
73 3300047446 Ga0495679_009928 Ga0495679_009928_1642_2628 319
74 3300048903 Ga0496100_0033980 Ga0496100_0033980_2073_3059 319
75 3300048905 Ga0496102_0017387 Ga0496102_0017387_4076_5062 319
76 3300048905 Ga0496102_0131230 Ga0496102_0131230_651_1637 319
77 3300048906 Ga0496103_0048592 Ga0496103_0048592_425_1411 319
78 3300048908 Ga0496105_0001519 Ga0496105_0001519_3409_4395 319
79 3300048913 Ga0496110_0063245 Ga0496110_0063245_2097_3083 319
80 3300048919 Ga0496116_0010533 Ga0496116_0010533_3285_4271 319
81 3300048919 Ga0496116_0128383 Ga0496116_0128383_204_1190 319
82 3300048920 Ga0496117_0000004 Ga0496117_0000004_484677_485663 319
83 3300048920 Ga0496117_0013386 Ga0496117_0013386_2613_3599 319
84 3300048921 Ga0496118_0001371 Ga0496118_0001371_4731_5717 319
85 3300048922 Ga0496119_0000124 Ga0496119_0000124_17891_18877 319
86 3300048922 Ga0496119_0007724 Ga0496119_0007724_4430_5416 319
87 3300048923 Ga0496120_0000062 Ga0496120_0000062_4430_5416 319
88 3300048923 Ga0496120_0001758 Ga0496120_0001758_5971_6957 319
89 3300048924 Ga0496121_0000047 Ga0496121_0000047_275595_276581 319
90 3300048926 Ga0496123_0047735 Ga0496123_0047735_432_1418 319
91 3300048927 Ga0496124_0000797 Ga0496124_0000797_20023_21009 319
92 3300048927 Ga0496124_0023206 Ga0496124_0023206_519_1505 319
93 3300048928 Ga0496125_0008148 Ga0496125_0008148_966_1952 319
94 3300048929 Ga0496126_0040602 Ga0496126_0040602_2050_3036 319
95 3300050491 nmdc:mga00v17_35324_c1 nmdc:mga00v17_35324_c1_617_1603 319
96 iso_pu_bacteria 2908669403 2908670782 320
97 iso_pu_bacteria 2547132181 2547694773 321
98 iso_pu_bacteria 2547132416 2548648936 321
99 iso_pu_bacteria 2561511199 2562466803 321
100 iso_pu_bacteria 2600255256 2601532331 321
101 iso_pu_bacteria 2600255257 2601537701 321
102 iso_pu_bacteria 2600255310 2601756047 321
103 iso_pu_bacteria 2600255311 2601761418 321
104 iso_pu_bacteria 2602042046 2603638557 321
105 iso_pu_bacteria 2602042047 2603643088 321
106 iso_pu_bacteria 2602042066 2603699660 321
107 iso_pu_bacteria 2602042067 2603703668 321
108 iso_pu_bacteria 2609459761 2609910815 321
109 iso_pu_bacteria 2667528172 2671102761 321
110 iso_pu_bacteria 2671180115 2671588013 321
111 iso_pu_bacteria 2681812866 2681995455 321
112 iso_pu_bacteria 2681812869 2682007231 321
113 iso_pu_bacteria 2711768156 2712469144 321
114 iso_pu_bacteria 2751185917 2753855362 321
115 iso_pu_bacteria 2765235842 2765588319 321
116 iso_pu_bacteria 2775506706 2775542112 321
117 iso_pu_bacteria 2791354903 2791924956 321
118 iso_pu_bacteria 2791355010 2792311720 321
119 iso_pu_bacteria 2811995292 2813729608 321
120 iso_pu_bacteria 2814123068 2814697109 321
121 iso_pu_bacteria 2821118458 2821119180 321
122 iso_pu_bacteria 2823373977 2823374108 321
123 iso_pu_bacteria 2844425489 2844426915 321
124 iso_pu_bacteria 2852103415 2852106976 321
125 iso_pu_bacteria 2891670763 2891673752 321
126 iso_pu_bacteria 2923634449 2923638806 321
127 iso_pu_bacteria 2927833300 2927834711 321
128 iso_pu_bacteria 2935625433 2935627246 321
129 iso_pu_bacteria 2937539931 2937543685 321
130 iso_pu_bacteria 2939568625 2939572709 321
131 iso_pu_bacteria 2939573065 2939574411 321
132 iso_pu_bacteria 2939617950 2939618968 321
133 iso_pu_bacteria 2939642701 2939644352 321
134 iso_pu_bacteria 2945874760 2945878716 321
135 iso_pu_bacteria 2974310843 2974312755 321
136 iso_pu_bacteria 2974435778 2974437835 321
137 iso_pu_bacteria 3000376612 3000379749 321
138 iso_pu_bacteria 8018221730 8018226146 321
139 iso_pu_bacteria 8018405270 8018407295 321
140 iso_pu_bacteria 8019504834 8019505852 321
141 iso_pu_bacteria 8054844752 8054844855 321
142 iso_pu_bacteria 8054849141 8054849518 321
143 iso_pu_bacteria 2554235234 2555261352 322
