F463073

General Info

Members Datasets Scaffolds Average Seq Length
555 271 1110 198

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10159486|Ga0070691_101594862
Length 206
Sequence MRRIALLTGFLALLAAGAARADAIEVRDAALRVVEEGLVLDADFDFELTPRLAEVVANGVPLYFRVEFELTRPRWYWFDERAASRLLQMRLSYHALSRHYRLSAGTQPERFMLQQNFATLEDALKVLKRVRNWLVLERAAGISRSDYDAAVRMRLDTTLLPKPFQLSALTSRELHLESPWKRFVLRSPQQVPAPVESIEPKKAAAR

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
147 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
151 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
182 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
187 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.36
Rhizosphere 99.64
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10159486 3300005341 Bacteria 1162
2 JGI25406J46586_10045579 3300003203 Bacteria 1508
3 Ga0065707_10012777 3300005295 Unclassified 2063
4 Ga0065707_10091059 3300005295 Bacteria 4014
5 Ga0065707_10422218 3300005295 Bacteria 829
6 Ga0065707_10433339 3300005295 Bacteria 818
7 Ga0070676_10117618 3300005328 Bacteria 1664
8 Ga0070690_100000082 3300005330 Bacteria 46700
9 Ga0070690_100161145 3300005330 Bacteria 1537
10 Ga0068869_100000044 3300005334 Bacteria 52351
11 Ga0068869_100139584 3300005334 Bacteria 1870
12 Ga0070666_10075840 3300005335 Bacteria 2293
13 Ga0070680_100000771 3300005336 Bacteria 22468
14 Ga0070680_100043245 3300005336 Bacteria 3659
15 Ga0070680_100265676 3300005336 Bacteria 1452
16 Ga0070682_100080731 3300005337 Bacteria 2104
17 Ga0068868_100000780 3300005338 Bacteria 21561
18 Ga0068868_100143534 3300005338 Bacteria 1962
19 Ga0068868_100399774 3300005338 Bacteria 1185
20 Ga0068868_100402997 3300005338 Bacteria 1181
21 Ga0070689_100002046 3300005340 Bacteria 13088
22 Ga0070689_100074829 3300005340 Bacteria 2650
23 Ga0070691_10000079 3300005341 Bacteria 26738
24 Ga0070687_100000034 3300005343 Bacteria 43229
25 Ga0070687_100039763 3300005343 Bacteria 2365
26 Ga0070687_100072962 3300005343 Bacteria 1848
27 Ga0070687_100329639 3300005343 Bacteria 978
28 Ga0070668_100012347 3300005347 Bacteria 6361
29 Ga0070669_100357931 3300005353 Bacteria 1186
30 Ga0070669_100858560 3300005353 Unclassified 774
31 Ga0070675_100007884 3300005354 Bacteria 8254
32 Ga0070675_100744755 3300005354 Unclassified 894
33 Ga0070673_100093425 3300005364 Bacteria 2463
34 Ga0070667_101274264 3300005367 Unclassified 688
35 Ga0070703_10005461 3300005406 Bacteria 3554
36 Ga0070709_10160134 3300005434 Bacteria 1564
37 Ga0070710_10035208 3300005437 Bacteria 2729
38 Ga0070701_10000247 3300005438 Bacteria 17402
39 Ga0070701_10056487 3300005438 Bacteria 2054
40 Ga0070701_10299829 3300005438 Bacteria 987
41 Ga0070711_100041319 3300005439 Bacteria 3114
42 Ga0070705_100000030 3300005440 Bacteria 71489
43 Ga0070705_100118981 3300005440 Bacteria 1702
44 Ga0070705_100275158 3300005440 Bacteria 1194
45 Ga0070705_100516292 3300005440 Unclassified 910
46 Ga0070705_101053708 3300005440 Unclassified 663
47 Ga0070700_100001187 3300005441 Bacteria 12899
48 Ga0070700_100002744 3300005441 Bacteria 9006
49 Ga0070700_100503759 3300005441 Bacteria 932
50 Ga0070694_100000202 3300005444 Bacteria 31690
51 Ga0070694_100005384 3300005444 Bacteria 7745
52 Ga0070694_100098869 3300005444 Bacteria 2061
53 Ga0070694_100604401 3300005444 Bacteria 883
54 Ga0070694_100666748 3300005444 Bacteria 843
55 Ga0070681_10000257 3300005458 Bacteria 42143
56 Ga0070681_10201540 3300005458 Bacteria 1908
57 Ga0068867_100000032 3300005459 Bacteria 84727
58 Ga0068867_100000126 3300005459 Bacteria 49231
59 Ga0068867_100390428 3300005459 Bacteria 1171
60 Ga0070706_100455766 3300005467 Bacteria 1190
61 Ga0070698_100448231 3300005471 Bacteria 1226
62 Ga0070699_101329823 3300005518 Bacteria 659
63 Ga0070679_100004882 3300005530 Bacteria 12368
64 Ga0070684_100024281 3300005535 Bacteria 5083
65 Ga0070697_100001805 3300005536 Bacteria 16337
66 Ga0070697_100196066 3300005536 Bacteria 1715
67 Ga0068853_100720965 3300005539 Bacteria 952
68 Ga0070672_100213794 3300005543 Bacteria 1616
69 Ga0070686_100000286 3300005544 Bacteria 34009
70 Ga0070686_100013122 3300005544 Bacteria 4731
71 Ga0070686_100154944 3300005544 Bacteria 1608
72 Ga0070686_100439233 3300005544 Bacteria 1001
73 Ga0070695_100000818 3300005545 Bacteria 16783
74 Ga0070695_100158687 3300005545 Bacteria 1585
75 Ga0070695_100428986 3300005545 Bacteria 1008
76 Ga0070696_100000344 3300005546 Bacteria 28208
77 Ga0070696_100005765 3300005546 Bacteria 8268
78 Ga0070696_100124529 3300005546 Unclassified 1869
79 Ga0070696_100130661 3300005546 Bacteria 1827
80 Ga0070696_100168607 3300005546 Bacteria 1617
81 Ga0070696_100191285 3300005546 Bacteria 1523
82 Ga0070696_100192339 3300005546 Bacteria 1519
83 Ga0070696_100510923 3300005546 Bacteria 957
84 Ga0070696_100518327 3300005546 Bacteria 951
85 Ga0070693_100000100 3300005547 Bacteria 38176
86 Ga0070693_100166047 3300005547 Bacteria 1410
87 Ga0070704_100000159 3300005549 Bacteria 26321
88 Ga0070704_100009938 3300005549 Bacteria 5777
89 Ga0070704_100197327 3300005549 Bacteria 1622
90 Ga0070704_101034007 3300005549 Bacteria 744
91 Ga0068855_100000695 3300005563 Bacteria 41137
92 Ga0068855_100555021 3300005563 Bacteria 1243
93 Ga0068854_100025568 3300005578 Bacteria 4052
94 Ga0068856_100042208 3300005614 Bacteria 4487
