F463086
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 555 | 244 | 555 | 237 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100765441|Ga0068855_1007654412 |
| Length | 242 |
| Sequence | MISPMGIAENIAAIRQRIDAAASRVRRDPSEIALMAVCKTKPAEEIRAAYEAGQRLFGENRVQEFHEKSGALTDLLSGDDAAEFHLIGHLQSNKTNRAAEIFHAVDSVDSLAVLERLHTAALRLNKHLPILIEINIGGEDQKAGLAPDSDELEQILQAAPRLLAIGISGLMTVPPFTDDPEGARPYFRRLRELRDHIAARNLPGVSMEELSIGMSHDFEVAIEEGSTCVRVGTAIFGARNYT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 174 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 175 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.74 |
| Metatranscriptomes | 1.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.05 |
| Rhizosphere | 94.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_1528414 | 2162886012 | Bacteria | 1064 |
| 2 | MBSR1b_contig_1782974 | 2162886012 | Bacteria | 1064 |
| 3 | Ga0070683_100012083 | 3300005329 | Bacteria | 7491 |
| 4 | Ga0070683_100183174 | 3300005329 | Bacteria | 1988 |
| 5 | Ga0070683_100184167 | 3300005329 | Bacteria | 1982 |
| 6 | Ga0070690_100012194 | 3300005330 | Bacteria | 5052 |
| 7 | Ga0070670_100003670 | 3300005331 | Bacteria | 12793 |
| 8 | Ga0070670_100048417 | 3300005331 | Bacteria | 3658 |
| 9 | Ga0070670_100144680 | 3300005331 | Unclassified | 2056 |
| 10 | Ga0070677_10006410 | 3300005333 | Unclassified | 3909 |
| 11 | Ga0068869_100032444 | 3300005334 | Bacteria | 3680 |
| 12 | Ga0070666_10131503 | 3300005335 | Unclassified | 1739 |
| 13 | Ga0070682_100023124 | 3300005337 | Unclassified | 3689 |
| 14 | Ga0068868_100012287 | 3300005338 | Bacteria | 6257 |
| 15 | Ga0068868_100012948 | 3300005338 | Bacteria | 6102 |
| 16 | Ga0068868_100019511 | 3300005338 | Bacteria | 5080 |
| 17 | Ga0070660_100015331 | 3300005339 | Bacteria | 5531 |
| 18 | Ga0070689_100026875 | 3300005340 | Unclassified | 4336 |
| 19 | Ga0070689_100088201 | 3300005340 | Unclassified | 2441 |
| 20 | Ga0070689_100134408 | 3300005340 | Bacteria | 1985 |
| 21 | Ga0070661_100090559 | 3300005344 | Unclassified | 2265 |
| 22 | Ga0070668_100056334 | 3300005347 | Unclassified | 3036 |
| 23 | Ga0070668_100127627 | 3300005347 | Unclassified | 2038 |
| 24 | Ga0070669_100031734 | 3300005353 | Bacteria | 3816 |
| 25 | Ga0070669_100317792 | 3300005353 | Bacteria | 1256 |
| 26 | Ga0070675_100079695 | 3300005354 | Bacteria | 2729 |
| 27 | Ga0070671_100164765 | 3300005355 | Bacteria | 1874 |
| 28 | Ga0070674_100052947 | 3300005356 | Unclassified | 2801 |
| 29 | Ga0070673_100018739 | 3300005364 | Unclassified | 4955 |
| 30 | Ga0070673_100137793 | 3300005364 | Bacteria | 2056 |
| 31 | Ga0070659_100002666 | 3300005366 | Bacteria | 12691 |
| 32 | Ga0070667_100119940 | 3300005367 | Unclassified | 2287 |
| 33 | Ga0070667_100699570 | 3300005367 | Unclassified | 938 |
| 34 | Ga0070709_10065582 | 3300005434 | Bacteria | 2326 |
| 35 | Ga0070714_100091694 | 3300005435 | Bacteria | 2662 |