144 iso_pu_bacteria 2599185169 2599410701 322
145 iso_pu_bacteria 2600255254 2601523656 322
146 iso_pu_bacteria 2600255255 2601528815 322
147 iso_pu_bacteria 2600255280 2601615648 322
148 iso_pu_bacteria 2600255281 2601620632 322
149 iso_pu_bacteria 2600255287 2601645485 322
150 iso_pu_bacteria 2600255288 2601649029 322
151 iso_pu_bacteria 2600255289 2601653699 322
152 iso_pu_bacteria 2600255290 2601659119 322
153 iso_pu_bacteria 2600255291 2601665528 322
154 iso_pu_bacteria 2600255298 2601698387 322
155 iso_pu_bacteria 2600255299 2601703631 322
156 iso_pu_bacteria 2600255300 2601707724 322
157 iso_pu_bacteria 2600255301 2601712783 322
158 iso_pu_bacteria 2600255302 2601716958 322
159 iso_pu_bacteria 2600255303 2601723569 322
160 iso_pu_bacteria 2600255304 2601724879 322
161 iso_pu_bacteria 2600255305 2601732162 322
162 iso_pu_bacteria 2600255306 2601737960 322
163 iso_pu_bacteria 2600255307 2601742634 322
164 iso_pu_bacteria 2600255309 2601752086 322
165 iso_pu_bacteria 2600255392 2602020533 322
166 iso_pu_bacteria 2602042052 2603658781 322
167 iso_pu_bacteria 2602042053 2603668360 322
168 iso_pu_bacteria 2602042103 2603839304 322
169 iso_pu_bacteria 2602042104 2603844640 322
170 iso_pu_bacteria 2602042105 2603849461 322
171 iso_pu_bacteria 2602042106 2603854529 322
172 iso_pu_bacteria 2602042109 2603865837 322
173 iso_pu_bacteria 2602042110 2603870058 322
174 iso_pu_bacteria 2602042111 2603875017 322
175 iso_pu_bacteria 2603880178 2606047249 322
176 iso_pu_bacteria 2603880184 2606072782 322
177 iso_pu_bacteria 2603880202 2606146249 322
178 iso_pu_bacteria 2603880211 2606177175 322
179 iso_pu_bacteria 2636415599 2637226154 322
180 iso_pu_bacteria 2675903046 2676407654 322
181 iso_pu_bacteria 2775507074 2777020492 322
182 iso_pu_bacteria 2847085930 2847088242 322
183 iso_pu_bacteria 2884086401 2884089614 322
184 iso_pu_bacteria 2888373701 2888374123 322
185 iso_pu_bacteria 2904513164 2904517633 322
186 iso_pu_bacteria 2919108558 2919111665 322
187 iso_pu_bacteria 2939607340 2939608102 322
188 iso_pu_bacteria 2969079654 2969083166 322
189 iso_pu_bacteria 2971820967 2971824542 322
190 iso_pu_bacteria 2984559226 2984560183 322
191 iso_pu_bacteria 2984595703 2984598263 322
192 iso_pu_bacteria 8055097453 8055099491 322
193 iso_pu_bacteria 8057304971 8057305640 322
194 iso_pu_bacteria 2904504865 2904505276 323
195 3300025245 Ga0207425_1013567 Ga0207425_10135672 324
196 3300048925 Ga0496122_0005363 Ga0496122_0005363_13154_14128 324
197 3300048926 Ga0496123_0005065 Ga0496123_0005065_8011_8985 324
198 iso_pu_bacteria 2608642108 2608668876 324
199 iso_pu_bacteria 2844528606 2844531675 324
200 iso_pu_bacteria 2865014394 2865015769 324
201 iso_pu_bacteria 2881609920 2881613243 324
202 iso_pu_bacteria 2945951305 2945953606 324
203 iso_pu_bacteria 2978975091 2978976099 324
204 3300003856 Ga0058692_1000343 Ga0058692_100034315 325
205 3300003856 Ga0058692_1002130 Ga0058692_10021302 325
206 3300003856 Ga0058692_1002141 Ga0058692_10021412 325
207 3300003856 Ga0058692_1008201 Ga0058692_10082012 325
208 3300005289 Ga0065704_10000557 Ga0065704_100005574 325
209 3300005289 Ga0065704_10001424 Ga0065704_100014246 325
210 3300005289 Ga0065704_10005301 Ga0065704_100053014 325
211 3300005548 Ga0070665_100000345 Ga0070665_1000003452 325
212 3300006051 Ga0075364_10013931 Ga0075364_100139312 325
213 3300006051 Ga0075364_10029314 Ga0075364_100293142 325
214 3300006946 Ga0079104_1000035 Ga0079104_10000355 325
215 3300006946 Ga0079104_1000114 Ga0079104_10001145 325
216 3300006946 Ga0079104_1000196 Ga0079104_100019681 325
217 3300006946 Ga0079104_1000951 Ga0079104_10009514 325
218 3300006946 Ga0079104_1001118 Ga0079104_100111813 325