95 Ga0068856_100371922 3300005614 Bacteria 1448
96 Ga0068856_100597995 3300005614 Bacteria 1124
97 Ga0070702_100000001 3300005615 Bacteria 87224
98 Ga0070702_100046156 3300005615 Bacteria 2468
99 Ga0070702_100424242 3300005615 Bacteria 958
100 Ga0070702_100445982 3300005615 Bacteria 938
101 Ga0068852_100066231 3300005616 Bacteria 3154
102 Ga0068859_100001620 3300005617 Bacteria 23013
103 Ga0068859_100018583 3300005617 Bacteria 6988
104 Ga0068859_100388507 3300005617 Bacteria 1491
105 Ga0068864_100166248 3300005618 Bacteria 2008
106 Ga0068866_10215718 3300005718 Bacteria 1155
107 Ga0068861_100000057 3300005719 Bacteria 52351
108 Ga0068861_100000134 3300005719 Bacteria 38219
109 Ga0068870_10181724 3300005840 Bacteria 1263
110 Ga0068858_100000289 3300005842 Bacteria 54365
111 Ga0068858_100097668 3300005842 Bacteria 2738
112 Ga0068858_100553809 3300005842 Bacteria 1113
113 Ga0068860_100004021 3300005843 Bacteria 15102
114 Ga0068860_100142708 3300005843 Unclassified 2303
115 Ga0068860_100506303 3300005843 Bacteria 1206
116 Ga0068860_100813832 3300005843 Bacteria 948
117 Ga0068862_100000583 3300005844 Bacteria 37988
118 Ga0068862_100001111 3300005844 Bacteria 25519
119 Ga0068862_100146396 3300005844 Bacteria 2100
120 Ga0068862_100268040 3300005844 Bacteria 1561
121 Ga0081538_10099149 3300005981 Unclassified 1473
122 Ga0081539_10002484 3300005985 Bacteria 25931
123 Ga0097621_100000368 3300006237 Bacteria 31276
124 Ga0097621_100000927 3300006237 Bacteria 20534
125 Ga0068871_100000246 3300006358 Bacteria 37632
126 Ga0068871_100003416 3300006358 Bacteria 10916
127 Ga0068871_100232011 3300006358 Bacteria 1602
128 Ga0068871_101067921 3300006358 Bacteria 754
129 Ga0075428_100000083 3300006844 Bacteria 78689
130 Ga0075428_100509725 3300006844 Bacteria 1287
131 Ga0075430_100000063 3300006846 Bacteria 57435
132 Ga0075430_100006901 3300006846 Bacteria 9573
133 Ga0075431_100015155 3300006847 Bacteria 7809
134 Ga0075431_100029695 3300006847 Bacteria 5629
135 Ga0075431_100113319 3300006847 Bacteria 2799
136 Ga0075431_100132949 3300006847 Bacteria 2565
137 Ga0075433_10003931 3300006852 Bacteria 11508
138 Ga0075433_10027271 3300006852 Bacteria 4842
139 Ga0075433_10165962 3300006852 Bacteria 1965
140 Ga0075433_10899415 3300006852 Bacteria 772
141 Ga0075434_100000064 3300006871 Bacteria 54394
142 Ga0075434_100016529 3300006871 Bacteria 7094
143 Ga0075434_100053099 3300006871 Bacteria 4027
144 Ga0075429_100001065 3300006880 Bacteria 21974
145 Ga0075429_100019585 3300006880 Bacteria 5865
146 Ga0068865_100000327 3300006881 Bacteria 26283
147 Ga0068865_100026071 3300006881 Bacteria 3851
148 Ga0075436_100000050 3300006914 Bacteria 71245
149 Ga0075436_100003460 3300006914 Bacteria 10826
150 Ga0075436_100034075 3300006914 Bacteria 3510
151 Ga0097620_100001620 3300006931 Bacteria 23013
152 Ga0097620_100018583 3300006931 Bacteria 6988
153 Ga0097620_100388541 3300006931 Bacteria 1491
154 Ga0075435_100000260 3300007076 Bacteria 32721
155 Ga0075435_100002126 3300007076 Bacteria 13046
156 Ga0075435_100013750 3300007076 Bacteria 6031
157 Ga0075435_100020168 3300007076 Bacteria 5102
158 Ga0075435_100331704 3300007076 Bacteria 1303
159 Ga0111539_10003219 3300009094 Bacteria 21595
160 Ga0111539_10008749 3300009094 Bacteria 12841
161 Ga0111539_10041451 3300009094 Bacteria 5536
162 Ga0111539_10085337 3300009094 Bacteria 3711
163 Ga0111539_10240521 3300009094 Bacteria 2107
164 Ga0105245_10000075 3300009098 Bacteria 103550
165 Ga0105245_10461920 3300009098 Bacteria 1280
166 Ga0105245_10478149 3300009098 Unclassified 1259
167 Ga0114129_10001164 3300009147 Bacteria 34871
168 Ga0114129_10110095 3300009147 Bacteria 3802
169 Ga0114129_10291815 3300009147 Bacteria 2176
170 Ga0114129_10298511 3300009147 Bacteria 2148
171 Ga0114129_10989165 3300009147 Bacteria 1060
172 Ga0114129_11310859 3300009147 Unclassified 897
173 Ga0105243_10001533 3300009148 Bacteria 20197
174 Ga0105243_10003894 3300009148 Bacteria 11915
175 Ga0105241_10020104 3300009174 Bacteria 4932
176 Ga0105242_10000359 3300009176 Bacteria 36471
177 Ga0105242_10000823 3300009176 Bacteria 24120
178 Ga0105248_10971398 3300009177 Bacteria 959
179 Ga0105249_10010306 3300009553 Bacteria 8212
180 Ga0105249_10011629 3300009553 Bacteria 7738
181 Ga0105246_10337310 3300011119 Bacteria 1231
182 Ga0157369_11102130 3300013105 Unclassified 811
183 Ga0157378_10000074 3300013297 Bacteria 90608
184 Ga0157380_10003099 3300014326 Bacteria 11340
185 Ga0157380_10012618 3300014326 Bacteria 6131
186 Ga0157377_10159148 3300014745 Bacteria 1403
187 Ga0157376_10015737 3300014969 Bacteria 5723
188 Ga0157376_10084950 3300014969 Bacteria 2726
189 Ga0207653_10009902 3300025885 Bacteria 2972
190 Ga0207642_10003500 3300025899 Bacteria 4961
191 Ga0207688_10401305 3300025901 Bacteria 850
192 Ga0207680_10245658 3300025903 Bacteria 1235
193 Ga0207685_10021986 3300025905 Bacteria 2147
194 Ga0207699_10665556 3300025906 Bacteria 761
195 Ga0207645_10047899 3300025907 Bacteria 2729
196 Ga0207645_10113741 3300025907 Bacteria 1753
197 Ga0207643_10193448 3300025908 Bacteria 1236
198 Ga0207643_10252399 3300025908 Bacteria 1087
199 Ga0207684_10449199 3300025910 Bacteria 1107
200 Ga0207654_10012040 3300025911 Bacteria 4424
201 Ga0207707_10005329 3300025912 Bacteria 11240
