F463086

General Info

Members Datasets Scaffolds Average Seq Length
555 244 555 237

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100765441|Ga0068855_1007654412
Length 242
Sequence MISPMGIAENIAAIRQRIDAAASRVRRDPSEIALMAVCKTKPAEEIRAAYEAGQRLFGENRVQEFHEKSGALTDLLSGDDAAEFHLIGHLQSNKTNRAAEIFHAVDSVDSLAVLERLHTAALRLNKHLPILIEINIGGEDQKAGLAPDSDELEQILQAAPRLLAIGISGLMTVPPFTDDPEGARPYFRRLRELRDHIAARNLPGVSMEELSIGMSHDFEVAIEEGSTCVRVGTAIFGARNYT

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.05
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1528414 2162886012 Bacteria 1064
2 MBSR1b_contig_1782974 2162886012 Bacteria 1064
3 Ga0070683_100012083 3300005329 Bacteria 7491
4 Ga0070683_100183174 3300005329 Bacteria 1988
5 Ga0070683_100184167 3300005329 Bacteria 1982
6 Ga0070690_100012194 3300005330 Bacteria 5052
7 Ga0070670_100003670 3300005331 Bacteria 12793
8 Ga0070670_100048417 3300005331 Bacteria 3658
9 Ga0070670_100144680 3300005331 Unclassified 2056
10 Ga0070677_10006410 3300005333 Unclassified 3909
11 Ga0068869_100032444 3300005334 Bacteria 3680
12 Ga0070666_10131503 3300005335 Unclassified 1739
13 Ga0070682_100023124 3300005337 Unclassified 3689
14 Ga0068868_100012287 3300005338 Bacteria 6257
15 Ga0068868_100012948 3300005338 Bacteria 6102
16 Ga0068868_100019511 3300005338 Bacteria 5080
17 Ga0070660_100015331 3300005339 Bacteria 5531
18 Ga0070689_100026875 3300005340 Unclassified 4336
19 Ga0070689_100088201 3300005340 Unclassified 2441
20 Ga0070689_100134408 3300005340 Bacteria 1985
21 Ga0070661_100090559 3300005344 Unclassified 2265
22 Ga0070668_100056334 3300005347 Unclassified 3036
23 Ga0070668_100127627 3300005347 Unclassified 2038
24 Ga0070669_100031734 3300005353 Bacteria 3816
25 Ga0070669_100317792 3300005353 Bacteria 1256
26 Ga0070675_100079695 3300005354 Bacteria 2729
27 Ga0070671_100164765 3300005355 Bacteria 1874
28 Ga0070674_100052947 3300005356 Unclassified 2801
29 Ga0070673_100018739 3300005364 Unclassified 4955
30 Ga0070673_100137793 3300005364 Bacteria 2056
31 Ga0070659_100002666 3300005366 Bacteria 12691
32 Ga0070667_100119940 3300005367 Unclassified 2287
33 Ga0070667_100699570 3300005367 Unclassified 938
34 Ga0070709_10065582 3300005434 Bacteria 2326
35 Ga0070714_100091694 3300005435 Bacteria 2662
36 Ga0070714_100173064 3300005435 Bacteria 1960
37 Ga0070714_100266166 3300005435 Bacteria 1588
38 Ga0070714_100339711 3300005435 Unclassified 1408
39 Ga0070713_100054518 3300005436 Unclassified 3318
40 Ga0070713_100058739 3300005436 Bacteria 3209
41 Ga0070713_100113612 3300005436 Bacteria 2364
42 Ga0070713_100279556 3300005436 Bacteria 1531
43 Ga0070710_10011795 3300005437 Bacteria 4328
44 Ga0070710_10020546 3300005437 Bacteria 3428
45 Ga0070711_100012311 3300005439 Bacteria 5337
46 Ga0070711_100012589 3300005439 Bacteria 5290
47 Ga0070711_100038547 3300005439 Bacteria 3214
48 Ga0070711_100078540 3300005439 Unclassified 2345
49 Ga0070711_100345000 3300005439 Bacteria 1196
50 Ga0070705_100200943 3300005440 Bacteria 1366
51 Ga0070708_101001314 3300005445 Unclassified 784
52 Ga0070663_100018203 3300005455 Unclassified 4599
53 Ga0070678_100033339 3300005456 Bacteria 3575
54 Ga0070678_100263519 3300005456 Unclassified 1450
55 Ga0070662_100005317 3300005457 Bacteria 8223
56 Ga0070681_10001100 3300005458 Bacteria 23120
57 Ga0070681_10003480 3300005458 Bacteria 14751
58 Ga0070681_10303423 3300005458 Bacteria 1506
59 Ga0068867_100073676 3300005459 Bacteria 2557
60 Ga0068867_100360599 3300005459 Unclassified 1216
61 Ga0070685_10093924 3300005466 Unclassified 1820
62 Ga0070706_100000278 3300005467 Bacteria 62365
63 Ga0070707_100022230 3300005468 Bacteria 5996
64 Ga0070707_100076687 3300005468 Unclassified 3224
65 Ga0070707_100216107 3300005468 Bacteria 1868
66 Ga0070698_100051792 3300005471 Unclassified 4179
67 Ga0070698_100110325 3300005471 Bacteria 2716
68 Ga0070699_100002709 3300005518 Bacteria 15794
69 Ga0070699_100020254 3300005518 Bacteria 5735
70 Ga0070679_100063805 3300005530 Bacteria 3672
71 Ga0070679_100091382 3300005530 Bacteria 3032
72 Ga0070684_100009298 3300005535 Bacteria 7736
73 Ga0070684_100057935 3300005535 Bacteria 3383
74 Ga0070684_100243220 3300005535 Bacteria 1644
75 Ga0070697_100000049 3300005536 Bacteria 90362
76 Ga0070697_100000158 3300005536 Bacteria 55228
77 Ga0070697_100005879 3300005536 Bacteria 9469
78 Ga0068853_100006343 3300005539 Bacteria 9387
79 Ga0068853_100024017 3300005539 Bacteria 5109
80 Ga0068853_100041531 3300005539 Bacteria 3930
81 Ga0068853_100132907 3300005539 Bacteria 2229
82 Ga0070672_100087257 3300005543 Unclassified 2510
83 Ga0070686_100087276 3300005544 Unclassified 2079
84 Ga0070695_100048381 3300005545 Bacteria 2719
85 Ga0070696_100008369 3300005546 Bacteria 6920
86 Ga0070704_100150447 3300005549 Bacteria 1829
87 Ga0068855_100003643 3300005563 Bacteria 18833
88 Ga0068855_100063779 3300005563 Bacteria 4299
89 Ga0068855_100137310 3300005563 Unclassified 2789
90 Ga0068855_100765441 3300005563 Unclassified 1028
91 Ga0070664_100000538 3300005564 Bacteria 28884
92 Ga0070664_100022774 3300005564 Bacteria 5168
93 Ga0068857_100000081 3300005577 Bacteria 55561
94 Ga0068857_100021579 3300005577 Bacteria 5666
95 Ga0068857_100029113 3300005577 Bacteria 4873
96 Ga0068857_100031365 3300005577 Bacteria 4696
97 Ga0068854_100004626 3300005578 Bacteria 8679
98 Ga0068854_100094421 3300005578 Bacteria 2231
99 Ga0068854_100854600 3300005578 Unclassified 797
100 Ga0068856_100000394 3300005614 Bacteria 47803
101 Ga0068856_100001986 3300005614 Bacteria 21328
102 Ga0068856_100008311 3300005614 Bacteria 10113
103 Ga0068856_100020557 3300005614 Bacteria 6412
104 Ga0068856_100027370 3300005614 Bacteria 5562
105 Ga0070702_100036892 3300005615 Unclassified 2712
106 Ga0068852_100093344 3300005616 Unclassified 2697
107 Ga0068852_100161338 3300005616 Unclassified 2093
108 Ga0068852_100306019 3300005616 Unclassified 1540
109 Ga0068852_100621350 3300005616 Unclassified 1086
110 Ga0068852_100909533 3300005616 Unclassified 897
111 Ga0068859_100000290 3300005617 Bacteria 49956
112 Ga0068864_100001275 3300005618 Bacteria 20944
113 Ga0068864_100018702 3300005618 Bacteria 5790
114 Ga0068864_100089470 3300005618 Unclassified 2712
115 Ga0068866_10205089 3300005718 Bacteria 1180
116 Ga0068861_100277429 3300005719 Unclassified 1442
117 Ga0068851_10026488 3300005834 Unclassified 2849
118 Ga0068851_10107976 3300005834 Bacteria 1483
119 Ga0068851_10423839 3300005834 Unclassified 786
120 Ga0068863_100008272 3300005841 Bacteria 10164
121 Ga0068863_100134013 3300005841 Bacteria 2366
122 Ga0068858_100001619 3300005842 Bacteria 22968
123 Ga0068858_100002791 3300005842 Bacteria 17553
124 Ga0068858_100077679 3300005842 Unclassified 3084
125 Ga0068858_100126941 3300005842 Unclassified 2389
126 Ga0068858_100237633 3300005842 Bacteria 1728
127 Ga0068860_100005894 3300005843 Bacteria 12335
128 Ga0068860_100011500 3300005843 Bacteria 8721
129 Ga0068860_100065442 3300005843 Unclassified 3452
130 Ga0068860_100160110 3300005843 Bacteria 2170
131 Ga0068862_100036273 3300005844 Unclassified 4179
132 Ga0081540_1110156 3300005983 Bacteria 1166
133 Ga0081540_1147245 3300005983 Unclassified 935
134 Ga0070717_10004359 3300006028 Bacteria 10210
135 Ga0070717_10020604 3300006028 Bacteria 5189
136 Ga0070717_10226286 3300006028 Bacteria 1646
137 Ga0070717_10236080 3300006028 Bacteria 1611
138 Ga0070715_10050443 3300006163 Bacteria 1787
139 Ga0070715_10063341 3300006163 Unclassified 1630
140 Ga0070715_10122083 3300006163 Bacteria 1243
141 Ga0070716_100003540 3300006173 Bacteria 7367
142 Ga0070716_100080483 3300006173 Bacteria 1942
143 Ga0070712_100002390 3300006175 Bacteria 11557
144 Ga0070712_100012269 3300006175 Bacteria 5447
145 Ga0070712_100059128 3300006175 Bacteria 2698
146 Ga0070712_100552249 3300006175 Bacteria 970
147 Ga0070712_100890687 3300006175 Bacteria 767
148 Ga0097621_100002603 3300006237 Bacteria 12369