219 3300006946 Ga0079104_1001121 Ga0079104_10011214 325
220 3300006946 Ga0079104_1002535 Ga0079104_10025354 325
221 3300006946 Ga0079104_1003633 Ga0079104_10036337 325
222 3300009011 Ga0105251_10003547 Ga0105251_100035475 325
223 3300009011 Ga0105251_10005127 Ga0105251_100051276 325
224 3300009011 Ga0105251_10005282 Ga0105251_100052823 325
225 3300009011 Ga0105251_10078524 Ga0105251_100785242 325
226 3300009011 Ga0105251_10119808 Ga0105251_101198082 325
227 3300009036 Ga0105244_10003814 Ga0105244_100038144 325
228 3300009036 Ga0105244_10005793 Ga0105244_100057936 325
229 3300009036 Ga0105244_10006144 Ga0105244_100061448 325
230 3300009036 Ga0105244_10024994 Ga0105244_100249942 325
231 3300009092 Ga0105250_10000360 Ga0105250_100003605 325
232 3300009092 Ga0105250_10001692 Ga0105250_100016923 325
233 3300009092 Ga0105250_10016315 Ga0105250_100163152 325
234 3300009148 Ga0105243_10124099 Ga0105243_101240992 325
235 3300013102 Ga0157371_10009135 Ga0157371_100091358 325
236 3300013102 Ga0157371_10091391 Ga0157371_100913911 325
237 3300013104 Ga0157370_10030467 Ga0157370_100304672 325
238 3300013105 Ga0157369_10021301 Ga0157369_100213015 325
239 3300013307 Ga0157372_10237216 Ga0157372_102372162 325
240 3300015679 Ga0183366_1001 Ga0183366_1001693 325
241 3300015680 Ga0183370_1001 Ga0183370_1001693 325
242 3300015685 Ga0183369_1001 Ga0183369_1001693 325
243 3300015687 Ga0183368_1001 Ga0183368_1001693 325
244 3300021384 Ga0213876_10000061 Ga0213876_10000061109 325
245 3300025258 Ga0209129_1000018 Ga0209129_1000018135 325
246 3300025711 Ga0207696_1000003 Ga0207696_1000003803 325
247 3300025711 Ga0207696_1006926 Ga0207696_10069264 325
248 3300025711 Ga0207696_1017821 Ga0207696_10178212 325
249 3300025728 Ga0207655_1000001 Ga0207655_1000001774 325
250 3300025728 Ga0207655_1000132 Ga0207655_1000132109 325
251 3300025728 Ga0207655_1005792 Ga0207655_10057924 325
252 3300025728 Ga0207655_1025096 Ga0207655_10250962 325
253 3300025735 Ga0207713_1000012 Ga0207713_1000012493 325
254 3300025735 Ga0207713_1007632 Ga0207713_10076322 325
255 3300025735 Ga0207713_1018003 Ga0207713_10180032 325
256 3300025735 Ga0207713_1028984 Ga0207713_10289842 325
257 3300027111 Ga0209281_1000001 Ga0209281_10000011211 325
258 3300027111 Ga0209281_1000114 Ga0209281_1000114226 325
259 3300027111 Ga0209281_1000180 Ga0209281_10001805 325
260 3300027111 Ga0209281_1000234 Ga0209281_1000234102 325
261 3300027111 Ga0209281_1000525 Ga0209281_10005255 325
262 3300027111 Ga0209281_1000535 Ga0209281_100053535 325
263 3300027111 Ga0209281_1000690 Ga0209281_100069010 325
264 3300027111 Ga0209281_1000967 Ga0209281_10009675 325
265 3300027111 Ga0209281_1001023 Ga0209281_10010234 325
266 3300027312 Ga0209371_1000086 Ga0209371_1000086156 325
267 3300027312 Ga0209371_1000269 Ga0209371_100026962 325
268 3300027312 Ga0209371_1001171 Ga0209371_100117111 325
269 3300027312 Ga0209371_1013161 Ga0209371_10131611 325
270 3300027312 Ga0209371_1013912 Ga0209371_10139121 325
271 3300027312 Ga0209371_1022816 Ga0209371_10228162 325
272 3300028379 Ga0268266_10000100 Ga0268266_10000100126 325
273 3300030500 Ga0268256_1000003 Ga0268256_1000003656 325
274 3300030500 Ga0268256_1000126 Ga0268256_100012625 325
275 3300030500 Ga0268256_1001002 Ga0268256_10010024 325
276 3300030500 Ga0268256_1003951 Ga0268256_10039516 325
277 3300030500 Ga0268256_1015413 Ga0268256_10154132 325
278 3300030500 Ga0268256_1023492 Ga0268256_10234922 325
279 3300030500 Ga0268256_1023598 Ga0268256_10235982 325
280 3300039437 Ga0436365_1910565 Ga0436365_1910565_163406_164383 325
281 3300041512 Ga0451853_2726652 Ga0451853_2726652_1427_2404 325
282 3300042010 Ga0439452_000008 Ga0439452_000008_399044_400021 325