202 Ga0207707_10107082 3300025912 Bacteria 2444
203 Ga0207695_10380068 3300025913 Bacteria 1298
204 Ga0207663_10184505 3300025916 Unclassified 1493
205 Ga0207660_10013906 3300025917 Bacteria 5281
206 Ga0207660_10031530 3300025917 Bacteria 3652
207 Ga0207660_10173846 3300025917 Bacteria 1669
208 Ga0207662_10000319 3300025918 Bacteria 21867
209 Ga0207662_10007825 3300025918 Bacteria 5823
210 Ga0207662_10028980 3300025918 Bacteria 3205
211 Ga0207662_10167540 3300025918 Bacteria 1407
212 Ga0207646_10291430 3300025922 Bacteria 1475
213 Ga0207681_10000301 3300025923 Bacteria 36454
214 Ga0207681_10312142 3300025923 Bacteria 1247
215 Ga0207659_10057259 3300025926 Bacteria 2794
216 Ga0207659_10209648 3300025926 Bacteria 1561
217 Ga0207687_10000832 3300025927 Bacteria 20844
218 Ga0207686_10001412 3300025934 Bacteria 13640
219 Ga0207686_10014439 3300025934 Bacteria 4397
220 Ga0207709_10000711 3300025935 Bacteria 26768
221 Ga0207709_10002128 3300025935 Bacteria 12728
222 Ga0207670_10002481 3300025936 Bacteria 9687
223 Ga0207670_10035961 3300025936 Bacteria 3217
224 Ga0207670_10048018 3300025936 Bacteria 2846
225 Ga0207670_10067142 3300025936 Bacteria 2467
226 Ga0207704_10000292 3300025938 Bacteria 23710
227 Ga0207704_10000660 3300025938 Bacteria 15241
228 Ga0207704_10480794 3300025938 Bacteria 997
229 Ga0207665_10047720 3300025939 Bacteria 2872
230 Ga0207691_10531130 3300025940 Bacteria 998
231 Ga0207711_10164270 3300025941 Bacteria 2012
232 Ga0207711_10688435 3300025941 Unclassified 953
233 Ga0207689_10000007 3300025942 Bacteria 132362
234 Ga0207689_10012667 3300025942 Bacteria 7205
235 Ga0207689_10514130 3300025942 Unclassified 1004
236 Ga0207667_10045637 3300025949 Bacteria 4640
237 Ga0207667_10285933 3300025949 Bacteria 1685
238 Ga0207651_10066743 3300025960 Bacteria 2529
239 Ga0207651_10120563 3300025960 Bacteria 1988
240 Ga0207651_10153527 3300025960 Bacteria 1796
241 Ga0207712_10006247 3300025961 Bacteria 7509
242 Ga0207712_10011207 3300025961 Bacteria 5709
243 Ga0207668_10007568 3300025972 Bacteria 6464
244 Ga0207640_10043507 3300025981 Bacteria 2871
245 Ga0207658_11073265 3300025986 Unclassified 735
246 Ga0207677_10001738 3300026023 Bacteria 11555
247 Ga0207703_10000606 3300026035 Bacteria 36379
248 Ga0207703_10079516 3300026035 Bacteria 2728
249 Ga0207703_10808390 3300026035 Bacteria 895
250 Ga0207639_11155397 3300026041 Unclassified 726
251 Ga0207708_10000086 3300026075 Bacteria 73314
252 Ga0207708_10000697 3300026075 Bacteria 25504
253 Ga0207708_10774211 3300026075 Bacteria 825
254 Ga0207702_10017383 3300026078 Bacteria 5951
255 Ga0207702_10061938 3300026078 Bacteria 3193
256 Ga0207702_10318489 3300026078 Bacteria 1481
257 Ga0207641_10076138 3300026088 Bacteria 2900
258 Ga0207648_10000079 3300026089 Bacteria 92044
259 Ga0207648_10000352 3300026089 Bacteria 50550
260 Ga0207648_10347786 3300026089 Bacteria 1336
261 Ga0207648_10444547 3300026089 Bacteria 1180
262 Ga0207676_10072364 3300026095 Unclassified 2771
263 Ga0207676_10097305 3300026095 Bacteria 2431
264 Ga0207675_100000093 3300026118 Bacteria 70343
265 Ga0207675_100000223 3300026118 Bacteria 53251
266 Ga0207675_101304744 3300026118 Bacteria 746
267 Ga0207683_10531499 3300026121 Bacteria 1087
268 Ga0209967_1017464 3300027364 Bacteria 1035
269 Ga0209981_1001021 3300027378 Bacteria 3539
270 Ga0209981_1009862 3300027378 Bacteria 1308
271 Ga0209981_1022771 3300027378 Bacteria 899
272 Ga0209996_1013243 3300027395 Bacteria 1113
273 Ga0210000_1004369 3300027462 Bacteria 2043
274 Ga0210000_1025507 3300027462 Bacteria 914
275 Ga0209995_1006185 3300027471 Bacteria 1925
276 Ga0209999_1000687 3300027543 Bacteria 5471
277 Ga0209970_1028308 3300027614 Bacteria 967
278 Ga0209983_1002209 3300027665 Bacteria 4283
279 Ga0209588_1007008 3300027671 Bacteria 3304
280 Ga0209588_1016176 3300027671 Bacteria 2299
281 Ga0209971_1043655 3300027682 Unclassified 1080
282 Ga0209966_1002603 3300027695 Bacteria 3012
283 Ga0209966_1008975 3300027695 Unclassified 1781
284 Ga0209998_10006830 3300027717 Bacteria 2368
285 Ga0209974_10075568 3300027876 Bacteria 1154
286 Ga0207428_10000321 3300027907 Bacteria 62664
287 Ga0207428_10028576 3300027907 Bacteria 4632
288 Ga0207428_10095016 3300027907 Bacteria 2310
289 Ga0207428_10255647 3300027907 Bacteria 1305
290 Ga0207428_10494055 3300027907 Bacteria 889
291 Ga0268265_10000579 3300028380 Bacteria 37090
292 Ga0268265_10005154 3300028380 Bacteria 8951
293 Ga0268265_10033842 3300028380 Bacteria 3719
294 Ga0268265_10393315 3300028380 Bacteria 1279
295 Ga0268264_10001253 3300028381 Bacteria 24204
296 Ga0268264_10113513 3300028381 Bacteria 2377
297 Ga0268264_10519347 3300028381 Bacteria 1164
298 Ga0307408_100064063 3300031548 Bacteria 2691
299 Ga0307408_100950247 3300031548 Unclassified 789
300 Ga0316575_10024709 3300031665 Bacteria 2327
301 Ga0316579_10000235 3300031691 Bacteria 16905
302 Ga0316578_10001845 3300031728 Bacteria 8908
303 Ga0316583_10001540 3300032133 Bacteria 7743
304 Ga0316583_10006500 3300032133 Bacteria 4199
305 Ga0373930_0004162 3300034816 Bacteria 2340
306 Ga0373948_0003815 3300034817 Bacteria 2345
307 Ga0373958_0008305 3300034819 Bacteria 1678
308 Ga0373926_0001423 3300035083 Bacteria 7276
309 Ga0373928_0011079 3300035084 Bacteria 1779
310 Ga0373928_0017323 3300035084 Bacteria 1482