149 Ga0097621_100004265 3300006237 Bacteria 9933
150 Ga0097621_100159158 3300006237 Unclassified 1940
151 Ga0068871_100001192 3300006358 Bacteria 17360
152 Ga0068871_100007456 3300006358 Bacteria 7820
153 Ga0068871_100018971 3300006358 Bacteria 5242
154 Ga0068871_100185995 3300006358 Unclassified 1787
155 Ga0075433_10001098 3300006852 Bacteria 19537
156 Ga0075434_100000195 3300006871 Bacteria 40479
157 Ga0068865_100008484 3300006881 Bacteria 6353
158 Ga0068865_100186635 3300006881 Bacteria 1600
159 Ga0075436_100004841 3300006914 Bacteria 9252
160 Ga0075436_100042255 3300006914 Bacteria 3144
161 Ga0075436_100275532 3300006914 Bacteria 1202
162 Ga0075436_100561083 3300006914 Unclassified 839
163 Ga0097620_100000290 3300006931 Bacteria 49956
164 Ga0075435_100000065 3300007076 Bacteria 54666
165 Ga0105250_10028996 3300009092 Unclassified 2227
166 Ga0105240_10017855 3300009093 Bacteria 9546
167 Ga0105240_10029292 3300009093 Bacteria 7176
168 Ga0105240_10065441 3300009093 Bacteria 4512
169 Ga0105240_10078716 3300009093 Bacteria 4058
170 Ga0105240_10504761 3300009093 Unclassified 1344
171 Ga0105240_10624398 3300009093 Unclassified 1184
172 Ga0105245_10002858 3300009098 Bacteria 15509
173 Ga0105245_10008495 3300009098 Bacteria 8958
174 Ga0105245_10054629 3300009098 Unclassified 3587
175 Ga0105245_10065607 3300009098 Unclassified 3283
176 Ga0105245_10324423 3300009098 Bacteria 1518
177 Ga0105245_10550211 3300009098 Bacteria 1176
178 Ga0105247_10006341 3300009101 Bacteria 7329
179 Ga0105241_10023905 3300009174 Bacteria 4535
180 Ga0105241_10044572 3300009174 Bacteria 3361
181 Ga0105241_10087172 3300009174 Bacteria 2456
182 Ga0105241_10117430 3300009174 Bacteria 2138
183 Ga0105241_10153074 3300009174 Unclassified 1888
184 Ga0105241_10165548 3300009174 Unclassified 1822
185 Ga0105241_10184527 3300009174 Bacteria 1733
186 Ga0105241_10227097 3300009174 Unclassified 1572
187 Ga0105241_10330440 3300009174 Unclassified 1317
188 Ga0105242_10009165 3300009176 Bacteria 7598
189 Ga0105242_10499047 3300009176 Bacteria 1157
190 Ga0105248_10021967 3300009177 Bacteria 7071
191 Ga0105248_10258562 3300009177 Unclassified 1960
192 Ga0105248_10382344 3300009177 Unclassified 1585
193 Ga0105237_10063189 3300009545 Bacteria 3700
194 Ga0105237_10183979 3300009545 Bacteria 2089
195 Ga0105237_10236827 3300009545 Bacteria 1827
196 Ga0105237_10403751 3300009545 Unclassified 1371
197 Ga0105237_10501110 3300009545 Bacteria 1221
198 Ga0105237_10681760 3300009545 Bacteria 1034
199 Ga0105238_10000417 3300009551 Bacteria 44911
200 Ga0105238_10014582 3300009551 Bacteria 7945
201 Ga0105238_10227665 3300009551 Unclassified 1841
202 Ga0105238_10317607 3300009551 Bacteria 1543
203 Ga0105238_10346525 3300009551 Unclassified 1474
204 Ga0105249_10024924 3300009553 Bacteria 5382
205 Ga0105249_10107413 3300009553 Unclassified 2634
206 Ga0099796_10063845 3300010159 Bacteria 1312
207 Ga0105239_10014364 3300010375 Bacteria 8786
208 Ga0105239_10114979 3300010375 Bacteria 2985
209 Ga0105239_10150419 3300010375 Unclassified 2598
210 Ga0105239_10221559 3300010375 Bacteria 2121
211 Ga0105239_10384835 3300010375 Unclassified 1586
212 Ga0105246_10007122 3300011119 Bacteria 6846
213 Ga0105246_10011181 3300011119 Bacteria 5564
214 Ga0105246_10087410 3300011119 Bacteria 2237
215 Ga0157373_10180002 3300013100 Unclassified 1488
216 Ga0157373_10244058 3300013100 Bacteria 1270
217 Ga0157373_10360623 3300013100 Unclassified 1038
218 Ga0157373_10548369 3300013100 Unclassified 838
219 Ga0157371_10098202 3300013102 Unclassified 2076
220 Ga0157371_10528214 3300013102 Unclassified 873
221 Ga0157370_10166681 3300013104 Unclassified 2049
222 Ga0157370_10516345 3300013104 Unclassified 1097
223 Ga0157369_10000258 3300013105 Bacteria 72711
224 Ga0157369_10499701 3300013105 Bacteria 1258
225 Ga0157374_10001052 3300013296 Bacteria 23995
226 Ga0157374_10001435 3300013296 Bacteria 20148
227 Ga0157374_10005580 3300013296 Bacteria 10593
228 Ga0157374_10012766 3300013296 Bacteria 7319
229 Ga0157374_10048161 3300013296 Bacteria 3955
230 Ga0157374_10109111 3300013296 Bacteria 2660
231 Ga0157378_10000541 3300013297 Bacteria 35976
232 Ga0157378_10002142 3300013297 Bacteria 17530
233 Ga0157378_10024706 3300013297 Bacteria 5290
234 Ga0157378_10206842 3300013297 Bacteria 1859
235 Ga0163162_10002555 3300013306 Bacteria 17229
236 Ga0163162_10004210 3300013306 Bacteria 13826
237 Ga0157372_10000335 3300013307 Bacteria 51775
238 Ga0157372_10001168 3300013307 Bacteria 28395
239 Ga0157372_10004868 3300013307 Bacteria 14272
240 Ga0157372_10010989 3300013307 Bacteria 9635
241 Ga0157372_10043120 3300013307 Unclassified 4993
242 Ga0157372_10144870 3300013307 Bacteria 2739
243 Ga0157372_10220384 3300013307 Unclassified 2199
244 Ga0157372_10781105 3300013307 Unclassified 1110
245 Ga0157372_10802984 3300013307 Bacteria 1093
246 Ga0157375_10078465 3300013308 Bacteria 3335
247 Ga0157375_10084316 3300013308 Unclassified 3226
248 Ga0157375_11569969 3300013308 Bacteria 778
249 Ga0163163_10004099 3300014325 Bacteria 12433
250 Ga0163163_10027698 3300014325 Bacteria 5432
251 Ga0163163_10028700 3300014325 Bacteria 5347
252 Ga0163163_10030507 3300014325 Bacteria 5195
253 Ga0163163_10210862 3300014325 Bacteria 1992
254 Ga0157380_10027507 3300014326 Unclassified 4325
255 Ga0157377_10001555 3300014745 Bacteria 9979
256 Ga0157377_10120179 3300014745 Unclassified 1591
257 Ga0157379_10057448 3300014968 Unclassified 3478
258 Ga0157379_10062392 3300014968 Bacteria 3333
259 Ga0157376_10026684 3300014969 Bacteria 4567
260 Ga0163161_10008769 3300017792 Bacteria 6990
261 Ga0224570_101606 3300022730 Bacteria 1642
262 Ga0207697_10016188 3300025315 Unclassified 3075
263 Ga0207656_10014138 3300025321 Unclassified 3068
264 Ga0207656_10071485 3300025321 Bacteria 1543
265 Ga0207656_10195614 3300025321 Unclassified 975
266 Ga0207692_10002000 3300025898 Bacteria 7789
267 Ga0207692_10325845 3300025898 Bacteria 941
268 Ga0207642_10114315 3300025899 Unclassified 1380
269 Ga0207642_10148907 3300025899 Bacteria 1243
270 Ga0207710_10065474 3300025900 Bacteria 1657
271 Ga0207688_10007283 3300025901 Bacteria 6021
272 Ga0207680_10019827 3300025903 Unclassified 3605
273 Ga0207647_10002874 3300025904 Bacteria 12974
274 Ga0207647_10008899 3300025904 Bacteria 7160
275 Ga0207647_10032472 3300025904 Unclassified 3352
276 Ga0207685_10057151 3300025905 Bacteria 1529
277 Ga0207685_10061440 3300025905 Bacteria 1489
278 Ga0207685_10100452 3300025905 Unclassified 1236
279 Ga0207699_10041384 3300025906 Unclassified 2661
280 Ga0207645_10007489 3300025907 Bacteria 7704
281 Ga0207643_10000639 3300025908 Bacteria 21958
282 Ga0207684_10001907 3300025910 Bacteria 21656
283 Ga0207684_10232864 3300025910 Bacteria 1589
284 Ga0207654_10032167 3300025911 Unclassified 2896
285 Ga0207654_10098528 3300025911 Unclassified 1796
286 Ga0207654_10113626 3300025911 Unclassified 1689
287 Ga0207654_10123476 3300025911 Bacteria 1629
288 Ga0207707_10033457 3300025912 Bacteria 4499
289 Ga0207707_10034516 3300025912 Bacteria 4426
290 Ga0207707_10049869 3300025912 Bacteria 3647
291 Ga0207707_10150627 3300025912 Unclassified 2034
292 Ga0207707_10217226 3300025912 Bacteria 1665
293 Ga0207707_10222184 3300025912 Unclassified 1644
294 Ga0207695_10022649 3300025913 Bacteria 7122
295 Ga0207695_10206793 3300025913 Bacteria 1875
296 Ga0207695_10440806 3300025913 Bacteria 1186
297 Ga0207693_10000402 3300025915 Bacteria 39488
298 Ga0207693_10008118 3300025915 Bacteria 8605
299 Ga0207693_10051323 3300025915 Bacteria 3237
300 Ga0207693_10051802 3300025915 Bacteria 3220
301 Ga0207693_10159841 3300025915 Bacteria 1772
302 Ga0207663_10003860 3300025916 Bacteria 7397
303 Ga0207663_10004728 3300025916 Bacteria 6803
304 Ga0207663_10347560 3300025916 Bacteria 1122
305 Ga0207660_10019093 3300025917 Bacteria 4578
306 Ga0207657_10001261 3300025919 Bacteria 27065