283 3300042010 Ga0439452_000061 Ga0439452_000061_94989_95966 325
284 3300042010 Ga0439452_000839 Ga0439452_000839_5271_6248 325
285 3300042010 Ga0439452_011669 Ga0439452_011669_685_1662 325
286 3300042439 Ga0439464_0010993 Ga0439464_0010993_412_1389 325
287 3300044669 Ga0466981_0000005 Ga0466981_0000005_80071_81048 325
288 3300046458 Ga0495591_000022 Ga0495591_000022_170405_171382 325
289 3300046471 Ga0495650_0000021 Ga0495650_0000021_318432_319409 325
290 3300046522 Ga0495643_0129537 Ga0495643_0129537_247_1224 325
291 3300046530 Ga0495654_0033011 Ga0495654_0033011_124_1101 325
292 3300046530 Ga0495654_0034596 Ga0495654_0034596_18_1001 325
293 3300046542 Ga0495597_0000744 Ga0495597_0000744_15377_16360 325
294 3300046660 Ga0495625_0003049 Ga0495625_0003049_12207_13190 325
295 3300046674 Ga0495588_0001484 Ga0495588_0001484_7776_8759 325
296 3300046694 Ga0495649_0116819 Ga0495649_0116819_121_1104 325
297 3300047320 Ga0495672_0000249 Ga0495672_0000249_11569_12552 325
298 3300047446 Ga0495679_000020 Ga0495679_000020_171996_172979 325
299 3300047469 Ga0495673_0000022 Ga0495673_0000022_64165_65142 325
300 3300048907 Ga0496104_0000148 Ga0496104_0000148_54589_55566 325
301 3300048908 Ga0496105_0006001 Ga0496105_0006001_7385_8362 325
302 3300048919 Ga0496116_0006660 Ga0496116_0006660_4987_5964 325
303 3300048919 Ga0496116_0045985 Ga0496116_0045985_806_1783 325
304 3300048919 Ga0496116_0058733 Ga0496116_0058733_1168_2145 325
305 3300048919 Ga0496116_0067245 Ga0496116_0067245_150_1127 325
306 3300048920 Ga0496117_0010020 Ga0496117_0010020_4465_5442 325
307 3300048920 Ga0496117_0010330 Ga0496117_0010330_1775_2752 325
308 3300048920 Ga0496117_0018733 Ga0496117_0018733_361_1338 325
309 3300048920 Ga0496117_0022427 Ga0496117_0022427_671_1648 325
310 3300048920 Ga0496117_0030312 Ga0496117_0030312_806_1783 325
311 3300048920 Ga0496117_0072723 Ga0496117_0072723_776_1753 325
312 3300048921 Ga0496118_0020003 Ga0496118_0020003_4205_5182 325
313 3300048921 Ga0496118_0022134 Ga0496118_0022134_387_1364 325
314 3300048921 Ga0496118_0028396 Ga0496118_0028396_1345_2322 325
315 3300048921 Ga0496118_0031449 Ga0496118_0031449_1195_2172 325
316 3300048921 Ga0496118_0067272 Ga0496118_0067272_1577_2554 325
317 3300048921 Ga0496118_0240407 Ga0496118_0240407_47_1024 325
318 3300048922 Ga0496119_0000008 Ga0496119_0000008_188693_189670 325
319 3300048922 Ga0496119_0005573 Ga0496119_0005573_4464_5441 325
320 3300048922 Ga0496119_0013238 Ga0496119_0013238_4221_5198 325
321 3300048922 Ga0496119_0075061 Ga0496119_0075061_13_990 325
322 3300048922 Ga0496119_0100610 Ga0496119_0100610_502_1479 325
323 3300048922 Ga0496119_0106706 Ga0496119_0106706_361_1338 325
324 3300048923 Ga0496120_0004359 Ga0496120_0004359_8400_9377 325
325 3300048923 Ga0496120_0006005 Ga0496120_0006005_4377_5354 325
326 3300048923 Ga0496120_0009294 Ga0496120_0009294_5015_5992 325
327 3300048923 Ga0496120_0012676 Ga0496120_0012676_1240_2217 325
328 3300048923 Ga0496120_0013175 Ga0496120_0013175_4475_5452 325
329 3300048923 Ga0496120_0029444 Ga0496120_0029444_2264_3241 325
330 3300048924 Ga0496121_0003618 Ga0496121_0003618_15990_16967 325
331 3300048924 Ga0496121_0011414 Ga0496121_0011414_3383_4360 325
332 3300048924 Ga0496121_0021893 Ga0496121_0021893_939_1916 325
333 3300048924 Ga0496121_0022861 Ga0496121_0022861_5030_6007 325
334 3300048924 Ga0496121_0026488 Ga0496121_0026488_436_1413 325
335 3300048924 Ga0496121_0105795 Ga0496121_0105795_1119_2096 325
336 3300048924 Ga0496121_0106463 Ga0496121_0106463_656_1633 325
337 3300048924 Ga0496121_0120866 Ga0496121_0120866_63_1040 325
338 3300048925 Ga0496122_0000340 Ga0496122_0000340_94803_95780 325
339 3300048925 Ga0496122_0000623 Ga0496122_0000623_15019_15996 325