311 Ga0373929_0016877 3300035085 Bacteria 1436
312 Ga0373940_0006582 3300035088 Bacteria 2584
313 Ga0373944_0002534 3300035089 Bacteria 4640
314 Ga0373949_0003832 3300035090 Bacteria 3501
315 Ga0373951_0002918 3300035091 Bacteria 4251
316 Ga0373952_0003595 3300035092 Bacteria 2796
317 Ga0373952_0011244 3300035092 Bacteria 1743
318 Ga0373952_0050122 3300035092 Bacteria 993
319 Ga0373923_0080946 3300035111 Bacteria 1409
320 Ga0373936_0005049 3300035113 Bacteria 4965
321 Ga0373936_0047227 3300035113 Bacteria 1736
322 Ga0373939_0201302 3300035114 Unclassified 753
323 Ga0373941_0035719 3300035115 Bacteria 1507
324 Ga0373941_0062674 3300035115 Bacteria 1214
325 Ga0373941_0110145 3300035115 Bacteria 970
326 Ga0373945_0006474 3300035116 Bacteria 3779
327 Ga0373953_0001215 3300035117 Bacteria 7337
328 Ga0373953_0032392 3300035117 Bacteria 2039
329 Ga0373954_0000002 3300035118 Bacteria 147478
330 Ga0373954_0122266 3300035118 Bacteria 1264
331 Ga0373960_0008088 3300035121 Bacteria 2511
332 Ga0373960_0008711 3300035121 Bacteria 2439
333 Ga0373960_0076433 3300035121 Unclassified 1046
334 Ga0373943_0040586 3300035170 Bacteria 2247
335 Ga0373946_0003690 3300035171 Bacteria 5425
336 Ga0373946_0182161 3300035171 Bacteria 997
337 Ga0373955_0002137 3300035172 Bacteria 8539
338 Ga0373955_0010473 3300035172 Bacteria 4382
339 Ga0373942_0019948 3300035207 Bacteria 1679
340 Ga0373942_0045746 3300035207 Bacteria 1210
341 Ga0373962_0034016 3300035242 Bacteria 1409
342 Ga0316574_0217533 3300035398 Bacteria 1225
343 Ga0373924_0004868 3300035410 Bacteria 4717
344 Ga0373924_0009924 3300035410 Bacteria 3503
345 Ga0373924_0012888 3300035410 Bacteria 3132
346 Ga0373931_0000134 3300035691 Bacteria 33430
347 Ga0373931_0002977 3300035691 Bacteria 7567
348 Ga0373931_0004561 3300035691 Bacteria 6336
349 Ga0373931_0250381 3300035691 Unclassified 1077
350 Ga0373935_0012022 3300035692 Bacteria 5202
351 Ga0373935_0015429 3300035692 Bacteria 4618
352 Ga0373927_0042855 3300035695 Bacteria 2932
353 Ga0373927_0043694 3300035695 Bacteria 2900
354 Ga0373933_0036551 3300035724 Bacteria 2875
355 Ga0373933_0474167 3300035724 Archaea 819
356 Ga0373947_0053589 3300035725 Bacteria 2432
357 Ga0373947_0578632 3300035725 Unclassified 765
358 Ga0373937_0000646 3300036401 Bacteria 30603
359 Ga0373937_0006721 3300036401 Bacteria 9921
360 Ga0373937_0018224 3300036401 Bacteria 6266
361 Ga0373937_0039910 3300036401 Bacteria 4278
362 Ga0373937_0272028 3300036401 Bacteria 1599
363 Ga0373937_0311226 3300036401 Bacteria 1490
364 Ga0373937_0390844 3300036401 Bacteria 1319
365 Ga0316582_0000784 3300036647 Bacteria 12827
366 Ga0316584_0257507 3300036712 Bacteria 1273
367 Ga0373925_0022805 3300037068 Bacteria 4569
368 Ga0373925_0027389 3300037068 Bacteria 4171
369 Ga0373925_0181953 3300037068 Bacteria 1664
370 Ga0316581_0005299 3300037588 Bacteria 3349
371 Ga0439453_0000413 3300041408 Bacteria 4604
372 Ga0451807_1154876 3300041486 Bacteria 3129
373 Ga0439441_000175 3300042001 Bacteria 5721
374 Ga0439441_000300 3300042001 Bacteria 4958
375 Ga0439441_003526 3300042001 Bacteria 2315
376 Ga0439442_051484 3300042002 Bacteria 869
377 Ga0439443_001970 3300042003 Bacteria 2383
378 Ga0439456_013918 3300042013 Bacteria 1676
379 Ga0439446_0011264 3300042156 Bacteria 2425
380 Ga0439446_0035582 3300042156 Bacteria 1453
381 Ga0439446_0079714 3300042156 Bacteria 1013
382 Ga0439434_0000165 3300042435 Bacteria 17901
383 Ga0439434_0055467 3300042435 Bacteria 1233
384 Ga0439435_0000132 3300042436 Bacteria 9910
385 Ga0439435_0011080 3300042436 Bacteria 2156
386 Ga0439444_0010082 3300042437 Bacteria 1503
387 Ga0439444_0016698 3300042437 Bacteria 1252
388 Ga0439460_0000243 3300042461 Bacteria 11109
389 Ga0439460_0001886 3300042461 Bacteria 5004
390 Ga0450893_0012037 3300042532 Bacteria 1434
391 Ga0451577_0149036 3300042876 Bacteria 2104
392 Ga0466957_0109729 3300044842 Bacteria 1749
393 Ga0451576_0005699 3300045051 Bacteria 15536
394 Ga0451576_0043018 3300045051 Bacteria 4767
395 Ga0451576_0430506 3300045051 Bacteria 1384
396 Ga0451576_1121439 3300045051 Unclassified 823
397 Ga0495592_0019870 3300046454 Bacteria 5107
398 Ga0495603_0116160 3300046455 Bacteria 1560
399 Ga0495641_0031513 3300046461 Bacteria 2533
400 Ga0495651_0260565 3300046462 Bacteria 1180
401 Ga0495580_0028878 3300046472 Bacteria 4029
402 Ga0495582_0013615 3300046473 Bacteria 4478
403 Ga0495639_0007114 3300046475 Bacteria 4806
404 Ga0495639_0069489 3300046475 Bacteria 1625
405 Ga0495662_0013077 3300046476 Bacteria 4042
406 Ga0495608_0000913 3300046511 Bacteria 20720
407 Ga0495628_0004622 3300046516 Bacteria 12162
408 Ga0495628_0547790 3300046516 Bacteria 831
409 Ga0495630_0035426 3300046517 Bacteria 3729
410 Ga0495630_0269682 3300046517 Bacteria 1300
411 Ga0495666_0040539 3300046526 Bacteria 2257
412 Ga0495666_0177718 3300046526 Bacteria 983
413 Ga0495652_0081831 3300046529 Bacteria 2663
414 Ga0495665_0016002 3300046531 Bacteria 4042
415 Ga0495640_0001515 3300046533 Bacteria 18292
416 Ga0495586_0001426 3300046535 Bacteria 13223
417 Ga0495586_0025477 3300046535 Bacteria 3165
418 Ga0495586_0215998 3300046535 Bacteria 1089
419 Ga0495645_0092243 3300046543 Bacteria 2163
420 Ga0495667_0005087 3300046559 Bacteria 8891
421 Ga0495667_0064899 3300046559 Bacteria 2388
422 Ga0495656_0005519 3300046615 Bacteria 4370