| 36 | Ga0070714_100173064 | 3300005435 | Bacteria | 1960 |
| 37 | Ga0070714_100266166 | 3300005435 | Bacteria | 1588 |
| 38 | Ga0070714_100339711 | 3300005435 | Unclassified | 1408 |
| 39 | Ga0070713_100054518 | 3300005436 | Unclassified | 3318 |
| 40 | Ga0070713_100058739 | 3300005436 | Bacteria | 3209 |
| 41 | Ga0070713_100113612 | 3300005436 | Bacteria | 2364 |
| 42 | Ga0070713_100279556 | 3300005436 | Bacteria | 1531 |
| 43 | Ga0070710_10011795 | 3300005437 | Bacteria | 4328 |
| 44 | Ga0070710_10020546 | 3300005437 | Bacteria | 3428 |
| 45 | Ga0070711_100012311 | 3300005439 | Bacteria | 5337 |
| 46 | Ga0070711_100012589 | 3300005439 | Bacteria | 5290 |
| 47 | Ga0070711_100038547 | 3300005439 | Bacteria | 3214 |
| 48 | Ga0070711_100078540 | 3300005439 | Unclassified | 2345 |
| 49 | Ga0070711_100345000 | 3300005439 | Bacteria | 1196 |
| 50 | Ga0070705_100200943 | 3300005440 | Bacteria | 1366 |
| 51 | Ga0070708_101001314 | 3300005445 | Unclassified | 784 |
| 52 | Ga0070663_100018203 | 3300005455 | Unclassified | 4599 |
| 53 | Ga0070678_100033339 | 3300005456 | Bacteria | 3575 |
| 54 | Ga0070678_100263519 | 3300005456 | Unclassified | 1450 |
| 55 | Ga0070662_100005317 | 3300005457 | Bacteria | 8223 |
| 56 | Ga0070681_10001100 | 3300005458 | Bacteria | 23120 |
| 57 | Ga0070681_10003480 | 3300005458 | Bacteria | 14751 |
| 58 | Ga0070681_10303423 | 3300005458 | Bacteria | 1506 |
| 59 | Ga0068867_100073676 | 3300005459 | Bacteria | 2557 |
| 60 | Ga0068867_100360599 | 3300005459 | Unclassified | 1216 |
| 61 | Ga0070685_10093924 | 3300005466 | Unclassified | 1820 |
| 62 | Ga0070706_100000278 | 3300005467 | Bacteria | 62365 |
| 63 | Ga0070707_100022230 | 3300005468 | Bacteria | 5996 |
| 64 | Ga0070707_100076687 | 3300005468 | Unclassified | 3224 |
| 65 | Ga0070707_100216107 | 3300005468 | Bacteria | 1868 |
| 66 | Ga0070698_100051792 | 3300005471 | Unclassified | 4179 |
| 67 | Ga0070698_100110325 | 3300005471 | Bacteria | 2716 |
| 68 | Ga0070699_100002709 | 3300005518 | Bacteria | 15794 |
| 69 | Ga0070699_100020254 | 3300005518 | Bacteria | 5735 |
| 70 | Ga0070679_100063805 | 3300005530 | Bacteria | 3672 |
| 71 | Ga0070679_100091382 | 3300005530 | Bacteria | 3032 |
| 72 | Ga0070684_100009298 | 3300005535 | Bacteria | 7736 |
| 73 | Ga0070684_100057935 | 3300005535 | Bacteria | 3383 |
| 74 | Ga0070684_100243220 | 3300005535 | Bacteria | 1644 |
| 75 | Ga0070697_100000049 | 3300005536 | Bacteria | 90362 |
| 76 | Ga0070697_100000158 | 3300005536 | Bacteria | 55228 |
| 77 | Ga0070697_100005879 | 3300005536 | Bacteria | 9469 |
| 78 | Ga0068853_100006343 | 3300005539 | Bacteria | 9387 |
| 79 | Ga0068853_100024017 | 3300005539 | Bacteria | 5109 |
| 80 | Ga0068853_100041531 | 3300005539 | Bacteria | 3930 |
| 81 | Ga0068853_100132907 | 3300005539 | Bacteria | 2229 |
| 82 | Ga0070672_100087257 | 3300005543 | Unclassified | 2510 |