340 3300048925 Ga0496122_0000645 Ga0496122_0000645_67757_68734 325
341 3300048925 Ga0496122_0004791 Ga0496122_0004791_13854_14831 325
342 3300048925 Ga0496122_0070639 Ga0496122_0070639_1155_2132 325
343 3300048925 Ga0496122_0152124 Ga0496122_0152124_332_1309 325
344 3300048925 Ga0496122_0228441 Ga0496122_0228441_57_1034 325
345 3300048926 Ga0496123_0000005 Ga0496123_0000005_94683_95660 325
346 3300048926 Ga0496123_0000425 Ga0496123_0000425_10859_11836 325
347 3300048926 Ga0496123_0000469 Ga0496123_0000469_2022_2999 325
348 3300048926 Ga0496123_0002313 Ga0496123_0002313_21862_22839 325
349 3300048926 Ga0496123_0012070 Ga0496123_0012070_1231_2208 325
350 3300048926 Ga0496123_0051279 Ga0496123_0051279_634_1611 325
351 3300048927 Ga0496124_0000101 Ga0496124_0000101_22822_23799 325
352 3300048927 Ga0496124_0003356 Ga0496124_0003356_13859_14836 325
353 3300048927 Ga0496124_0053101 Ga0496124_0053101_1067_2044 325
354 3300048928 Ga0496125_0002788 Ga0496125_0002788_5079_6056 325
355 3300048928 Ga0496125_0019034 Ga0496125_0019034_1186_2163 325
356 3300048928 Ga0496125_0023776 Ga0496125_0023776_1643_2620 325
357 3300048928 Ga0496125_0041090 Ga0496125_0041090_32_1009 325
358 3300048928 Ga0496125_0067796 Ga0496125_0067796_423_1400 325
359 3300048928 Ga0496125_0106694 Ga0496125_0106694_965_1942 325
360 3300048928 Ga0496125_0142264 Ga0496125_0142264_167_1144 325
361 3300048929 Ga0496126_0014961 Ga0496126_0014961_5205_6182 325
362 3300048929 Ga0496126_0021809 Ga0496126_0021809_4100_5077 325
363 3300048929 Ga0496126_0050473 Ga0496126_0050473_813_1790 325
364 3300048929 Ga0496126_0052612 Ga0496126_0052612_2073_3050 325
365 3300048929 Ga0496126_0136047 Ga0496126_0136047_911_1888 325
366 3300048929 Ga0496126_0149799 Ga0496126_0149799_475_1452 325
367 3300048929 Ga0496126_0150691 Ga0496126_0150691_130_1107 325
368 3300048929 Ga0496126_0224674 Ga0496126_0224674_557_1534 325
369 3300048929 Ga0496126_0306398 Ga0496126_0306398_239_1216 325
370 iso_pu_bacteria 2511231025 2511378624 325
371 iso_pu_bacteria 2511231035 2511434168 325
372 iso_pu_bacteria 2537561728 2538424328 325
373 iso_pu_bacteria 2585427591 2585827448 325
374 iso_pu_bacteria 2585427592 2585832483 325
375 iso_pu_bacteria 2599185299 2599927457 325
376 iso_pu_bacteria 2648501693 2650896805 325
377 iso_pu_bacteria 2667528173 2671106853 325
378 iso_pu_bacteria 2684622997 2686352804 325
379 iso_pu_bacteria 2791355275 2793406025 325
380 iso_pu_bacteria 2808606414 2809127703 325
381 iso_pu_bacteria 2846540461 2846542020 325
382 iso_pu_bacteria 2847797336 2847800516 325
383 iso_pu_bacteria 2854601825 2854602338 325
384 iso_pu_bacteria 2855195626 2855199641 325
385 iso_pu_bacteria 2858466076 2858467723 325
386 iso_pu_bacteria 2871272651 2871275262 325
387 iso_pu_bacteria 2871282230 2871285223 325
388 iso_pu_bacteria 2876601092 2876602118 325
389 iso_pu_bacteria 2900051742 2900052266 325
390 iso_pu_bacteria 2904474040 2904475814 325
391 iso_pu_bacteria 2919150387 2919151983 325
392 iso_pu_bacteria 2927143783 2927144652 325
393 iso_pu_bacteria 2939602548 2939602670 325
394 iso_pu_bacteria 2984494565 2984496032 325
395 iso_pu_bacteria 2990261002 2990262712 325
396 iso_pu_bacteria 8016733728 8016736499 325
397 iso_pu_bacteria 8019499862 8019503169 325
398 iso_pu_bacteria 8055087960 8055088169 325
399 iso_pu_bacteria 8055092621 8055094071 325
400 iso_pu_bacteria 8055693939 8055695555 325
401 3300003856 Ga0058692_1001394 Ga0058692_10013948 326
402 3300009011 Ga0105251_10000351 Ga0105251_100003515 326
403 3300009011 Ga0105251_10062101 Ga0105251_100621012 326
404 3300009036 Ga0105244_10000034 Ga0105244_100000346 326
405 3300009036 Ga0105244_10020328 Ga0105244_100203282 326