423 Ga0495634_0036458 3300046642 Bacteria 3363
424 Ga0495634_0420173 3300046642 Bacteria 792
425 Ga0495635_0235012 3300046663 Bacteria 1237
426 Ga0495657_0310915 3300046675 Archaea 938
427 Ga0495623_0399543 3300046679 Unclassified 740
428 Ga0495647_0000674 3300046681 Bacteria 10164
429 Ga0495658_0001043 3300046683 Bacteria 14639
430 Ga0495658_0041954 3300046683 Bacteria 2552
431 Ga0495613_0021648 3300046689 Bacteria 4789
432 Ga0495624_0042710 3300046690 Bacteria 2897
433 Ga0495624_0119077 3300046690 Bacteria 1622
434 Ga0495600_0020498 3300046809 Bacteria 4228
435 Ga0495581_0226858 3300047315 Bacteria 1093
436 Ga0495636_0012131 3300047318 Bacteria 3413
437 Ga0495680_0001187 3300047322 Bacteria 28585
438 Ga0495680_0059099 3300047322 Bacteria 2961
439 Ga0495593_0043827 3300047673 Bacteria 2396
440 Ga0496106_0414772 3300048909 Bacteria 1082
441 Ga0501032_0050336 3300049569 Bacteria 2809
442 Ga0501033_0004036 3300049570 Bacteria 11859
443 Ga0501033_0377636 3300049570 Bacteria 990
444 Ga0501036_0000314 3300049572 Bacteria 33786
445 Ga0501036_0297896 3300049572 Bacteria 1349
446 Ga0501037_0057939 3300049573 Bacteria 2827
447 Ga0501038_0002946 3300049574 Bacteria 15875
448 Ga0501038_0113324 3300049574 Bacteria 2244
449 Ga0501038_0240965 3300049574 Bacteria 1436
450 Ga0501039_0000438 3300049575 Bacteria 30118
451 Ga0501039_0114897 3300049575 Bacteria 2106
452 Ga0501039_0243923 3300049575 Bacteria 1413
453 Ga0501039_0907045 3300049575 Unclassified 686
454 Ga0501040_0000261 3300049576 Bacteria 30880
455 Ga0501040_0011163 3300049576 Bacteria 5874
456 Ga0501040_0113999 3300049576 Bacteria 1892
457 Ga0501040_0143734 3300049576 Bacteria 1681
458 Ga0501041_0000207 3300049577 Bacteria 27155
459 Ga0501041_0014791 3300049577 Bacteria 4635
460 Ga0501041_0064124 3300049577 Bacteria 2250
461 Ga0501042_0007514 3300049578 Bacteria 7145
462 Ga0501042_0066965 3300049578 Bacteria 2567
463 Ga0501042_0087381 3300049578 Bacteria 2237
464 Ga0501043_1006144 3300049579 Bacteria 593
465 Ga0501046_0000806 3300049580 Bacteria 30435
466 Ga0501046_0133856 3300049580 Bacteria 1879
467 Ga0501046_0192317 3300049580 Bacteria 1521
468 Ga0501046_0632788 3300049580 Bacteria 757
469 Ga0501048_0001059 3300049582 Bacteria 20596
470 Ga0501048_0022772 3300049582 Bacteria 4580
471 Ga0501048_0194391 3300049582 Bacteria 1438
472 Ga0501068_0448966 3300049584 Bacteria 834
473 Ga0501070_0015814 3300049586 Bacteria 6345
474 Ga0501071_0005067 3300049587 Bacteria 8428
475 Ga0501071_0038892 3300049587 Bacteria 3401
476 Ga0501072_0000329 3300049588 Bacteria 33886
477 Ga0501072_0039983 3300049588 Bacteria 3682
478 Ga0501072_0331194 3300049588 Bacteria 1210
479 Ga0501073_0033825 3300049589 Bacteria 3638
480 Ga0501073_0162171 3300049589 Bacteria 1549
481 Ga0501073_0352410 3300049589 Bacteria 1016
482 Ga0501074_0019835 3300049590 Bacteria 4883
483 Ga0501074_0111957 3300049590 Unclassified 1953
484 Ga0501075_0004029 3300049591 Bacteria 9907
485 Ga0501075_0006513 3300049591 Bacteria 8039
486 Ga0501075_0221771 3300049591 Bacteria 1442
487 Ga0501075_0325865 3300049591 Bacteria 1170
488 Ga0501076_0000989 3300049592 Bacteria 18566
489 Ga0501076_0015089 3300049592 Bacteria 5833
490 Ga0501076_0415795 3300049592 Bacteria 1106
491 Ga0501077_0001375 3300049593 Bacteria 14643
492 Ga0501077_0022365 3300049593 Bacteria 4005
493 Ga0501216_055218 3300049660 Bacteria 789
494 Ga0501079_0000149 3300049741 Bacteria 38185
495 Ga0501079_0108813 3300049741 Bacteria 2152
496 Ga0501079_0294443 3300049741 Bacteria 1269
497 Ga0501080_0012142 3300049742 Bacteria 7892
498 Ga0501080_0085783 3300049742 Bacteria 2926
499 Ga0501080_0121795 3300049742 Bacteria 2417
500 Ga0501080_0264596 3300049742 Bacteria 1566
501 Ga0501081_0000497 3300049743 Bacteria 21992
502 Ga0501081_0000738 3300049743 Bacteria 19080
503 Ga0501035_0023262 3300049822 Bacteria 5683
504 Ga0501035_0061931 3300049822 Bacteria 3329
505 Ga0501035_0111940 3300049822 Bacteria 2392
506 Ga0501045_0000100 3300049824 Bacteria 42747
507 Ga0501045_0154150 3300049824 Bacteria 1709
508 Ga0501045_0521865 3300049824 Bacteria 882
509 nmdc:mga05p37_1001973_c1 3300050507 Bacteria 887
510 nmdc:mga05p37_114313_c1 3300050507 Bacteria 3318
511 nmdc:mga05p37_132_c1 3300050507 Bacteria 68371
512 nmdc:mga05p37_246548_c1 3300050507 Bacteria 2144
513 nmdc:mga05p37_478462_c1 3300050507 Bacteria 1435
514 nmdc:mga05p37_847220_c1 3300050507 Bacteria 993
515 nmdc:mga09592_350_c1 3300050508 Bacteria 33875
516 nmdc:mga09592_685247_c1 3300050508 Bacteria 873
517 nmdc:mga0qj67_143171_c1 3300050509 Bacteria 1938
518 nmdc:mga0qj67_1671_c1 3300050509 Bacteria 15623
519 nmdc:mga0qj67_26351_c1 3300050509 Bacteria 4500
520 nmdc:mga0qj67_27614_c1 3300050509 Bacteria 4401
521 nmdc:mga0qj67_62433_c1 3300050509 Bacteria 2961
522 nmdc:mga06r32_272914_c1 3300050510 Bacteria 1679
523 nmdc:mga06r32_48163_c1 3300050510 Bacteria 4074
524 nmdc:mga06r32_83258_c1 3300050510 Bacteria 3117
525 nmdc:mga08y16_2879_c1 3300050511 Bacteria 17709
526 nmdc:mga08y16_30512_c1 3300050511 Bacteria 5673
527 nmdc:mga08y16_54165_c1 3300050511 Bacteria 4192
528 nmdc:mga08y16_73615_c1 3300050511 Bacteria 3560
529 nmdc:mga08y16_91009_c1 3300050511 Bacteria 3180
530 nmdc:mga0n895_10896_c1 3300050512 Bacteria 8075