| 83 | Ga0070686_100087276 | 3300005544 | Unclassified | 2079 |
| 84 | Ga0070695_100048381 | 3300005545 | Bacteria | 2719 |
| 85 | Ga0070696_100008369 | 3300005546 | Bacteria | 6920 |
| 86 | Ga0070704_100150447 | 3300005549 | Bacteria | 1829 |
| 87 | Ga0068855_100003643 | 3300005563 | Bacteria | 18833 |
| 88 | Ga0068855_100063779 | 3300005563 | Bacteria | 4299 |
| 89 | Ga0068855_100137310 | 3300005563 | Unclassified | 2789 |
| 90 | Ga0068855_100765441 | 3300005563 | Unclassified | 1028 |
| 91 | Ga0070664_100000538 | 3300005564 | Bacteria | 28884 |
| 92 | Ga0070664_100022774 | 3300005564 | Bacteria | 5168 |
| 93 | Ga0068857_100000081 | 3300005577 | Bacteria | 55561 |
| 94 | Ga0068857_100021579 | 3300005577 | Bacteria | 5666 |
| 95 | Ga0068857_100029113 | 3300005577 | Bacteria | 4873 |
| 96 | Ga0068857_100031365 | 3300005577 | Bacteria | 4696 |
| 97 | Ga0068854_100004626 | 3300005578 | Bacteria | 8679 |
| 98 | Ga0068854_100094421 | 3300005578 | Bacteria | 2231 |
| 99 | Ga0068854_100854600 | 3300005578 | Unclassified | 797 |
| 100 | Ga0068856_100000394 | 3300005614 | Bacteria | 47803 |
| 101 | Ga0068856_100001986 | 3300005614 | Bacteria | 21328 |
| 102 | Ga0068856_100008311 | 3300005614 | Bacteria | 10113 |
| 103 | Ga0068856_100020557 | 3300005614 | Bacteria | 6412 |
| 104 | Ga0068856_100027370 | 3300005614 | Bacteria | 5562 |
| 105 | Ga0070702_100036892 | 3300005615 | Unclassified | 2712 |
| 106 | Ga0068852_100093344 | 3300005616 | Unclassified | 2697 |
| 107 | Ga0068852_100161338 | 3300005616 | Unclassified | 2093 |
| 108 | Ga0068852_100306019 | 3300005616 | Unclassified | 1540 |
| 109 | Ga0068852_100621350 | 3300005616 | Unclassified | 1086 |
| 110 | Ga0068852_100909533 | 3300005616 | Unclassified | 897 |
| 111 | Ga0068859_100000290 | 3300005617 | Bacteria | 49956 |
| 112 | Ga0068864_100001275 | 3300005618 | Bacteria | 20944 |
| 113 | Ga0068864_100018702 | 3300005618 | Bacteria | 5790 |
| 114 | Ga0068864_100089470 | 3300005618 | Unclassified | 2712 |
| 115 | Ga0068866_10205089 | 3300005718 | Bacteria | 1180 |
| 116 | Ga0068861_100277429 | 3300005719 | Unclassified | 1442 |
| 117 | Ga0068851_10026488 | 3300005834 | Unclassified | 2849 |
| 118 | Ga0068851_10107976 | 3300005834 | Bacteria | 1483 |
| 119 | Ga0068851_10423839 | 3300005834 | Unclassified | 786 |
| 120 | Ga0068863_100008272 | 3300005841 | Bacteria | 10164 |
| 121 | Ga0068863_100134013 | 3300005841 | Bacteria | 2366 |
| 122 | Ga0068858_100001619 | 3300005842 | Bacteria | 22968 |
| 123 | Ga0068858_100002791 | 3300005842 | Bacteria | 17553 |
| 124 | Ga0068858_100077679 | 3300005842 | Unclassified | 3084 |
| 125 | Ga0068858_100126941 | 3300005842 | Unclassified | 2389 |
| 126 | Ga0068858_100237633 | 3300005842 | Bacteria | 1728 |
| 127 | Ga0068860_100005894 | 3300005843 | Bacteria | 12335 |
| 128 | Ga0068860_100011500 | 3300005843 | Bacteria | 8721 |