406 3300009092 Ga0105250_10000206 Ga0105250_100002065 326
407 3300009148 Ga0105243_10054597 Ga0105243_100545972 326
408 3300025711 Ga0207696_1000077 Ga0207696_1000077196 326
409 3300025728 Ga0207655_1000046 Ga0207655_100004644 326
410 3300025728 Ga0207655_1021963 Ga0207655_10219632 326
411 3300025735 Ga0207713_1000346 Ga0207713_100034636 326
412 3300025935 Ga0207709_10037121 Ga0207709_100371212 326
413 3300027312 Ga0209371_1002141 Ga0209371_10021418 326
414 3300027312 Ga0209371_1002215 Ga0209371_10022152 326
415 3300030500 Ga0268256_1001951 Ga0268256_100195110 326
416 3300030500 Ga0268256_1003750 Ga0268256_10037502 326
417 3300041405 Ga0439438_002382 Ga0439438_002382_6231_7229 326
418 3300042136 Ga0450900_005018 Ga0450900_005018_63_1061 326
419 3300046692 Ga0495671_0045461 Ga0495671_0045461_1207_2187 326
420 3300048907 Ga0496104_0045572 Ga0496104_0045572_2221_3201 326
421 3300048920 Ga0496117_0038369 Ga0496117_0038369_2383_3363 326
422 3300048921 Ga0496118_0026417 Ga0496118_0026417_1026_2006 326
423 3300048922 Ga0496119_0010973 Ga0496119_0010973_1399_2379 326
424 3300048923 Ga0496120_0005168 Ga0496120_0005168_4794_5774 326
425 3300048925 Ga0496122_0100569 Ga0496122_0100569_679_1659 326
426 3300048926 Ga0496123_0081944 Ga0496123_0081944_76_1056 326
427 3300048928 Ga0496125_0031612 Ga0496125_0031612_781_1761 326
428 3300003856 Ga0058692_1000325 Ga0058692_10003256 327
429 3300009036 Ga0105244_10000085 Ga0105244_1000008586 327
430 3300009036 Ga0105244_10005729 Ga0105244_100057295 327
431 3300009092 Ga0105250_10000003 Ga0105250_1000000379 327
432 3300013307 Ga0157372_10016181 Ga0157372_100161815 327
433 3300013307 Ga0157372_10061352 Ga0157372_100613524 327
434 3300013307 Ga0157372_10065256 Ga0157372_100652564 327
435 3300025711 Ga0207696_1000004 Ga0207696_1000004555 327
436 3300025728 Ga0207655_1000194 Ga0207655_100019431 327
437 3300025728 Ga0207655_1000280 Ga0207655_10002805 327
438 3300027312 Ga0209371_1000085 Ga0209371_10000856 327
439 3300030500 Ga0268256_1000048 Ga0268256_10000486 327
440 3300041405 Ga0439438_000001 Ga0439438_000001_312684_313667 327
441 3300041407 Ga0439447_003600 Ga0439447_003600_309_1292 327
442 3300042006 Ga0439432_000943 Ga0439432_000943_6085_7068 327
443 3300046471 Ga0495650_0000032 Ga0495650_0000032_127970_128953 327
444 3300046474 Ga0495605_0070436 Ga0495605_0070436_167_1150 327
445 3300046491 Ga0495584_0007620 Ga0495584_0007620_550_1533 327
446 3300046501 Ga0495607_0096533 Ga0495607_0096533_449_1432 327
447 3300046507 Ga0495606_0039523 Ga0495606_0039523_693_1676 327
448 3300046513 Ga0495616_0023653 Ga0495616_0023653_1459_2442 327
449 3300046523 Ga0495644_0001396 Ga0495644_0001396_2260_3243 327
450 3300046524 Ga0495648_0011917 Ga0495648_0011917_1381_2364 327
451 3300046530 Ga0495654_0000052 Ga0495654_0000052_79283_80266 327
452 3300046694 Ga0495649_0070585 Ga0495649_0070585_158_1141 327
453 3300046794 Ga0495589_0023999 Ga0495589_0023999_519_1502 327
454 3300046810 Ga0495660_0000038 Ga0495660_0000038_11520_12503 327
455 3300047320 Ga0495672_0000002 Ga0495672_0000002_91628_92611 327
456 3300047323 Ga0495683_0026201 Ga0495683_0026201_1114_2097 327
457 3300047323 Ga0495683_0062691 Ga0495683_0062691_72_1055 327
458 3300047469 Ga0495673_0000095 Ga0495673_0000095_104726_105709 327
459 3300048919 Ga0496116_0007716 Ga0496116_0007716_3415_4398 327
460 3300048922 Ga0496119_0004820 Ga0496119_0004820_7216_8199 327
461 3300048923 Ga0496120_0000040 Ga0496120_0000040_167239_168222 327
462 3300048927 Ga0496124_0000399 Ga0496124_0000399_72497_73480 327
463 3300049459 Ga0495678_000118 Ga0495678_000118_39670_40653 327
464 3300049460 Ga0495682_0000015 Ga0495682_0000015_145812_146795 327