531 nmdc:mga0n895_42998_c1 3300050512 Bacteria 4400
532 nmdc:mga0n895_468_c1 3300050512 Bacteria 27132
533 nmdc:mga0rr50_1288_c1 3300050513 Bacteria 13672
534 nmdc:mga0rr50_139419_c1 3300050513 Bacteria 1949
535 nmdc:mga0rr50_145_c1 3300050513 Bacteria 39313
536 nmdc:mga0rr50_2771_c1 3300050513 Bacteria 9956
537 nmdc:mga08x19_20102_c2 3300050514 Bacteria 3788
538 nmdc:mga08x19_28186_c1 3300050514 Bacteria 3516
539 nmdc:mga08x19_305277_c1 3300050514 Bacteria 1106
540 nmdc:mga08x19_522_c1 3300050514 Bacteria 25573
541 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
542 nmdc:mga0a205_1077_c1 3300050515 Bacteria 22648
543 nmdc:mga0a205_137556_c1 3300050515 Bacteria 2343
544 nmdc:mga0a205_19674_c1 3300050515 Bacteria 4758
545 Ga0495601_0104567 3300053077 Unclassified 1830
546 Ga0495595_0064738 3300053084 Bacteria 1719
547 Ga0495619_0154357 3300053085 Bacteria 1584
548 Ga0501084_0005737 3300054114 Bacteria 10205
549 Ga0501084_0028728 3300054114 Bacteria 4650
550 Ga0501084_0161052 3300054114 Bacteria 1893
551 Ga0501082_0004296 3300060353 Bacteria 12455
552 Ga0501082_0049462 3300060353 Bacteria 3626
553 Ga0530510_0000579 3300061734 Bacteria 23494
554 Ga0530510_0001762 3300061734 Bacteria 14739
555 Ga0530510_0321135 3300061734 Bacteria 1161
556 Ga0070691_10159486
557 JGI25406J46586_10045579
558 Ga0065707_10012777
559 Ga0065707_10091059
560 Ga0065707_10422218
561 Ga0065707_10433339
562 Ga0070676_10117618
563 Ga0070690_100000082
564 Ga0070690_100161145
565 Ga0068869_100000044
566 Ga0068869_100139584
567 Ga0070666_10075840
568 Ga0070680_100000771
569 Ga0070680_100043245
570 Ga0070680_100265676
571 Ga0070682_100080731
572 Ga0068868_100000780
573 Ga0068868_100143534
574 Ga0068868_100399774
575 Ga0068868_100402997
576 Ga0070689_100002046
577 Ga0070689_100074829
578 Ga0070691_10000079
579 Ga0070687_100000034
580 Ga0070687_100039763
581 Ga0070687_100072962
582 Ga0070687_100329639
583 Ga0070668_100012347
584 Ga0070669_100357931
585 Ga0070669_100858560
586 Ga0070675_100007884
587 Ga0070675_100744755
588 Ga0070673_100093425
589 Ga0070667_101274264
590 Ga0070703_10005461
591 Ga0070709_10160134
592 Ga0070710_10035208
593 Ga0070701_10000247
594 Ga0070701_10056487
595 Ga0070701_10299829
596 Ga0070711_100041319
597 Ga0070705_100000030
598 Ga0070705_100118981
599 Ga0070705_100275158
600 Ga0070705_100516292
601 Ga0070705_101053708
602 Ga0070700_100001187
603 Ga0070700_100002744
604 Ga0070700_100503759
605 Ga0070694_100000202
606 Ga0070694_100005384
607 Ga0070694_100098869
608 Ga0070694_100604401
609 Ga0070694_100666748
610 Ga0070681_10000257
611 Ga0070681_10201540
612 Ga0068867_100000032
613 Ga0068867_100000126
614 Ga0068867_100390428
615 Ga0070706_100455766
616 Ga0070698_100448231
617 Ga0070699_101329823
618 Ga0070679_100004882
619 Ga0070684_100024281
620 Ga0070697_100001805
621 Ga0070697_100196066
622 Ga0068853_100720965
623 Ga0070672_100213794
624 Ga0070686_100000286
625 Ga0070686_100013122
626 Ga0070686_100154944
627 Ga0070686_100439233
628 Ga0070695_100000818
629 Ga0070695_100158687
630 Ga0070695_100428986
631 Ga0070696_100000344
632 Ga0070696_100005765
633 Ga0070696_100124529
634 Ga0070696_100130661
635 Ga0070696_100168607
636 Ga0070696_100191285
637 Ga0070696_100192339
638 Ga0070696_100510923
639 Ga0070696_100518327
640 Ga0070693_100000100
641 Ga0070693_100166047
642 Ga0070704_100000159
643 Ga0070704_100009938
644 Ga0070704_100197327
645 Ga0070704_101034007
646 Ga0068855_100000695
647 Ga0068855_100555021
648 Ga0068854_100025568
649 Ga0068856_100042208
650 Ga0068856_100371922
651 Ga0068856_100597995
652 Ga0070702_100000001
653 Ga0070702_100046156
654 Ga0070702_100424242
655 Ga0070702_100445982
656 Ga0068852_100066231
657 Ga0068859_100001620
658 Ga0068859_100018583
659 Ga0068859_100388507
660 Ga0068864_100166248
661 Ga0068866_10215718
662 Ga0068861_100000057
663 Ga0068861_100000134
664 Ga0068870_10181724
665 Ga0068858_100000289
666 Ga0068858_100097668
667 Ga0068858_100553809
668 Ga0068860_100004021
669 Ga0068860_100142708
670 Ga0068860_100506303
671 Ga0068860_100813832
672 Ga0068862_100000583
673 Ga0068862_100001111
674 Ga0068862_100146396
675 Ga0068862_100268040
676 Ga0081538_10099149
677 Ga0081539_10002484
678 Ga0097621_100000368
679 Ga0097621_100000927
680 Ga0068871_100000246
681 Ga0068871_100003416
682 Ga0068871_100232011
683 Ga0068871_101067921
684 Ga0075428_100000083
685 Ga0075428_100509725
686 Ga0075430_100000063
687 Ga0075430_100006901
688 Ga0075431_100015155
689 Ga0075431_100029695
690 Ga0075431_100113319
691 Ga0075431_100132949
692 Ga0075433_10003931
693 Ga0075433_10027271
694 Ga0075433_10165962
695 Ga0075433_10899415
696 Ga0075434_100000064
697 Ga0075434_100016529
698 Ga0075434_100053099
699 Ga0075429_100001065
700 Ga0075429_100019585
701 Ga0068865_100000327
702 Ga0068865_100026071
703 Ga0075436_100000050
704 Ga0075436_100003460
705 Ga0075436_100034075
706 Ga0097620_100001620
707 Ga0097620_100018583
708 Ga0097620_100388541
709 Ga0075435_100000260
710 Ga0075435_100002126
711 Ga0075435_100013750
712 Ga0075435_100020168
713 Ga0075435_100331704
714 Ga0111539_10003219
715 Ga0111539_10008749
716 Ga0111539_10041451
717 Ga0111539_10085337
718 Ga0111539_10240521
719 Ga0105245_10000075
720 Ga0105245_10461920
721 Ga0105245_10478149
722 Ga0114129_10001164
723 Ga0114129_10110095
724 Ga0114129_10291815