307 Ga0207649_10001661 3300025920 Bacteria 12866
308 Ga0207649_10488438 3300025920 Unclassified 935
309 Ga0207652_10168593 3300025921 Bacteria 1964
310 Ga0207646_10282658 3300025922 Bacteria 1499
311 Ga0207646_10483205 3300025922 Bacteria 1117
312 Ga0207694_10000284 3300025924 Bacteria 47825
313 Ga0207694_10053209 3300025924 Bacteria 3138
314 Ga0207694_10171950 3300025924 Bacteria 1754
315 Ga0207650_10000177 3300025925 Bacteria 75244
316 Ga0207650_10017093 3300025925 Bacteria 5078
317 Ga0207659_10361037 3300025926 Unclassified 1207
318 Ga0207687_10003150 3300025927 Bacteria 11190
319 Ga0207687_10064410 3300025927 Bacteria 2599
320 Ga0207687_10067507 3300025927 Unclassified 2544
321 Ga0207700_10006979 3300025928 Bacteria 6872
322 Ga0207700_10025629 3300025928 Unclassified 4099
323 Ga0207700_10028535 3300025928 Unclassified 3925
324 Ga0207700_10037677 3300025928 Bacteria 3504
325 Ga0207700_10202489 3300025928 Bacteria 1674
326 Ga0207700_10222605 3300025928 Bacteria 1600
327 Ga0207700_10259523 3300025928 Bacteria 1487
328 Ga0207700_10308062 3300025928 Bacteria 1369
329 Ga0207664_10096008 3300025929 Bacteria 2439
330 Ga0207664_10294738 3300025929 Unclassified 1426
331 Ga0207644_10149614 3300025931 Bacteria 1805
332 Ga0207644_10202574 3300025931 Bacteria 1566
333 Ga0207706_10000941 3300025933 Bacteria 29750
334 Ga0207706_10019421 3300025933 Bacteria 6115
335 Ga0207686_10019667 3300025934 Unclassified 3845
336 Ga0207686_10133952 3300025934 Bacteria 1703
337 Ga0207670_10060919 3300025936 Bacteria 2573
338 Ga0207704_10003491 3300025938 Bacteria 7154
339 Ga0207704_10019678 3300025938 Bacteria 3552
340 Ga0207665_10000358 3300025939 Bacteria 31676
341 Ga0207665_10037700 3300025939 Bacteria 3218
342 Ga0207665_10184325 3300025939 Unclassified 1513
343 Ga0207665_10282537 3300025939 Bacteria 1235
344 Ga0207691_10001447 3300025940 Bacteria 23651
345 Ga0207711_10183843 3300025941 Bacteria 1902
346 Ga0207689_10000542 3300025942 Bacteria 35861
347 Ga0207689_10002307 3300025942 Bacteria 17863
348 Ga0207661_10016213 3300025944 Bacteria 5494
349 Ga0207661_10065537 3300025944 Bacteria 2949
350 Ga0207661_10100415 3300025944 Bacteria 2429
351 Ga0207679_10000143 3300025945 Bacteria 59141
352 Ga0207679_10021292 3300025945 Bacteria 4394
353 Ga0207667_10000487 3300025949 Bacteria 52501
354 Ga0207667_10008691 3300025949 Bacteria 12035
355 Ga0207667_10024560 3300025949 Bacteria 6613
356 Ga0207667_10130156 3300025949 Unclassified 2592
357 Ga0207667_10151125 3300025949 Bacteria 2390
358 Ga0207667_10172327 3300025949 Bacteria 2224
359 Ga0207667_10566164 3300025949 Unclassified 1148
360 Ga0207667_10813166 3300025949 Unclassified 931
361 Ga0207651_10030416 3300025960 Bacteria 3438
362 Ga0207651_10084353 3300025960 Bacteria 2301
363 Ga0207651_10551283 3300025960 Bacteria 1002
364 Ga0207712_10021844 3300025961 Unclassified 4206
365 Ga0207668_10013931 3300025972 Bacteria 4967
366 Ga0207640_10047553 3300025981 Unclassified 2768
367 Ga0207640_10078549 3300025981 Bacteria 2247
368 Ga0207658_10015504 3300025986 Bacteria 5228
369 Ga0207658_10632976 3300025986 Unclassified 963
370 Ga0207677_10000998 3300026023 Bacteria 15626
371 Ga0207677_10002399 3300026023 Bacteria 9824
372 Ga0207677_10109793 3300026023 Bacteria 2052
373 Ga0207677_10314679 3300026023 Bacteria 1299
374 Ga0207677_10628603 3300026023 Unclassified 945
375 Ga0207703_10006117 3300026035 Bacteria 9633
376 Ga0207703_10010977 3300026035 Bacteria 7058
377 Ga0207703_10017812 3300026035 Bacteria 5547
378 Ga0207703_10083353 3300026035 Bacteria 2671
379 Ga0207703_10176019 3300026035 Bacteria 1885
380 Ga0207639_10012639 3300026041 Bacteria 5885
381 Ga0207639_10518496 3300026041 Bacteria 1091
382 Ga0207678_10001668 3300026067 Bacteria 20376
383 Ga0207702_10000482 3300026078 Bacteria 44849
384 Ga0207702_10003272 3300026078 Bacteria 14951
385 Ga0207702_10028596 3300026078 Unclassified 4634
386 Ga0207702_10039405 3300026078 Unclassified 3958
387 Ga0207702_10077565 3300026078 Bacteria 2874
388 Ga0207702_10275050 3300026078 Bacteria 1590
389 Ga0207641_10003028 3300026088 Bacteria 15142
390 Ga0207641_10209389 3300026088 Unclassified 1802
391 Ga0207641_10307463 3300026088 Bacteria 1499
392 Ga0207648_10008810 3300026089 Bacteria 9719
393 Ga0207648_10019097 3300026089 Bacteria 6187
394 Ga0207648_10363612 3300026089 Bacteria 1306
395 Ga0207676_10001159 3300026095 Bacteria 19817
396 Ga0207676_10002377 3300026095 Bacteria 13429
397 Ga0207674_10000195 3300026116 Bacteria 75067
398 Ga0207674_10000229 3300026116 Bacteria 69982
399 Ga0207674_10009145 3300026116 Bacteria 11363
400 Ga0207674_10014217 3300026116 Bacteria 8795
401 Ga0207674_10034006 3300026116 Bacteria 5332
402 Ga0207675_100399215 3300026118 Unclassified 1355
403 Ga0207683_10003688 3300026121 Bacteria 13306
404 Ga0207698_10027346 3300026142 Bacteria 4048
405 Ga0207698_10062953 3300026142 Bacteria 2900
406 Ga0207698_10158217 3300026142 Unclassified 1977
407 Ga0207698_10271381 3300026142 Unclassified 1564
408 Ga0268265_10056860 3300028380 Bacteria 2979
409 Ga0268264_10080074 3300028381 Bacteria 2788
410 Ga0268264_10102638 3300028381 Bacteria 2489
411 Ga0268264_10192689 3300028381 Unclassified 1859
412 Ga0268264_10346169 3300028381 Unclassified 1413
413 Ga0265762_1000119 3300030760 Bacteria 11713
414 Ga0265762_1057041 3300030760 Bacteria 795
415 Ga0265765_1003676 3300030879 Unclassified 1548
416 Ga0265760_10003665 3300031090 Bacteria 4452
417 Ga0265760_10004688 3300031090 Bacteria 3914
418 Ga0265760_10008406 3300031090 Bacteria 2953
419 Ga0265760_10010644 3300031090 Bacteria 2628
420 Ga0265328_10045711 3300031239 Unclassified 1610
421 Ga0265325_10026032 3300031241 Bacteria 3172
422 Ga0265340_10041679 3300031247 Unclassified 2256
423 Ga0265339_10164856 3300031249 Unclassified 1113
424 Ga0265314_10109198 3300031711 Unclassified 1761
425 Ga0316214_1012801 3300033545 Bacteria 1147
426 Ga0373926_0015941 3300035083 Bacteria 2566
427 Ga0373934_0147038 3300035086 Bacteria 964
428 Ga0373923_0036252 3300035111 Bacteria 2012
429 Ga0373936_0004184 3300035113 Bacteria 5439
430 Ga0373945_0021506 3300035116 Bacteria 2217
431 Ga0373954_0301359 3300035118 Bacteria 791
432 Ga0373956_0012621 3300035119 Bacteria 3505
433 Ga0373956_0043386 3300035119 Bacteria 2002
434 Ga0373956_0104490 3300035119 Bacteria 1316
435 Ga0373943_0000047 3300035170 Bacteria 41181
436 Ga0373943_0001571 3300035170 Bacteria 10341
437 Ga0373946_0037452 3300035171 Bacteria 1971
438 Ga0373955_0012079 3300035172 Bacteria 4142
439 Ga0373955_0128684 3300035172 Bacteria 1477
440 Ga0373955_0164239 3300035172 Bacteria 1312
441 Ga0373924_0020440 3300035410 Unclassified 2574
442 Ga0373924_0036100 3300035410 Unclassified 2007
443 Ga0373924_0132583 3300035410 Bacteria 1084
444 Ga0373931_0025417 3300035691 Bacteria 3008
445 Ga0373935_0000841 3300035692 Bacteria 16552
446 Ga0373935_0001112 3300035692 Bacteria 14666
447 Ga0373935_0001333 3300035692 Bacteria 13657
448 Ga0373935_0149794 3300035692 Bacteria 1582
449 Ga0373935_0225206 3300035692 Unclassified 1304
450 Ga0373927_0000447 3300035695 Bacteria 31498
451 Ga0373927_0004796 3300035695 Bacteria 9410
452 Ga0373927_0082982 3300035695 Bacteria 2078
453 Ga0373927_0089947 3300035695 Bacteria 1993
454 Ga0373927_0107307 3300035695 Bacteria 1819
455 Ga0373933_0012118 3300035724 Bacteria 4761
456 Ga0373933_0072959 3300035724 Bacteria 2091
457 Ga0373947_0000112 3300035725 Bacteria 40758
458 Ga0373947_0027135 3300035725 Bacteria 3350
459 Ga0373947_0052737 3300035725 Bacteria 2450
460 Ga0373947_0100168 3300035725 Bacteria 1820
461 Ga0373937_0000204 3300036401 Bacteria 57131
462 Ga0373937_0121435 3300036401 Bacteria 2435
463 Ga0373937_0138477 3300036401 Bacteria 2276
464 Ga0373937_0147343 3300036401 Unclassified 2204
465 Ga0373937_0317780 3300036401 Bacteria 1473
466 Ga0373925_0000770 3300037068 Bacteria 29427
467 Ga0373925_0001810 3300037068 Bacteria 17840