465 3300053126 Ga0500621_000001 Ga0500621_000001_727243_728226 327
466 3300009011 Ga0105251_10007051 Ga0105251_100070512 328
467 3300009036 Ga0105244_10042448 Ga0105244_100424481 328
468 3300009092 Ga0105250_10013792 Ga0105250_100137922 328
469 3300025735 Ga0207713_1000001 Ga0207713_1000001514 328
470 3300047470 Ga0495681_0032917 Ga0495681_0032917_404_1393 328
471 3300048909 Ga0496106_0185595 Ga0496106_0185595_231_1217 328
472 3300048925 Ga0496122_0009988 Ga0496122_0009988_4164_5150 328
473 3300048926 Ga0496123_0007619 Ga0496123_0007619_4419_5405 328
474 3300048927 Ga0496124_0073353 Ga0496124_0073353_1107_2093 328
475 2162886007 SwRhRL2b_contig_1623572 SwRhRL2b_0331.00002030 329
476 3300002737 JGI25162J39368_1000035 JGI25162J39368_100003520 329
477 3300002771 JGI25163J39215_1000086 JGI25163J39215_100008619 329
478 3300002772 JGI25164J39214_1000019 JGI25164J39214_100001920 329
479 3300003751 Ga0055538_1000039 Ga0055538_100003920 329
480 3300003752 Ga0055539_1000050 Ga0055539_1000050150 329
481 3300003756 Ga0055533_1000062 Ga0055533_100006220 329
482 3300003759 Ga0055525_1000072 Ga0055525_1000072150 329
483 3300003841 Ga0055541_1000038 Ga0055541_1000038150 329
484 3300003856 Ga0058692_1000624 Ga0058692_10006242 329
485 3300003856 Ga0058692_1004889 Ga0058692_10048892 329
486 3300003856 Ga0058692_1004890 Ga0058692_10048902 329
487 3300005289 Ga0065704_10000532 Ga0065704_1000053212 329
488 3300006051 Ga0075364_10020360 Ga0075364_100203602 329
489 3300009011 Ga0105251_10004692 Ga0105251_100046925 329
490 3300009011 Ga0105251_10005665 Ga0105251_100056655 329
491 3300009036 Ga0105244_10002226 Ga0105244_1000222611 329
492 3300009036 Ga0105244_10012549 Ga0105244_100125492 329
493 3300009036 Ga0105244_10056550 Ga0105244_100565502 329
494 3300009092 Ga0105250_10000168 Ga0105250_1000016837 329
495 3300011119 Ga0105246_10015720 Ga0105246_100157204 329
496 3300013100 Ga0157373_10001881 Ga0157373_100018815 329
497 3300013102 Ga0157371_10000288 Ga0157371_1000028856 329
498 3300013102 Ga0157371_10003619 Ga0157371_100036195 329
499 3300013104 Ga0157370_10004586 Ga0157370_100045865 329
500 3300013306 Ga0163162_10039479 Ga0163162_100394794 329
501 3300015261 Ga0182006_1000022 Ga0182006_100002223 329
502 3300025207 Ga0209760_100002 Ga0209760_10000270 329
503 3300025224 Ga0209784_100001 Ga0209784_1000012737 329
504 3300025225 Ga0209566_100001 Ga0209566_1000012737 329
505 3300025226 Ga0209674_100002 Ga0209674_1000022737 329
506 3300025230 Ga0209563_100002 Ga0209563_1000021272 329
507 3300025231 Ga0207427_100012 Ga0207427_10001278 329
508 3300025233 Ga0209437_100001 Ga0209437_1000011272 329
509 3300025253 Ga0209677_100002 Ga0209677_1000021272 329
510 3300025711 Ga0207696_1000070 Ga0207696_1000070220 329
511 3300025711 Ga0207696_1000287 Ga0207696_100028712 329
512 3300025728 Ga0207655_1000155 Ga0207655_100015579 329
513 3300025728 Ga0207655_1013040 Ga0207655_10130402 329
514 3300025728 Ga0207655_1048040 Ga0207655_10480402 329
515 3300025735 Ga0207713_1005255 Ga0207713_10052557 329
516 3300025735 Ga0207713_1013132 Ga0207713_10131326 329
517 3300027312 Ga0209371_1000010 Ga0209371_1000010347 329
518 3300027312 Ga0209371_1000785 Ga0209371_100078517 329
519 3300030500 Ga0268256_1000092 Ga0268256_1000092141 329
520 3300030500 Ga0268256_1000639 Ga0268256_10006393 329
521 3300030500 Ga0268256_1010532 Ga0268256_10105322 329
522 3300041405 Ga0439438_010591 Ga0439438_010591_917_1906 329
523 3300042010 Ga0439452_000003 Ga0439452_000003_220574_221563 329
524 3300046452 Ga0495617_050496 Ga0495617_050496_175_1176 329
525 3300046458 Ga0495591_000014 Ga0495591_000014_76428_77429 329
526 3300046471 Ga0495650_0000018 Ga0495650_0000018_368118_369107 329