725 Ga0114129_10298511
726 Ga0114129_10989165
727 Ga0114129_11310859
728 Ga0105243_10001533
729 Ga0105243_10003894
730 Ga0105241_10020104
731 Ga0105242_10000359
732 Ga0105242_10000823
733 Ga0105248_10971398
734 Ga0105249_10010306
735 Ga0105249_10011629
736 Ga0105246_10337310
737 Ga0157369_11102130
738 Ga0157378_10000074
739 Ga0157380_10003099
740 Ga0157380_10012618
741 Ga0157377_10159148
742 Ga0157376_10015737
743 Ga0157376_10084950
744 Ga0207653_10009902
745 Ga0207642_10003500
746 Ga0207688_10401305
747 Ga0207680_10245658
748 Ga0207685_10021986
749 Ga0207699_10665556
750 Ga0207645_10047899
751 Ga0207645_10113741
752 Ga0207643_10193448
753 Ga0207643_10252399
754 Ga0207684_10449199
755 Ga0207654_10012040
756 Ga0207707_10005329
757 Ga0207707_10107082
758 Ga0207695_10380068
759 Ga0207663_10184505
760 Ga0207660_10013906
761 Ga0207660_10031530
762 Ga0207660_10173846
763 Ga0207662_10000319
764 Ga0207662_10007825
765 Ga0207662_10028980
766 Ga0207662_10167540
767 Ga0207646_10291430
768 Ga0207681_10000301
769 Ga0207681_10312142
770 Ga0207659_10057259
771 Ga0207659_10209648
772 Ga0207687_10000832
773 Ga0207686_10001412
774 Ga0207686_10014439
775 Ga0207709_10000711
776 Ga0207709_10002128
777 Ga0207670_10002481
778 Ga0207670_10035961
779 Ga0207670_10048018
780 Ga0207670_10067142
781 Ga0207704_10000292
782 Ga0207704_10000660
783 Ga0207704_10480794
784 Ga0207665_10047720
785 Ga0207691_10531130
786 Ga0207711_10164270
787 Ga0207711_10688435
788 Ga0207689_10000007
789 Ga0207689_10012667
790 Ga0207689_10514130
791 Ga0207667_10045637
792 Ga0207667_10285933
793 Ga0207651_10066743
794 Ga0207651_10120563
795 Ga0207651_10153527
796 Ga0207712_10006247
797 Ga0207712_10011207
798 Ga0207668_10007568
799 Ga0207640_10043507
800 Ga0207658_11073265
801 Ga0207677_10001738
802 Ga0207703_10000606
803 Ga0207703_10079516
804 Ga0207703_10808390
805 Ga0207639_11155397
806 Ga0207708_10000086
807 Ga0207708_10000697
808 Ga0207708_10774211
809 Ga0207702_10017383
810 Ga0207702_10061938
811 Ga0207702_10318489
812 Ga0207641_10076138
813 Ga0207648_10000079
814 Ga0207648_10000352
815 Ga0207648_10347786
816 Ga0207648_10444547
817 Ga0207676_10072364
818 Ga0207676_10097305
819 Ga0207675_100000093
820 Ga0207675_100000223
821 Ga0207675_101304744
822 Ga0207683_10531499
823 Ga0209967_1017464
824 Ga0209981_1001021
825 Ga0209981_1009862
826 Ga0209981_1022771
827 Ga0209996_1013243
828 Ga0210000_1004369
829 Ga0210000_1025507
830 Ga0209995_1006185
831 Ga0209999_1000687
832 Ga0209970_1028308
833 Ga0209983_1002209
834 Ga0209588_1007008
835 Ga0209588_1016176
836 Ga0209971_1043655
837 Ga0209966_1002603
838 Ga0209966_1008975
839 Ga0209998_10006830
840 Ga0209974_10075568
841 Ga0207428_10000321
842 Ga0207428_10028576
843 Ga0207428_10095016
844 Ga0207428_10255647
845 Ga0207428_10494055
846 Ga0268265_10000579
847 Ga0268265_10005154
848 Ga0268265_10033842
849 Ga0268265_10393315
850 Ga0268264_10001253
851 Ga0268264_10113513
852 Ga0268264_10519347
853 Ga0307408_100064063
854 Ga0307408_100950247
855 Ga0316575_10024709
856 Ga0316579_10000235
857 Ga0316578_10001845
858 Ga0316583_10001540
859 Ga0316583_10006500
860 Ga0373930_0004162
861 Ga0373948_0003815
862 Ga0373958_0008305
863 Ga0373926_0001423
864 Ga0373928_0011079
865 Ga0373928_0017323
866 Ga0373929_0016877
867 Ga0373940_0006582
868 Ga0373944_0002534
869 Ga0373949_0003832
870 Ga0373951_0002918
871 Ga0373952_0003595
872 Ga0373952_0011244
873 Ga0373952_0050122
874 Ga0373923_0080946
875 Ga0373936_0005049
876 Ga0373936_0047227
877 Ga0373939_0201302
878 Ga0373941_0035719
879 Ga0373941_0062674
880 Ga0373941_0110145
881 Ga0373945_0006474
882 Ga0373953_0001215
883 Ga0373953_0032392
884 Ga0373954_0000002
885 Ga0373954_0122266
886 Ga0373960_0008088
887 Ga0373960_0008711
888 Ga0373960_0076433
889 Ga0373943_0040586
890 Ga0373946_0003690
891 Ga0373946_0182161
892 Ga0373955_0002137
893 Ga0373955_0010473
894 Ga0373942_0019948
895 Ga0373942_0045746
896 Ga0373962_0034016
897 Ga0316574_0217533
898 Ga0373924_0004868
899 Ga0373924_0009924
900 Ga0373924_0012888
901 Ga0373931_0000134
902 Ga0373931_0002977
903 Ga0373931_0004561
904 Ga0373931_0250381
905 Ga0373935_0012022
906 Ga0373935_0015429
907 Ga0373927_0042855
908 Ga0373927_0043694
909 Ga0373933_0036551
910 Ga0373933_0474167
911 Ga0373947_0053589
912 Ga0373947_0578632
913 Ga0373937_0000646
914 Ga0373937_0006721
915 Ga0373937_0018224
916 Ga0373937_0039910
917 Ga0373937_0272028
918 Ga0373937_0311226
919 Ga0373937_0390844
920 Ga0316582_0000784
921 Ga0316584_0257507
922 Ga0373925_0022805
923 Ga0373925_0027389
924 Ga0373925_0181953
925 Ga0316581_0005299
926 Ga0439453_0000413
927 Ga0451807_1154876
928 Ga0439441_000175
929 Ga0439441_000300
930 Ga0439441_003526
931 Ga0439442_051484
932 Ga0439443_001970
933 Ga0439456_013918
934 Ga0439446_0011264
935 Ga0439446_0035582
936 Ga0439446_0079714
937 Ga0439434_0000165
938 Ga0439434_0055467
939 Ga0439435_0000132
940 Ga0439435_0011080
941 Ga0439444_0010082
942 Ga0439444_0016698
943 Ga0439460_0000243
944 Ga0439460_0001886
945 Ga0450893_0012037
946 Ga0451577_0149036
947 Ga0466957_0109729
948 Ga0451576_0005699
949 Ga0451576_0043018
950 Ga0451576_0430506
951 Ga0451576_1121439
952 Ga0495592_0019870
953 Ga0495603_0116160
954 Ga0495641_0031513
955 Ga0495651_0260565
956 Ga0495580_0028878
957 Ga0495582_0013615