468 Ga0373925_0008172 3300037068 Bacteria 7620
469 Ga0373925_0008202 3300037068 Bacteria 7604
470 Ga0373925_0042863 3300037068 Bacteria 3357
471 Ga0395901_0254013 3300038443 Unclassified 1831
472 Ga0466963_0001070 3300044694 Bacteria 14274
473 Ga0453684_0435579 3300044712 Unclassified 1462
474 Ga0451576_0358914 3300045051 Bacteria 1526
475 Ga0451576_0394431 3300045051 Bacteria 1451
476 Ga0451576_0462429 3300045051 Unclassified 1332
477 Ga0466958_0254892 3300045836 Unclassified 1123
478 Ga0466967_0005563 3300045976 Bacteria 8753
479 Ga0466967_0377625 3300045976 Bacteria 1376
480 Ga0495603_0057720 3300046455 Unclassified 2296
481 Ga0495603_0390896 3300046455 Unclassified 797
482 Ga0495651_0131872 3300046462 Bacteria 1823
483 Ga0495580_0001544 3300046472 Bacteria 20251
484 Ga0495580_0007898 3300046472 Bacteria 8510
485 Ga0495580_0008448 3300046472 Bacteria 8191
486 Ga0495580_0020794 3300046472 Unclassified 4851
487 Ga0495580_0124153 3300046472 Bacteria 1792
488 Ga0495580_0131868 3300046472 Bacteria 1733
489 Ga0495582_0048059 3300046473 Bacteria 2350
490 Ga0495582_0258575 3300046473 Bacteria 999
491 Ga0495639_0101969 3300046475 Bacteria 1356
492 Ga0495664_0200912 3300046477 Unclassified 1208
493 Ga0495628_0211608 3300046516 Bacteria 1458
494 Ga0495652_0352663 3300046529 Bacteria 1054
495 Ga0495665_0006637 3300046531 Bacteria 6245
496 Ga0495665_0020860 3300046531 Bacteria 3520
497 Ga0495667_0430715 3300046559 Bacteria 830
498 Ga0495635_0262559 3300046663 Bacteria 1163
499 Ga0495599_0412917 3300046678 Bacteria 803
500 Ga0495623_0001371 3300046679 Bacteria 16530
501 Ga0495658_0022720 3300046683 Bacteria 3321
502 Ga0495669_0105202 3300046684 Unclassified 1314
503 Ga0495581_0018527 3300047315 Bacteria 4043
504 Ga0495581_0041757 3300047315 Bacteria 2655
505 Ga0495604_0090018 3300047317 Bacteria 2280
506 Ga0495674_0034545 3300047319 Bacteria 4572
507 Ga0496100_0359218 3300048903 Bacteria 1102
508 Ga0496101_0209200 3300048904 Unclassified 1511
509 Ga0496102_0241091 3300048905 Bacteria 1705
510 Ga0496102_0275079 3300048905 Bacteria 1587
511 Ga0496102_0485209 3300048905 Unclassified 1157
512 Ga0496104_0101247 3300048907 Bacteria 2758
513 Ga0496104_0224142 3300048907 Bacteria 1792
514 Ga0496105_0020434 3300048908 Bacteria 5350
515 Ga0496107_0280146 3300048910 Bacteria 1241
516 Ga0496108_0000689 3300048911 Bacteria 26147
517 Ga0496108_0013237 3300048911 Bacteria 6724
518 Ga0496109_0001300 3300048912 Bacteria 20670
519 Ga0496109_0034301 3300048912 Bacteria 4570
520 Ga0496110_0008161 3300048913 Bacteria 8412
521 Ga0496110_0042861 3300048913 Bacteria 3950
522 Ga0496110_0251347 3300048913 Bacteria 1609
523 Ga0496111_0102159 3300048914 Bacteria 2107
524 Ga0496111_0197289 3300048914 Unclassified 1496
525 Ga0496112_0006571 3300048915 Bacteria 10232
526 Ga0496112_0027881 3300048915 Bacteria 5448
527 Ga0496112_0042724 3300048915 Unclassified 4435
528 Ga0496112_0043787 3300048915 Bacteria 4383
529 Ga0496112_0072910 3300048915 Bacteria 3394
530 Ga0496112_0083914 3300048915 Bacteria 3151
531 Ga0496112_0085247 3300048915 Bacteria 3126
532 Ga0496113_0003019 3300048916 Bacteria 9971
533 Ga0496113_0004283 3300048916 Bacteria 8742
534 Ga0496115_0065577 3300048918 Bacteria 2933
535 Ga0501031_0645590 3300049568 Unclassified 680
536 Ga0501040_0129757 3300049576 Unclassified 1772
537 Ga0501042_0307744 3300049578 Unclassified 1145
538 Ga0501071_0015344 3300049587 Bacteria 5258
539 Ga0501075_0030607 3300049591 Bacteria 3988
540 Ga0501076_0080135 3300049592 Unclassified 2620
541 Ga0501079_0134427 3300049741 Unclassified 1925
542 Ga0501080_0141223 3300049742 Unclassified 2226
543 Ga0501081_0291844 3300049743 Bacteria 1195
544 nmdc:mga0n895_133536_c1 3300050512 Bacteria 2508
545 nmdc:mga0n895_1564_c1 3300050512 Bacteria 17207
546 nmdc:mga0rr50_40678_c1 3300050513 Bacteria 3381
547 nmdc:mga0rr50_6304_c1 3300050513 Bacteria 7204
548 nmdc:mga0rr50_7316_c1 3300050513 Bacteria 6796
549 nmdc:mga08x19_2888_c1 3300050514 Bacteria 10345
550 nmdc:mga08x19_3182_c1 3300050514 Bacteria 9850
551 nmdc:mga08x19_35485_c1 3300050514 Bacteria 3155
552 nmdc:mga0a205_1800_c1 3300050515 Bacteria 18534
553 Ga0495619_0129171 3300053085 Bacteria 1736
554 Ga0501082_0029757 3300060353 Bacteria 4705
555 Ga0530510_0021704 3300061734 Bacteria 4568

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0645590 Ga0501031_0645590_83_670 188
2 3300049587 Ga0501071_0015344 Ga0501071_0015344_2996_3583 188
3 3300049592 Ga0501076_0080135 Ga0501076_0080135_1997_2584 188
4 3300060353 Ga0501082_0029757 Ga0501082_0029757_1410_1997 188
5 3300005329 Ga0070683_100183174 Ga0070683_1001831744 215
6 3300005331 Ga0070670_100048417 Ga0070670_1000484174 215
7 3300005456 Ga0070678_100033339 Ga0070678_1000333394 215
8 3300005563 Ga0068855_100063779 Ga0068855_1000637792 215
9 3300005577 Ga0068857_100029113 Ga0068857_1000291135 215
10 3300005616 Ga0068852_100621350 Ga0068852_1006213502 215
11 3300005618 Ga0068864_100018702 Ga0068864_1000187025 215
12 3300005841 Ga0068863_100008272 Ga0068863_10000827212 215
13 3300010375 Ga0105239_10384835 Ga0105239_103848352 215
14 3300013296 Ga0157374_10109111 Ga0157374_101091114 215
15 3300014325 Ga0163163_10030507 Ga0163163_100305074 215
16 3300025944 Ga0207661_10100415 Ga0207661_101004154 215
17 3300026088 Ga0207641_10209389 Ga0207641_102093892 215
18 3300026116 Ga0207674_10009145 Ga0207674_100091454 215
19 3300044712 Ga0453684_0435579 Ga0453684_0435579_141_857 215
20 3300046684 Ga0495669_0105202 Ga0495669_0105202_165_881 215
21 3300048911 Ga0496108_0013237 Ga0496108_0013237_3551_4267 215
22 3300048912 Ga0496109_0034301 Ga0496109_0034301_1250_1966 215
23 3300048915 Ga0496112_0072910 Ga0496112_0072910_2332_3048 215
24 3300049576 Ga0501040_0129757 Ga0501040_0129757_101_787 218
25 3300049578 Ga0501042_0307744 Ga0501042_0307744_93_779 218
26 3300049591 Ga0501075_0030607 Ga0501075_0030607_2887_3573 218
27 3300049741 Ga0501079_0134427 Ga0501079_0134427_833_1519 218
28 3300049742 Ga0501080_0141223 Ga0501080_0141223_1471_2157 218
29 3300049743 Ga0501081_0291844 Ga0501081_0291844_57_743 218
30 3300061734 Ga0530510_0021704 Ga0530510_0021704_2372_3058 218
31 3300013307 Ga0157372_10144870 Ga0157372_101448702 221
32 3300005436 Ga0070713_100058739 Ga0070713_1000587392 231
33 3300035692 Ga0373935_0225206 Ga0373935_0225206_97_810 231
34 3300035695 Ga0373927_0107307 Ga0373927_0107307_419_1132 231
35 3300035725 Ga0373947_0100168 Ga0373947_0100168_745_1458 231
36 3300005563 Ga0068855_100765441 Ga0068855_1007654412 232
37 3300009174 Ga0105241_10044572 Ga0105241_100445724 232
38 3300009545 Ga0105237_10501110 Ga0105237_105011102 232
39 3300009551 Ga0105238_10317607 Ga0105238_103176071 232
40 3300013100 Ga0157373_10360623 Ga0157373_103606231 232
41 3300014325 Ga0163163_10004099 Ga0163163_1000409913 232
42 3300025949 Ga0207667_10130156 Ga0207667_101301562 232
43 3300026078 Ga0207702_10077565 Ga0207702_100775654 232
44 3300035172 Ga0373955_0128684 Ga0373955_0128684_433_1149 232
45 3300046472 Ga0495580_0124153 Ga0495580_0124153_622_1338 232
46 3300046559 Ga0495667_0430715 Ga0495667_0430715_22_738 232
47 3300046663 Ga0495635_0262559 Ga0495635_0262559_113_829 232
48 3300048913 Ga0496110_0251347 Ga0496110_0251347_407_1123 232
49 3300053085 Ga0495619_0129171 Ga0495619_0129171_671_1387 232
50 3300005468 Ga0070707_100022230 Ga0070707_1000222303 233
51 3300005518 Ga0070699_100002709 Ga0070699_1000027097 233
52 3300045051 Ga0451576_0358914 Ga0451576_0358914_385_1155 233
53 3300046462 Ga0495651_0131872 Ga0495651_0131872_201_902 233
54 3300005337 Ga0070682_100023124 Ga0070682_1000231243 234
55 3300005340 Ga0070689_100026875 Ga0070689_1000268754 234
56 3300005347 Ga0070668_100056334 Ga0070668_1000563343 234
57 3300005353 Ga0070669_100031734 Ga0070669_1000317342 234
58 3300005434 Ga0070709_10065582 Ga0070709_100655822 234
59 3300005435 Ga0070714_100091694 Ga0070714_1000916942 234