527 3300046500 Ga0495596_0051390 Ga0495596_0051390_524_1519 329
528 3300046530 Ga0495654_0000049 Ga0495654_0000049_45999_47000 329
529 3300046616 Ga0495668_0018329 Ga0495668_0018329_1812_2813 329
530 3300046810 Ga0495660_0000004 Ga0495660_0000004_615964_616953 329
531 3300048903 Ga0496100_0177317 Ga0496100_0177317_352_1353 329
532 3300048904 Ga0496101_0000863 Ga0496101_0000863_4183_5184 329
533 3300048907 Ga0496104_0009616 Ga0496104_0009616_2123_3112 329
534 3300048919 Ga0496116_0000083 Ga0496116_0000083_167351_168340 329
535 3300048920 Ga0496117_0004573 Ga0496117_0004573_8523_9512 329
536 3300048920 Ga0496117_0057692 Ga0496117_0057692_179_1180 329
537 3300048920 Ga0496117_0129058 Ga0496117_0129058_409_1398 329
538 3300048921 Ga0496118_0002474 Ga0496118_0002474_19270_20259 329
539 3300048921 Ga0496118_0003989 Ga0496118_0003989_12478_13467 329
540 3300048921 Ga0496118_0167116 Ga0496118_0167116_124_1125 329
541 3300048922 Ga0496119_0012903 Ga0496119_0012903_2991_3992 329
542 3300048923 Ga0496120_0000075 Ga0496120_0000075_5026_6030 329
543 3300048923 Ga0496120_0002562 Ga0496120_0002562_11102_12103 329
544 3300048925 Ga0496122_0000007 Ga0496122_0000007_542636_543625 329
545 3300048925 Ga0496122_0018840 Ga0496122_0018840_4167_5168 329
546 3300048926 Ga0496123_0000004 Ga0496123_0000004_233605_234594 329
547 3300048926 Ga0496123_0019753 Ga0496123_0019753_3648_4649 329
548 3300048927 Ga0496124_0000369 Ga0496124_0000369_23239_24228 329
549 3300048927 Ga0496124_0025074 Ga0496124_0025074_976_1980 329
550 3300048927 Ga0496124_0049363 Ga0496124_0049363_2467_3468 329
551 3300048928 Ga0496125_0000013 Ga0496125_0000013_37698_38687 329
552 3300048929 Ga0496126_0000562 Ga0496126_0000562_15937_16926 329
553 3300048929 Ga0496126_0037666 Ga0496126_0037666_1295_2296 329
554 3300048929 Ga0496126_0262965 Ga0496126_0262965_402_1403 329
555 3300050491 nmdc:mga00v17_37448_c1 nmdc:mga00v17_37448_c1_1868_2869 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02606

LpxK

Tetraacyldisaccharide-1-P 4'-kinase

12

322

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.8265 16 324
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.8097 16 324
5a5g-assembly1.cif.gz_A crystal structure of fthfs2 from t.acetoxydans re1 0.7847 46 85
7xzn-assembly1.cif.gz_A formate-tetrahydrofolate ligase from peptostreptococcus anaerobius 0.674 38 88
3tk1-assembly1.cif.gz_A crystal structure of a meab and rv1496 ortholog from mycobacterium thermoresistible bound to gdp 0.6347 44 201
ID Description Score Start End Superfamily
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9785 15 320 3.40.50.300
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9599 15 320 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8292 20 324 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7701 20 324 3.40.50.300
af_A0A1D6KF80_27_384_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7665 22 320 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3B0XCW4-F1-model_v4 tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.9826 10 162 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A261QNM8-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9751 1 327 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A5W3REE6-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.9745 82 323 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A379WX14-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.9741 180 324 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-F4N4M8-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9736 46 324 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245

Feature Viewer

pLDDT pTM Quality
86.68 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map