| 129 | Ga0068860_100065442 | 3300005843 | Unclassified | 3452 |
| 130 | Ga0068860_100160110 | 3300005843 | Bacteria | 2170 |
| 131 | Ga0068862_100036273 | 3300005844 | Unclassified | 4179 |
| 132 | Ga0081540_1110156 | 3300005983 | Bacteria | 1166 |
| 133 | Ga0081540_1147245 | 3300005983 | Unclassified | 935 |
| 134 | Ga0070717_10004359 | 3300006028 | Bacteria | 10210 |
| 135 | Ga0070717_10020604 | 3300006028 | Bacteria | 5189 |
| 136 | Ga0070717_10226286 | 3300006028 | Bacteria | 1646 |
| 137 | Ga0070717_10236080 | 3300006028 | Bacteria | 1611 |
| 138 | Ga0070715_10050443 | 3300006163 | Bacteria | 1787 |
| 139 | Ga0070715_10063341 | 3300006163 | Unclassified | 1630 |
| 140 | Ga0070715_10122083 | 3300006163 | Bacteria | 1243 |
| 141 | Ga0070716_100003540 | 3300006173 | Bacteria | 7367 |
| 142 | Ga0070716_100080483 | 3300006173 | Bacteria | 1942 |
| 143 | Ga0070712_100002390 | 3300006175 | Bacteria | 11557 |
| 144 | Ga0070712_100012269 | 3300006175 | Bacteria | 5447 |
| 145 | Ga0070712_100059128 | 3300006175 | Bacteria | 2698 |
| 146 | Ga0070712_100552249 | 3300006175 | Bacteria | 970 |
| 147 | Ga0070712_100890687 | 3300006175 | Bacteria | 767 |
| 148 | Ga0097621_100002603 | 3300006237 | Bacteria | 12369 |
| 149 | Ga0097621_100004265 | 3300006237 | Bacteria | 9933 |
| 150 | Ga0097621_100159158 | 3300006237 | Unclassified | 1940 |
| 151 | Ga0068871_100001192 | 3300006358 | Bacteria | 17360 |
| 152 | Ga0068871_100007456 | 3300006358 | Bacteria | 7820 |
| 153 | Ga0068871_100018971 | 3300006358 | Bacteria | 5242 |
| 154 | Ga0068871_100185995 | 3300006358 | Unclassified | 1787 |
| 155 | Ga0075433_10001098 | 3300006852 | Bacteria | 19537 |
| 156 | Ga0075434_100000195 | 3300006871 | Bacteria | 40479 |
| 157 | Ga0068865_100008484 | 3300006881 | Bacteria | 6353 |
| 158 | Ga0068865_100186635 | 3300006881 | Bacteria | 1600 |
| 159 | Ga0075436_100004841 | 3300006914 | Bacteria | 9252 |
| 160 | Ga0075436_100042255 | 3300006914 | Bacteria | 3144 |
| 161 | Ga0075436_100275532 | 3300006914 | Bacteria | 1202 |
| 162 | Ga0075436_100561083 | 3300006914 | Unclassified | 839 |
| 163 | Ga0097620_100000290 | 3300006931 | Bacteria | 49956 |
| 164 | Ga0075435_100000065 | 3300007076 | Bacteria | 54666 |
| 165 | Ga0105250_10028996 | 3300009092 | Unclassified | 2227 |
| 166 | Ga0105240_10017855 | 3300009093 | Bacteria | 9546 |
| 167 | Ga0105240_10029292 | 3300009093 | Bacteria | 7176 |
| 168 | Ga0105240_10065441 | 3300009093 | Bacteria | 4512 |
| 169 | Ga0105240_10078716 | 3300009093 | Bacteria | 4058 |
| 170 | Ga0105240_10504761 | 3300009093 | Unclassified | 1344 |
| 171 | Ga0105240_10624398 | 3300009093 | Unclassified | 1184 |
| 172 | Ga0105245_10002858 | 3300009098 | Bacteria | 15509 |
| 173 | Ga0105245_10008495 | 3300009098 | Bacteria | 8958 |
| 174 | Ga0105245_10054629 | 3300009098 | Unclassified | 3587 |
| 175 | Ga0105245_10065607 | 3300009098 | Unclassified | 3283 |