958 Ga0495639_0007114
959 Ga0495639_0069489
960 Ga0495662_0013077
961 Ga0495608_0000913
962 Ga0495628_0004622
963 Ga0495628_0547790
964 Ga0495630_0035426
965 Ga0495630_0269682
966 Ga0495666_0040539
967 Ga0495666_0177718
968 Ga0495652_0081831
969 Ga0495665_0016002
970 Ga0495640_0001515
971 Ga0495586_0001426
972 Ga0495586_0025477
973 Ga0495586_0215998
974 Ga0495645_0092243
975 Ga0495667_0005087
976 Ga0495667_0064899
977 Ga0495656_0005519
978 Ga0495634_0036458
979 Ga0495634_0420173
980 Ga0495635_0235012
981 Ga0495657_0310915
982 Ga0495623_0399543
983 Ga0495647_0000674
984 Ga0495658_0001043
985 Ga0495658_0041954
986 Ga0495613_0021648
987 Ga0495624_0042710
988 Ga0495624_0119077
989 Ga0495600_0020498
990 Ga0495581_0226858
991 Ga0495636_0012131
992 Ga0495680_0001187
993 Ga0495680_0059099
994 Ga0495593_0043827
995 Ga0496106_0414772
996 Ga0501032_0050336
997 Ga0501033_0004036
998 Ga0501033_0377636
999 Ga0501036_0000314
1000 Ga0501036_0297896
1001 Ga0501037_0057939
1002 Ga0501038_0002946
1003 Ga0501038_0113324
1004 Ga0501038_0240965
1005 Ga0501039_0000438
1006 Ga0501039_0114897
1007 Ga0501039_0243923
1008 Ga0501039_0907045
1009 Ga0501040_0000261
1010 Ga0501040_0011163
1011 Ga0501040_0113999
1012 Ga0501040_0143734
1013 Ga0501041_0000207
1014 Ga0501041_0014791
1015 Ga0501041_0064124
1016 Ga0501042_0007514
1017 Ga0501042_0066965
1018 Ga0501042_0087381
1019 Ga0501043_1006144
1020 Ga0501046_0000806
1021 Ga0501046_0133856
1022 Ga0501046_0192317
1023 Ga0501046_0632788
1024 Ga0501048_0001059
1025 Ga0501048_0022772
1026 Ga0501048_0194391
1027 Ga0501068_0448966
1028 Ga0501070_0015814
1029 Ga0501071_0005067
1030 Ga0501071_0038892
1031 Ga0501072_0000329
1032 Ga0501072_0039983
1033 Ga0501072_0331194
1034 Ga0501073_0033825
1035 Ga0501073_0162171
1036 Ga0501073_0352410
1037 Ga0501074_0019835
1038 Ga0501074_0111957
1039 Ga0501075_0004029
1040 Ga0501075_0006513
1041 Ga0501075_0221771
1042 Ga0501075_0325865
1043 Ga0501076_0000989
1044 Ga0501076_0015089
1045 Ga0501076_0415795
1046 Ga0501077_0001375
1047 Ga0501077_0022365
1048 Ga0501216_055218
1049 Ga0501079_0000149
1050 Ga0501079_0108813
1051 Ga0501079_0294443
1052 Ga0501080_0012142
1053 Ga0501080_0085783
1054 Ga0501080_0121795
1055 Ga0501080_0264596
1056 Ga0501081_0000497
1057 Ga0501081_0000738
1058 Ga0501035_0023262
1059 Ga0501035_0061931
1060 Ga0501035_0111940
1061 Ga0501045_0000100
1062 Ga0501045_0154150
1063 Ga0501045_0521865
1064 nmdc:mga05p37_1001973_c1
1065 nmdc:mga05p37_114313_c1
1066 nmdc:mga05p37_132_c1
1067 nmdc:mga05p37_246548_c1
1068 nmdc:mga05p37_478462_c1
1069 nmdc:mga05p37_847220_c1
1070 nmdc:mga09592_350_c1
1071 nmdc:mga09592_685247_c1
1072 nmdc:mga0qj67_143171_c1
1073 nmdc:mga0qj67_1671_c1
1074 nmdc:mga0qj67_26351_c1
1075 nmdc:mga0qj67_27614_c1
1076 nmdc:mga0qj67_62433_c1
1077 nmdc:mga06r32_272914_c1
1078 nmdc:mga06r32_48163_c1
1079 nmdc:mga06r32_83258_c1
1080 nmdc:mga08y16_2879_c1
1081 nmdc:mga08y16_30512_c1
1082 nmdc:mga08y16_54165_c1
1083 nmdc:mga08y16_73615_c1
1084 nmdc:mga08y16_91009_c1
1085 nmdc:mga0n895_10896_c1
1086 nmdc:mga0n895_42998_c1
1087 nmdc:mga0n895_468_c1
1088 nmdc:mga0rr50_1288_c1
1089 nmdc:mga0rr50_139419_c1
1090 nmdc:mga0rr50_145_c1
1091 nmdc:mga0rr50_2771_c1
1092 nmdc:mga08x19_20102_c2
1093 nmdc:mga08x19_28186_c1
1094 nmdc:mga08x19_305277_c1
1095 nmdc:mga08x19_522_c1
1096 nmdc:mga08x19_55_c1
1097 nmdc:mga0a205_1077_c1
1098 nmdc:mga0a205_137556_c1
1099 nmdc:mga0a205_19674_c1
1100 Ga0495601_0104567
1101 Ga0495595_0064738
1102 Ga0495619_0154357
1103 Ga0501084_0005737
1104 Ga0501084_0028728
1105 Ga0501084_0161052
1106 Ga0501082_0004296
1107 Ga0501082_0049462
1108 Ga0530510_0000579
1109 Ga0530510_0001762
1110 Ga0530510_0321135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14334

DUF4390

Domain of unknown function (DUF4390)

21

184

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hs5-assembly2.cif.gz_B frataxin from psychromonas ingrahamii as a model to study stability modulation within cyay protein family 0.6063 72 114
6hej-assembly1.cif.gz_A structure of human usp28 0.5894 61 118
6ah0-assembly1.cif.gz_W the cryo-em structure of the precusor of human pre-catalytic spliceosome (pre-b complex) 0.5877 64 113
4nn5-assembly1.cif.gz_C cytokine receptor complex - crystal form 1a 0.5798 27 181
1px3-assembly1.cif.gz_A e. coli (lacz) beta-galactosidase (g794a) 0.5679 25 181
ID Description Score Start End Superfamily
af_A0A2R8QR54_13_160_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.8526 90 113 1.20.58.1120
af_A0A0P0Y493_607_911_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7214 63 123 3.90.70.10
af_Q9SNC3_28_180_2.30.180.10 Mainly Beta;Roll;FAS1 domain;FAS1 domain 0.6971 89 115 2.30.180.10
af_Q09732_2_101_2.60.40.4370 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6965 88 111 2.60.40.4370
af_Q6NZZ8_274_342_3.10.50.10 Alpha Beta;Roll;Chitinase A; domain 3; 0.6351 90 119 3.10.50.10
ID Description Score Start End GO Terms
AF-A0A6L5JX42-F1-model_v4 DUF4390 domain-containing protein 0.9724 24 182
AF-A0A2A4VVR8-F1-model_v4 DUF4390 domain-containing protein 0.9656 24 179
AF-N6XXX0-F1-model_v4 Proline rich signal peptide protein 0.9623 19 182
AF-A0A431L075-F1-model_v4 DUF4390 domain-containing protein 0.9613 22 181
AF-A0A377RKR6-F1-model_v4 DUF4390 domain-containing protein 0.9606 25 183

Map