60 3300005435 Ga0070714_100173064 Ga0070714_1001730643 234
61 3300005435 Ga0070714_100266166 Ga0070714_1002661662 234
62 3300005435 Ga0070714_100339711 Ga0070714_1003397112 234
63 3300005436 Ga0070713_100113612 Ga0070713_1001136123 234
64 3300005436 Ga0070713_100279556 Ga0070713_1002795561 234
65 3300005437 Ga0070710_10011795 Ga0070710_100117952 234
66 3300005439 Ga0070711_100012311 Ga0070711_1000123112 234
67 3300005439 Ga0070711_100012589 Ga0070711_1000125893 234
68 3300005439 Ga0070711_100038547 Ga0070711_1000385473 234
69 3300005439 Ga0070711_100078540 Ga0070711_1000785402 234
70 3300005439 Ga0070711_100345000 Ga0070711_1003450001 234
71 3300005445 Ga0070708_101001314 Ga0070708_1010013141 234
72 3300005457 Ga0070662_100005317 Ga0070662_1000053174 234
73 3300005467 Ga0070706_100000278 Ga0070706_10000027848 234
74 3300005468 Ga0070707_100076687 Ga0070707_1000766874 234
75 3300005471 Ga0070698_100051792 Ga0070698_1000517921 234
76 3300005471 Ga0070698_100110325 Ga0070698_1001103253 234
77 3300005518 Ga0070699_100020254 Ga0070699_1000202546 234
78 3300005530 Ga0070679_100091382 Ga0070679_1000913822 234
79 3300005536 Ga0070697_100000049 Ga0070697_1000000499 234
80 3300005536 Ga0070697_100000158 Ga0070697_10000015823 234
81 3300005536 Ga0070697_100005879 Ga0070697_1000058797 234
82 3300005545 Ga0070695_100048381 Ga0070695_1000483813 234
83 3300005546 Ga0070696_100008369 Ga0070696_1000083692 234
84 3300005549 Ga0070704_100150447 Ga0070704_1001504472 234
85 3300005563 Ga0068855_100137310 Ga0068855_1001373102 234
86 3300005578 Ga0068854_100004626 Ga0068854_1000046265 234
87 3300005614 Ga0068856_100008311 Ga0068856_1000083116 234
88 3300005614 Ga0068856_100020557 Ga0068856_1000205576 234
89 3300005616 Ga0068852_100161338 Ga0068852_1001613383 234
90 3300005842 Ga0068858_100077679 Ga0068858_1000776794 234
91 3300005843 Ga0068860_100011500 Ga0068860_1000115007 234
92 3300005983 Ga0081540_1110156 Ga0081540_11101562 234
93 3300005983 Ga0081540_1147245 Ga0081540_11472452 234
94 3300006028 Ga0070717_10226286 Ga0070717_102262862 234
95 3300006028 Ga0070717_10236080 Ga0070717_102360802 234
96 3300006163 Ga0070715_10050443 Ga0070715_100504434 234
97 3300006163 Ga0070715_10122083 Ga0070715_101220832 234
98 3300006173 Ga0070716_100003540 Ga0070716_1000035409 234
99 3300006175 Ga0070712_100002390 Ga0070712_1000023908 234
100 3300006175 Ga0070712_100012269 Ga0070712_1000122694 234
101 3300006175 Ga0070712_100059128 Ga0070712_1000591282 234
102 3300006175 Ga0070712_100552249 Ga0070712_1005522491 234
103 3300006175 Ga0070712_100890687 Ga0070712_1008906871 234
104 3300006358 Ga0068871_100018971 Ga0068871_1000189712 234
105 3300006852 Ga0075433_10001098 Ga0075433_100010988 234
106 3300006871 Ga0075434_100000195 Ga0075434_10000019539 234
107 3300006914 Ga0075436_100004841 Ga0075436_1000048419 234
108 3300006914 Ga0075436_100042255 Ga0075436_1000422554 234
109 3300006914 Ga0075436_100561083 Ga0075436_1005610831 234
110 3300007076 Ga0075435_100000065 Ga0075435_10000006536 234
111 3300009093 Ga0105240_10029292 Ga0105240_100292924 234
112 3300009093 Ga0105240_10504761 Ga0105240_105047612 234
113 3300009093 Ga0105240_10624398 Ga0105240_106243982 234
114 3300009098 Ga0105245_10054629 Ga0105245_100546292 234
115 3300009098 Ga0105245_10324423 Ga0105245_103244231 234
116 3300009101 Ga0105247_10006341 Ga0105247_100063414 234
117 3300009174 Ga0105241_10087172 Ga0105241_100871723 234
118 3300009174 Ga0105241_10165548 Ga0105241_101655482 234
119 3300009174 Ga0105241_10184527 Ga0105241_101845273 234
120 3300009174 Ga0105241_10330440 Ga0105241_103304402 234
121 3300009176 Ga0105242_10009165 Ga0105242_100091658 234
122 3300009176 Ga0105242_10499047 Ga0105242_104990472 234
123 3300009177 Ga0105248_10021967 Ga0105248_100219675 234
124 3300009545 Ga0105237_10403751 Ga0105237_104037513 234
125 3300009551 Ga0105238_10014582 Ga0105238_100145824 234
126 3300009551 Ga0105238_10227665 Ga0105238_102276652 234
127 3300009551 Ga0105238_10346525 Ga0105238_103465252 234
128 3300009553 Ga0105249_10024924 Ga0105249_100249243 234
129 3300010159 Ga0099796_10063845 Ga0099796_100638452 234
130 3300010375 Ga0105239_10114979 Ga0105239_101149793 234
131 3300010375 Ga0105239_10221559 Ga0105239_102215592 234
132 3300011119 Ga0105246_10007122 Ga0105246_100071223 234
133 3300013100 Ga0157373_10180002 Ga0157373_101800022 234
134 3300013100 Ga0157373_10244058 Ga0157373_102440581 234
135 3300013104 Ga0157370_10166681 Ga0157370_101666811 234
136 3300013104 Ga0157370_10516345 Ga0157370_105163452 234
137 3300013296 Ga0157374_10005580 Ga0157374_100055801 234
138 3300013296 Ga0157374_10048161 Ga0157374_100481614 234
139 3300013297 Ga0157378_10024706 Ga0157378_100247062 234
140 3300013297 Ga0157378_10206842 Ga0157378_102068422 234
141 3300013306 Ga0163162_10002555 Ga0163162_1000255512 234
142 3300013307 Ga0157372_10010989 Ga0157372_100109898 234
143 3300013307 Ga0157372_10220384 Ga0157372_102203842 234
144 3300013307 Ga0157372_10802984 Ga0157372_108029842 234
145 3300013308 Ga0157375_11569969 Ga0157375_115699691 234
146 3300014325 Ga0163163_10028700 Ga0163163_100287007 234
147 3300014968 Ga0157379_10062392 Ga0157379_100623923 234
148 3300022730 Ga0224570_101606 Ga0224570_1016063 234
149 3300025321 Ga0207656_10071485 Ga0207656_100714851 234
150 3300025898 Ga0207692_10002000 Ga0207692_100020002 234
151 3300025898 Ga0207692_10325845 Ga0207692_103258452 234
152 3300025900 Ga0207710_10065474 Ga0207710_100654742 234
153 3300025903 Ga0207680_10019827 Ga0207680_100198271 234
154 3300025905 Ga0207685_10057151 Ga0207685_100571511 234
155 3300025905 Ga0207685_10061440 Ga0207685_100614402 234
156 3300025905 Ga0207685_10100452 Ga0207685_101004522 234
157 3300025906 Ga0207699_10041384 Ga0207699_100413843 234
158 3300025910 Ga0207684_10001907 Ga0207684_100019079 234
159 3300025911 Ga0207654_10032167 Ga0207654_100321672 234
160 3300025911 Ga0207654_10098528 Ga0207654_100985282 234
161 3300025911 Ga0207654_10113626 Ga0207654_101136261 234
162 3300025912 Ga0207707_10034516 Ga0207707_100345162 234
163 3300025912 Ga0207707_10150627 Ga0207707_101506273 234
164 3300025912 Ga0207707_10217226 Ga0207707_102172262 234
165 3300025912 Ga0207707_10222184 Ga0207707_102221842 234
166 3300025913 Ga0207695_10022649 Ga0207695_100226496 234
167 3300025915 Ga0207693_10000402 Ga0207693_100004027 234
168 3300025915 Ga0207693_10008118 Ga0207693_100081188 234
169 3300025915 Ga0207693_10051802 Ga0207693_100518022 234
170 3300025915 Ga0207693_10159841 Ga0207693_101598412 234
171 3300025916 Ga0207663_10003860 Ga0207663_100038607 234
172 3300025916 Ga0207663_10004728 Ga0207663_100047286 234
173 3300025916 Ga0207663_10347560 Ga0207663_103475602 234
174 3300025917 Ga0207660_10019093 Ga0207660_100190934 234
175 3300025921 Ga0207652_10168593 Ga0207652_101685933 234
176 3300025922 Ga0207646_10282658 Ga0207646_102826581 234
177 3300025922 Ga0207646_10483205 Ga0207646_104832052 234
178 3300025928 Ga0207700_10006979 Ga0207700_100069795 234
179 3300025928 Ga0207700_10222605 Ga0207700_102226052 234
180 3300025929 Ga0207664_10096008 Ga0207664_100960082 234
181 3300025929 Ga0207664_10294738 Ga0207664_102947381 234
182 3300025933 Ga0207706_10000941 Ga0207706_1000094127 234
183 3300025934 Ga0207686_10019667 Ga0207686_100196674 234
184 3300025934 Ga0207686_10133952 Ga0207686_101339522 234
185 3300025939 Ga0207665_10000358 Ga0207665_100003589 234
186 3300025939 Ga0207665_10037700 Ga0207665_100377003 234
187 3300025939 Ga0207665_10184325 Ga0207665_101843252 234
188 3300025949 Ga0207667_10024560 Ga0207667_100245605 234
189 3300025949 Ga0207667_10151125 Ga0207667_101511253 234
190 3300025949 Ga0207667_10566164 Ga0207667_105661642 234
191 3300025949 Ga0207667_10813166 Ga0207667_108131661 234
192 3300025961 Ga0207712_10021844 Ga0207712_100218441 234
193 3300025972 Ga0207668_10013931 Ga0207668_100139314 234
194 3300025981 Ga0207640_10047553 Ga0207640_100475532 234
195 3300025986 Ga0207658_10015504 Ga0207658_100155041 234
196 3300026023 Ga0207677_10002399 Ga0207677_1000239910 234
197 3300026023 Ga0207677_10314679 Ga0207677_103146792 234
198 3300026035 Ga0207703_10017812 Ga0207703_100178126 234
199 3300026078 Ga0207702_10028596 Ga0207702_100285962 234
200 3300026078 Ga0207702_10039405 Ga0207702_100394052 234
201 3300026089 Ga0207648_10363612 Ga0207648_103636122 234
202 3300026116 Ga0207674_10014217 Ga0207674_100142176 234
203 3300026142 Ga0207698_10027346 Ga0207698_100273462 234
204 3300026142 Ga0207698_10158217 Ga0207698_101582173 234
205 3300028380 Ga0268265_10056860 Ga0268265_100568603 234
206 3300028381 Ga0268264_10102638 Ga0268264_101026382 234
207 3300030760 Ga0265762_1000119 Ga0265762_10001197 234
208 3300030760 Ga0265762_1057041 Ga0265762_10570411 234
209 3300030879 Ga0265765_1003676 Ga0265765_10036762 234
210 3300031090 Ga0265760_10003665 Ga0265760_100036653 234
211 3300031090 Ga0265760_10004688 Ga0265760_100046884 234
212 3300031090 Ga0265760_10008406 Ga0265760_100084062 234
213 3300031090 Ga0265760_10010644 Ga0265760_100106443 234
214 3300031239 Ga0265328_10045711 Ga0265328_100457112 234
215 3300031241 Ga0265325_10026032 Ga0265325_100260322 234
216 3300031247 Ga0265340_10041679 Ga0265340_100416792 234
217 3300031249 Ga0265339_10164856 Ga0265339_101648561 234
218 3300031711 Ga0265314_10109198 Ga0265314_101091982 234
219 3300033545 Ga0316214_1012801 Ga0316214_10128012 234
220 3300035086 Ga0373934_0147038 Ga0373934_0147038_200_904 234
221 3300035116 Ga0373945_0021506 Ga0373945_0021506_119_853 234
222 3300035119 Ga0373956_0043386 Ga0373956_0043386_104_808 234
223 3300035119 Ga0373956_0104490 Ga0373956_0104490_160_864 234
224 3300035170 Ga0373943_0000047 Ga0373943_0000047_9576_10310 234
225 3300035171 Ga0373946_0037452 Ga0373946_0037452_1159_1893 234
226 3300035172 Ga0373955_0012079 Ga0373955_0012079_2134_2838 234
227 3300035172 Ga0373955_0164239 Ga0373955_0164239_160_864 234
228 3300035410 Ga0373924_0132583 Ga0373924_0132583_154_858 234
229 3300035692 Ga0373935_0000841 Ga0373935_0000841_2999_3733 234
230 3300035695 Ga0373927_0000447 Ga0373927_0000447_29985_30719 234
231 3300035695 Ga0373927_0082982 Ga0373927_0082982_303_1007 234
232 3300035724 Ga0373933_0012118 Ga0373933_0012118_2905_3609 234
233 3300035724 Ga0373933_0072959 Ga0373933_0072959_153_857 234
234 3300035725 Ga0373947_0000112 Ga0373947_0000112_35983_36717 234
235 3300036401 Ga0373937_0121435 Ga0373937_0121435_575_1279 234
236 3300036401 Ga0373937_0138477 Ga0373937_0138477_1384_2088 234
237 3300036401 Ga0373937_0317780 Ga0373937_0317780_29_733 234
238 3300037068 Ga0373925_0000770 Ga0373925_0000770_934_1668 234
239 3300037068 Ga0373925_0008172 Ga0373925_0008172_5391_6095 234
240 3300038443 Ga0395901_0254013 Ga0395901_0254013_503_1210 234
241 3300045051 Ga0451576_0394431 Ga0451576_0394431_47_751 234
242 3300045051 Ga0451576_0462429 Ga0451576_0462429_133_840 234
243 3300046455 Ga0495603_0057720 Ga0495603_0057720_480_1184 234
244 3300046455 Ga0495603_0390896 Ga0495603_0390896_22_726 234
245 3300046472 Ga0495580_0001544 Ga0495580_0001544_14885_15589 234
246 3300046472 Ga0495580_0008448 Ga0495580_0008448_2486_3190 234
247 3300046473 Ga0495582_0258575 Ga0495582_0258575_64_768 234
248 3300046475 Ga0495639_0101969 Ga0495639_0101969_409_1113 234
249 3300046477 Ga0495664_0200912 Ga0495664_0200912_332_1066 234
250 3300046516 Ga0495628_0211608 Ga0495628_0211608_414_1148 234
251 3300046529 Ga0495652_0352663 Ga0495652_0352663_232_936 234
252 3300046678 Ga0495599_0412917 Ga0495599_0412917_88_792 234
253 3300046679 Ga0495623_0001371 Ga0495623_0001371_15401_16105 234
254 3300046683 Ga0495658_0022720 Ga0495658_0022720_412_1116 234
255 3300047315 Ga0495581_0041757 Ga0495581_0041757_562_1266 234
256 3300047317 Ga0495604_0090018 Ga0495604_0090018_268_1002 234
257 3300047319 Ga0495674_0034545 Ga0495674_0034545_1254_1988 234
258 3300048905 Ga0496102_0241091 Ga0496102_0241091_193_897 234
259 3300048907 Ga0496104_0224142 Ga0496104_0224142_312_1016 234
260 3300048915 Ga0496112_0085247 Ga0496112_0085247_1191_1895 234
261 3300050512 nmdc:mga0n895_133536_c1 nmdc:mga0n895_133536_c1_847_1551 234
262 3300050512 nmdc:mga0n895_1564_c1 nmdc:mga0n895_1564_c1_12452_13156 234
263 3300050513 nmdc:mga0rr50_40678_c1 nmdc:mga0rr50_40678_c1_2274_2978 234
264 3300050513 nmdc:mga0rr50_7316_c1 nmdc:mga0rr50_7316_c1_5894_6598 234
265 3300050514 nmdc:mga08x19_3182_c1 nmdc:mga08x19_3182_c1_8211_8915 234
266 3300050514 nmdc:mga08x19_35485_c1 nmdc:mga08x19_35485_c1_575_1279 234
267 3300050515 nmdc:mga0a205_1800_c1 nmdc:mga0a205_1800_c1_11575_12279 234
268 3300005329 Ga0070683_100184167 Ga0070683_1001841672 235
269 3300005338 Ga0068868_100012948 Ga0068868_1000129481 235
270 3300005436 Ga0070713_100054518 Ga0070713_1000545183 235
271 3300005458 Ga0070681_10303423 Ga0070681_103034232 235
272 3300005468 Ga0070707_100216107 Ga0070707_1002161072 235
273 3300005535 Ga0070684_100057935 Ga0070684_1000579352 235
274 3300005539 Ga0068853_100024017 Ga0068853_1000240176 235
275 3300005578 Ga0068854_100854600 Ga0068854_1008546001 235
276 3300005616 Ga0068852_100093344 Ga0068852_1000933444 235
277 3300005834 Ga0068851_10423839 Ga0068851_104238391 235
278 3300006028 Ga0070717_10020604 Ga0070717_100206042 235
279 3300006914 Ga0075436_100275532 Ga0075436_1002755322 235
280 3300009093 Ga0105240_10017855 Ga0105240_1001785511 235
281 3300009093 Ga0105240_10078716 Ga0105240_100787163 235
282 3300009098 Ga0105245_10002858 Ga0105245_100028584 235
283 3300009098 Ga0105245_10550211 Ga0105245_105502112 235
284 3300009174 Ga0105241_10153074 Ga0105241_101530742 235
285 3300009545 Ga0105237_10236827 Ga0105237_102368271 235
286 3300013105 Ga0157369_10499701 Ga0157369_104997012 235
287 3300013307 Ga0157372_10004868 Ga0157372_100048684 235
288 3300025910 Ga0207684_10232864 Ga0207684_102328642 235
289 3300025912 Ga0207707_10049869 Ga0207707_100498692 235
290 3300025913 Ga0207695_10440806 Ga0207695_104408062 235
291 3300025924 Ga0207694_10053209 Ga0207694_100532094 235
292 3300025924 Ga0207694_10171950 Ga0207694_101719502 235
293 3300025927 Ga0207687_10003150 Ga0207687_100031505 235
294 3300025928 Ga0207700_10202489 Ga0207700_102024891 235
295 3300025928 Ga0207700_10259523 Ga0207700_102595232 235
296 3300025928 Ga0207700_10308062 Ga0207700_103080622 235
297 3300026041 Ga0207639_10518496 Ga0207639_105184961 235
298 3300026078 Ga0207702_10275050 Ga0207702_102750502 235
299 3300026142 Ga0207698_10062953 Ga0207698_100629533 235
300 3300035083 Ga0373926_0015941 Ga0373926_0015941_1078_1800 235
301 3300035111 Ga0373923_0036252 Ga0373923_0036252_1064_1771 235
302 3300035119 Ga0373956_0012621 Ga0373956_0012621_1212_1931 235
303 3300035170 Ga0373943_0001571 Ga0373943_0001571_7426_8148 235
304 3300035410 Ga0373924_0020440 Ga0373924_0020440_273_980 235
305 3300035692 Ga0373935_0001333 Ga0373935_0001333_6930_7637 235
306 3300035692 Ga0373935_0149794 Ga0373935_0149794_19_741 235
307 3300035695 Ga0373927_0004796 Ga0373927_0004796_7505_8227 235
308 3300035695 Ga0373927_0089947 Ga0373927_0089947_385_1092 235
309 3300035725 Ga0373947_0027135 Ga0373947_0027135_241_948 235
310 3300035725 Ga0373947_0052737 Ga0373947_0052737_637_1359 235
311 3300036401 Ga0373937_0000204 Ga0373937_0000204_394_1101 235
312 3300037068 Ga0373925_0008202 Ga0373925_0008202_5791_6513 235
313 3300037068 Ga0373925_0042863 Ga0373925_0042863_911_1618 235
314 3300044694 Ga0466963_0001070 Ga0466963_0001070_12075_12782 235
315 3300045836 Ga0466958_0254892 Ga0466958_0254892_72_779 235
316 3300045976 Ga0466967_0005563 Ga0466967_0005563_819_1526 235
317 3300045976 Ga0466967_0377625 Ga0466967_0377625_198_905 235
318 3300046472 Ga0495580_0131868 Ga0495580_0131868_680_1402 235
319 3300046473 Ga0495582_0048059 Ga0495582_0048059_212_934 235
320 3300046531 Ga0495665_0020860 Ga0495665_0020860_1219_1926 235
321 3300048908 Ga0496105_0020434 Ga0496105_0020434_1003_1710 235
322 3300048910 Ga0496107_0280146 Ga0496107_0280146_288_995 235
323 3300048915 Ga0496112_0027881 Ga0496112_0027881_313_1020 235
324 3300048916 Ga0496113_0003019 Ga0496113_0003019_7464_8171 235
325 3300005338 Ga0068868_100012287 Ga0068868_1000122872 236
326 3300005437 Ga0070710_10020546 Ga0070710_100205462 236
327 3300005458 Ga0070681_10003480 Ga0070681_100034809 236
328 3300005530 Ga0070679_100063805 Ga0070679_1000638053 236
329 3300005535 Ga0070684_100243220 Ga0070684_1002432202 236
330 3300005539 Ga0068853_100041531 Ga0068853_1000415312 236
331 3300005577 Ga0068857_100031365 Ga0068857_1000313652 236
332 3300005614 Ga0068856_100001986 Ga0068856_1000019863 236
333 3300005834 Ga0068851_10107976 Ga0068851_101079762 236
334 3300005842 Ga0068858_100237633 Ga0068858_1002376331 236
335 3300006173 Ga0070716_100080483 Ga0070716_1000804831 236
336 3300006237 Ga0097621_100002603 Ga0097621_1000026038 236
337 3300006358 Ga0068871_100001192 Ga0068871_10000119212 236
338 3300009093 Ga0105240_10065441 Ga0105240_100654415 236
339 3300009174 Ga0105241_10023905 Ga0105241_100239052 236
340 3300009545 Ga0105237_10183979 Ga0105237_101839792 236
341 3300009551 Ga0105238_10000417 Ga0105238_1000041723 236
342 3300013102 Ga0157371_10528214 Ga0157371_105282141 236
343 3300013105 Ga0157369_10000258 Ga0157369_100002583 236
344 3300013296 Ga0157374_10001052 Ga0157374_100010529 236
345 3300013297 Ga0157378_10002142 Ga0157378_1000214213 236
346 3300013307 Ga0157372_10000335 Ga0157372_1000033540 236
347 3300025321 Ga0207656_10195614 Ga0207656_101956141 236
348 3300025913 Ga0207695_10206793 Ga0207695_102067932 236
349 3300025915 Ga0207693_10051323 Ga0207693_100513233 236
350 3300025924 Ga0207694_10000284 Ga0207694_1000028438 236
351 3300025928 Ga0207700_10025629 Ga0207700_100256292 236
352 3300025928 Ga0207700_10028535 Ga0207700_100285353 236
353 3300025928 Ga0207700_10037677 Ga0207700_100376771 236
354 3300025939 Ga0207665_10282537 Ga0207665_102825372 236
355 3300025949 Ga0207667_10000487 Ga0207667_1000048740 236
356 3300026023 Ga0207677_10109793 Ga0207677_101097933 236
357 3300026035 Ga0207703_10176019 Ga0207703_101760191 236
358 3300026041 Ga0207639_10012639 Ga0207639_100126392 236
359 3300026078 Ga0207702_10000482 Ga0207702_1000048222 236
360 3300026116 Ga0207674_10034006 Ga0207674_100340063 236
361 3300035113 Ga0373936_0004184 Ga0373936_0004184_2181_2897 236
362 3300035118 Ga0373954_0301359 Ga0373954_0301359_44_754 236
363 3300035410 Ga0373924_0036100 Ga0373924_0036100_142_852 236
364 3300035692 Ga0373935_0001112 Ga0373935_0001112_8306_9022 236
365 3300036401 Ga0373937_0147343 Ga0373937_0147343_335_1045 236
366 3300037068 Ga0373925_0001810 Ga0373925_0001810_5466_6182 236
367 3300046472 Ga0495580_0007898 Ga0495580_0007898_3168_3884 236
368 3300046472 Ga0495580_0020794 Ga0495580_0020794_4123_4839 236
369 3300046531 Ga0495665_0006637 Ga0495665_0006637_4640_5356 236
370 3300047315 Ga0495581_0018527 Ga0495581_0018527_2712_3428 236
371 3300048905 Ga0496102_0275079 Ga0496102_0275079_618_1328 236
372 3300048907 Ga0496104_0101247 Ga0496104_0101247_121_831 236
373 3300048913 Ga0496110_0042861 Ga0496110_0042861_1245_1955 236
374 3300048914 Ga0496111_0102159 Ga0496111_0102159_224_934 236
375 3300048915 Ga0496112_0043787 Ga0496112_0043787_1556_2266 236
376 3300048918 Ga0496115_0065577 Ga0496115_0065577_779_1489 236
377 3300050513 nmdc:mga0rr50_6304_c1 nmdc:mga0rr50_6304_c1_3263_3979 236
378 3300050514 nmdc:mga08x19_2888_c1 nmdc:mga08x19_2888_c1_5178_5894 236
379 2162886012 MBSR1b_contig_1528414 MBSR1b_0500.00002250 237
380 2162886012 MBSR1b_contig_1782974 MBSR1b_0977.00005380 237
381 3300005329 Ga0070683_100012083 Ga0070683_1000120832 237
382 3300005330 Ga0070690_100012194 Ga0070690_1000121943 237
383 3300005331 Ga0070670_100003670 Ga0070670_1000036709 237
384 3300005331 Ga0070670_100144680 Ga0070670_1001446802 237
385 3300005333 Ga0070677_10006410 Ga0070677_100064103 237
386 3300005334 Ga0068869_100032444 Ga0068869_1000324442 237
387 3300005335 Ga0070666_10131503 Ga0070666_101315032 237
388 3300005338 Ga0068868_100019511 Ga0068868_1000195112 237
389 3300005339 Ga0070660_100015331 Ga0070660_1000153315 237
390 3300005340 Ga0070689_100088201 Ga0070689_1000882014 237
391 3300005340 Ga0070689_100134408 Ga0070689_1001344082 237
392 3300005344 Ga0070661_100090559 Ga0070661_1000905592 237
393 3300005347 Ga0070668_100127627 Ga0070668_1001276272 237
394 3300005353 Ga0070669_100317792 Ga0070669_1003177922 237
395 3300005354 Ga0070675_100079695 Ga0070675_1000796953 237
396 3300005355 Ga0070671_100164765 Ga0070671_1001647652 237
397 3300005356 Ga0070674_100052947 Ga0070674_1000529474 237
398 3300005364 Ga0070673_100018739 Ga0070673_1000187393 237
399 3300005364 Ga0070673_100137793 Ga0070673_1001377932 237
400 3300005366 Ga0070659_100002666 Ga0070659_1000026667 237
401 3300005367 Ga0070667_100119940 Ga0070667_1001199403 237
402 3300005367 Ga0070667_100699570 Ga0070667_1006995701 237
403 3300005440 Ga0070705_100200943 Ga0070705_1002009431 237
404 3300005455 Ga0070663_100018203 Ga0070663_1000182036 237
405 3300005456 Ga0070678_100263519 Ga0070678_1002635191 237
406 3300005458 Ga0070681_10001100 Ga0070681_1000110020 237
407 3300005459 Ga0068867_100073676 Ga0068867_1000736762 237
408 3300005459 Ga0068867_100360599 Ga0068867_1003605992 237
409 3300005466 Ga0070685_10093924 Ga0070685_100939241 237
410 3300005535 Ga0070684_100009298 Ga0070684_1000092987 237
411 3300005539 Ga0068853_100006343 Ga0068853_1000063435 237
412 3300005539 Ga0068853_100132907 Ga0068853_1001329071 237
413 3300005543 Ga0070672_100087257 Ga0070672_1000872574 237
414 3300005544 Ga0070686_100087276 Ga0070686_1000872762 237
415 3300005563 Ga0068855_100003643 Ga0068855_10000364320 237
416 3300005564 Ga0070664_100000538 Ga0070664_10000053813 237
417 3300005564 Ga0070664_100022774 Ga0070664_1000227744 237
418 3300005577 Ga0068857_100000081 Ga0068857_1000000814 237
419 3300005577 Ga0068857_100021579 Ga0068857_1000215796 237
420 3300005578 Ga0068854_100094421 Ga0068854_1000944212 237
421 3300005614 Ga0068856_100000394 Ga0068856_10000039418 237
422 3300005614 Ga0068856_100027370 Ga0068856_1000273705 237
423 3300005615 Ga0070702_100036892 Ga0070702_1000368922 237
424 3300005616 Ga0068852_100306019 Ga0068852_1003060192 237
425 3300005616 Ga0068852_100909533 Ga0068852_1009095331 237
426 3300005617 Ga0068859_100000290 Ga0068859_10000029043 237
427 3300005618 Ga0068864_100001275 Ga0068864_10000127512 237
428 3300005618 Ga0068864_100089470 Ga0068864_1000894702 237
429 3300005718 Ga0068866_10205089 Ga0068866_102050892 237
430 3300005719 Ga0068861_100277429 Ga0068861_1002774292 237
431 3300005834 Ga0068851_10026488 Ga0068851_100264882 237
432 3300005841 Ga0068863_100134013 Ga0068863_1001340132 237
433 3300005842 Ga0068858_100001619 Ga0068858_10000161926 237
434 3300005842 Ga0068858_100002791 Ga0068858_10000279119 237
435 3300005842 Ga0068858_100126941 Ga0068858_1001269412 237
436 3300005843 Ga0068860_100005894 Ga0068860_1000058942 237
437 3300005843 Ga0068860_100065442 Ga0068860_1000654422 237
438 3300005843 Ga0068860_100160110 Ga0068860_1001601102 237
439 3300005844 Ga0068862_100036273 Ga0068862_1000362735 237
440 3300006028 Ga0070717_10004359 Ga0070717_100043594 237
441 3300006163 Ga0070715_10063341 Ga0070715_100633412 237
442 3300006237 Ga0097621_100004265 Ga0097621_1000042657 237
443 3300006237 Ga0097621_100159158 Ga0097621_1001591582 237
444 3300006358 Ga0068871_100007456 Ga0068871_1000074562 237
445 3300006358 Ga0068871_100185995 Ga0068871_1001859954 237
446 3300006881 Ga0068865_100008484 Ga0068865_1000084848 237
447 3300006881 Ga0068865_100186635 Ga0068865_1001866351 237
448 3300006931 Ga0097620_100000290 Ga0097620_10000029043 237
449 3300009092 Ga0105250_10028996 Ga0105250_100289963 237
450 3300009098 Ga0105245_10008495 Ga0105245_100084952 237
451 3300009098 Ga0105245_10065607 Ga0105245_100656072 237
452 3300009174 Ga0105241_10117430 Ga0105241_101174302 237
453 3300009174 Ga0105241_10227097 Ga0105241_102270972 237
454 3300009177 Ga0105248_10258562 Ga0105248_102585622 237
455 3300009177 Ga0105248_10382344 Ga0105248_103823442 237
456 3300009545 Ga0105237_10063189 Ga0105237_100631892 237
457 3300009545 Ga0105237_10681760 Ga0105237_106817601 237
458 3300009553 Ga0105249_10107413 Ga0105249_101074133 237
459 3300010375 Ga0105239_10014364 Ga0105239_100143644 237
460 3300010375 Ga0105239_10150419 Ga0105239_101504192 237
461 3300011119 Ga0105246_10011181 Ga0105246_100111815 237
462 3300011119 Ga0105246_10087410 Ga0105246_100874102 237
463 3300013100 Ga0157373_10548369 Ga0157373_105483691 237
464 3300013102 Ga0157371_10098202 Ga0157371_100982022 237
465 3300013296 Ga0157374_10001435 Ga0157374_100014352 237
466 3300013296 Ga0157374_10012766 Ga0157374_100127662 237
467 3300013297 Ga0157378_10000541 Ga0157378_1000054120 237
468 3300013306 Ga0163162_10004210 Ga0163162_100042102 237
469 3300013307 Ga0157372_10001168 Ga0157372_1000116817 237
470 3300013307 Ga0157372_10043120 Ga0157372_100431205 237
471 3300013307 Ga0157372_10781105 Ga0157372_107811051 237
472 3300013308 Ga0157375_10078465 Ga0157375_100784651 237
473 3300013308 Ga0157375_10084316 Ga0157375_100843162 237
474 3300014325 Ga0163163_10027698 Ga0163163_100276981 237
475 3300014325 Ga0163163_10210862 Ga0163163_102108621 237
476 3300014326 Ga0157380_10027507 Ga0157380_100275076 237
477 3300014745 Ga0157377_10001555 Ga0157377_100015552 237
478 3300014745 Ga0157377_10120179 Ga0157377_101201792 237
479 3300014968 Ga0157379_10057448 Ga0157379_100574482 237
480 3300014969 Ga0157376_10026684 Ga0157376_100266843 237
481 3300017792 Ga0163161_10008769 Ga0163161_100087697 237
482 3300025315 Ga0207697_10016188 Ga0207697_100161882 237
483 3300025321 Ga0207656_10014138 Ga0207656_100141382 237
484 3300025899 Ga0207642_10114315 Ga0207642_101143151 237
485 3300025899 Ga0207642_10148907 Ga0207642_101489072 237
486 3300025901 Ga0207688_10007283 Ga0207688_100072834 237
487 3300025904 Ga0207647_10002874 Ga0207647_100028746 237
488 3300025904 Ga0207647_10008899 Ga0207647_100088995 237
489 3300025904 Ga0207647_10032472 Ga0207647_100324722 237
490 3300025907 Ga0207645_10007489 Ga0207645_100074897 237
491 3300025908 Ga0207643_10000639 Ga0207643_1000063918 237
492 3300025911 Ga0207654_10123476 Ga0207654_101234762 237
493 3300025912 Ga0207707_10033457 Ga0207707_100334571 237
494 3300025919 Ga0207657_10001261 Ga0207657_1000126120 237
495 3300025920 Ga0207649_10001661 Ga0207649_100016615 237
496 3300025920 Ga0207649_10488438 Ga0207649_104884382 237
497 3300025925 Ga0207650_10000177 Ga0207650_100001778 237
498 3300025925 Ga0207650_10017093 Ga0207650_100170931 237
499 3300025926 Ga0207659_10361037 Ga0207659_103610372 237
500 3300025927 Ga0207687_10064410 Ga0207687_100644102 237
501 3300025927 Ga0207687_10067507 Ga0207687_100675072 237
502 3300025931 Ga0207644_10149614 Ga0207644_101496142 237
503 3300025931 Ga0207644_10202574 Ga0207644_102025741 237
504 3300025933 Ga0207706_10019421 Ga0207706_100194213 237
505 3300025936 Ga0207670_10060919 Ga0207670_100609192 237
506 3300025938 Ga0207704_10003491 Ga0207704_100034917 237
507 3300025938 Ga0207704_10019678 Ga0207704_100196782 237
508 3300025940 Ga0207691_10001447 Ga0207691_100014476 237
509 3300025941 Ga0207711_10183843 Ga0207711_101838431 237
510 3300025942 Ga0207689_10000542 Ga0207689_1000054232 237
511 3300025942 Ga0207689_10002307 Ga0207689_100023077 237
512 3300025944 Ga0207661_10016213 Ga0207661_100162138 237
513 3300025944 Ga0207661_10065537 Ga0207661_100655372 237
514 3300025945 Ga0207679_10000143 Ga0207679_1000014341 237
515 3300025945 Ga0207679_10021292 Ga0207679_100212922 237
516 3300025949 Ga0207667_10008691 Ga0207667_100086912 237
517 3300025949 Ga0207667_10172327 Ga0207667_101723271 237
518 3300025960 Ga0207651_10030416 Ga0207651_100304163 237
519 3300025960 Ga0207651_10084353 Ga0207651_100843531 237
520 3300025960 Ga0207651_10551283 Ga0207651_105512831 237
521 3300025981 Ga0207640_10078549 Ga0207640_100785492 237
522 3300025986 Ga0207658_10632976 Ga0207658_106329761 237
523 3300026023 Ga0207677_10000998 Ga0207677_1000099812 237
524 3300026023 Ga0207677_10628603 Ga0207677_106286032 237
525 3300026035 Ga0207703_10006117 Ga0207703_100061178 237
526 3300026035 Ga0207703_10010977 Ga0207703_100109775 237
527 3300026035 Ga0207703_10083353 Ga0207703_100833531 237
528 3300026067 Ga0207678_10001668 Ga0207678_1000166821 237
529 3300026078 Ga0207702_10003272 Ga0207702_1000327211 237
530 3300026088 Ga0207641_10003028 Ga0207641_100030289 237
531 3300026088 Ga0207641_10307463 Ga0207641_103074632 237
532 3300026089 Ga0207648_10008810 Ga0207648_100088104 237
533 3300026089 Ga0207648_10019097 Ga0207648_100190972 237
534 3300026095 Ga0207676_10001159 Ga0207676_1000115910 237
535 3300026095 Ga0207676_10002377 Ga0207676_1000237711 237
536 3300026116 Ga0207674_10000195 Ga0207674_100001958 237
537 3300026116 Ga0207674_10000229 Ga0207674_1000022919 237
538 3300026118 Ga0207675_100399215 Ga0207675_1003992152 237
539 3300026121 Ga0207683_10003688 Ga0207683_100036882 237
540 3300026142 Ga0207698_10271381 Ga0207698_102713812 237
541 3300028381 Ga0268264_10080074 Ga0268264_100800742 237
542 3300028381 Ga0268264_10192689 Ga0268264_101926892 237
543 3300028381 Ga0268264_10346169 Ga0268264_103461692 237
544 3300035691 Ga0373931_0025417 Ga0373931_0025417_1839_2552 237
545 3300048903 Ga0496100_0359218 Ga0496100_0359218_308_1021 237
546 3300048904 Ga0496101_0209200 Ga0496101_0209200_64_777 237
547 3300048905 Ga0496102_0485209 Ga0496102_0485209_236_949 237
548 3300048911 Ga0496108_0000689 Ga0496108_0000689_5056_5769 237
549 3300048912 Ga0496109_0001300 Ga0496109_0001300_5244_5957 237
550 3300048913 Ga0496110_0008161 Ga0496110_0008161_5463_6176 237
551 3300048914 Ga0496111_0197289 Ga0496111_0197289_692_1405 237
552 3300048915 Ga0496112_0006571 Ga0496112_0006571_3093_3806 237
553 3300048915 Ga0496112_0042724 Ga0496112_0042724_3418_4131 237
554 3300048915 Ga0496112_0083914 Ga0496112_0083914_389_1102 237
555 3300048916 Ga0496113_0004283 Ga0496113_0004283_2741_3454 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

10

240

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r79-assembly3.cif.gz_B crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9482 2 231
5nm8-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942, with plp bound 0.939 2 229
6kzw-assembly2.cif.gz_B crystal structure of yggs family pyridoxal phosphate-dependent enzyme pipy from fusobacterium nucleatum 0.9364 1 228
5nm8-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942, with plp bound 0.9347 2 229
7uat-assembly1.cif.gz_A the crystal structure of the k36a mutant of e. coli yggs in complex with plp 0.9345 2 230
ID Description Score Start End Superfamily
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.939 2 229 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9347 2 229 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9339 2 230 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.93 2 230 3.20.20.10
3r79B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9227 2 231 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A2V9ZR95-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9911 1 229 GO:0030170
AF-A0A2V9T6E7-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9883 42 231 GO:0030170
AF-A0A2V9ZR95-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9869 1 229 GO:0030170
AF-A0A2V9YRX8-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.9833 106 231 GO:0030170
AF-A0A7C5MDQ5-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9778 3 232 GO:0030170

Feature Viewer

pLDDT pTM Quality
94.26 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map