| 176 | Ga0105245_10324423 | 3300009098 | Bacteria | 1518 |
| 177 | Ga0105245_10550211 | 3300009098 | Bacteria | 1176 |
| 178 | Ga0105247_10006341 | 3300009101 | Bacteria | 7329 |
| 179 | Ga0105241_10023905 | 3300009174 | Bacteria | 4535 |
| 180 | Ga0105241_10044572 | 3300009174 | Bacteria | 3361 |
| 181 | Ga0105241_10087172 | 3300009174 | Bacteria | 2456 |
| 182 | Ga0105241_10117430 | 3300009174 | Bacteria | 2138 |
| 183 | Ga0105241_10153074 | 3300009174 | Unclassified | 1888 |
| 184 | Ga0105241_10165548 | 3300009174 | Unclassified | 1822 |
| 185 | Ga0105241_10184527 | 3300009174 | Bacteria | 1733 |
| 186 | Ga0105241_10227097 | 3300009174 | Unclassified | 1572 |
| 187 | Ga0105241_10330440 | 3300009174 | Unclassified | 1317 |
| 188 | Ga0105242_10009165 | 3300009176 | Bacteria | 7598 |
| 189 | Ga0105242_10499047 | 3300009176 | Bacteria | 1157 |
| 190 | Ga0105248_10021967 | 3300009177 | Bacteria | 7071 |
| 191 | Ga0105248_10258562 | 3300009177 | Unclassified | 1960 |
| 192 | Ga0105248_10382344 | 3300009177 | Unclassified | 1585 |
| 193 | Ga0105237_10063189 | 3300009545 | Bacteria | 3700 |
| 194 | Ga0105237_10183979 | 3300009545 | Bacteria | 2089 |
| 195 | Ga0105237_10236827 | 3300009545 | Bacteria | 1827 |
| 196 | Ga0105237_10403751 | 3300009545 | Unclassified | 1371 |
| 197 | Ga0105237_10501110 | 3300009545 | Bacteria | 1221 |
| 198 | Ga0105237_10681760 | 3300009545 | Bacteria | 1034 |
| 199 | Ga0105238_10000417 | 3300009551 | Bacteria | 44911 |
| 200 | Ga0105238_10014582 | 3300009551 | Bacteria | 7945 |
| 201 | Ga0105238_10227665 | 3300009551 | Unclassified | 1841 |
| 202 | Ga0105238_10317607 | 3300009551 | Bacteria | 1543 |
| 203 | Ga0105238_10346525 | 3300009551 | Unclassified | 1474 |
| 204 | Ga0105249_10024924 | 3300009553 | Bacteria | 5382 |
| 205 | Ga0105249_10107413 | 3300009553 | Unclassified | 2634 |
| 206 | Ga0099796_10063845 | 3300010159 | Bacteria | 1312 |
| 207 | Ga0105239_10014364 | 3300010375 | Bacteria | 8786 |
| 208 | Ga0105239_10114979 | 3300010375 | Bacteria | 2985 |
| 209 | Ga0105239_10150419 | 3300010375 | Unclassified | 2598 |
| 210 | Ga0105239_10221559 | 3300010375 | Bacteria | 2121 |
| 211 | Ga0105239_10384835 | 3300010375 | Unclassified | 1586 |
| 212 | Ga0105246_10007122 | 3300011119 | Bacteria | 6846 |
| 213 | Ga0105246_10011181 | 3300011119 | Bacteria | 5564 |
| 214 | Ga0105246_10087410 | 3300011119 | Bacteria | 2237 |
| 215 | Ga0157373_10180002 | 3300013100 | Unclassified | 1488 |
| 216 | Ga0157373_10244058 | 3300013100 | Bacteria | 1270 |
| 217 | Ga0157373_10360623 | 3300013100 | Unclassified | 1038 |
| 218 | Ga0157373_10548369 | 3300013100 | Unclassified | 838 |
| 219 | Ga0157371_10098202 | 3300013102 | Unclassified | 2076 |
| 220 | Ga0157371_10528214 | 3300013102 | Unclassified | 873 |
| 221 | Ga0157370_10166681 | 3300013104 | Unclassified | 2049 |
| 222 | Ga0157370_10516345 | 3300013104 | Unclassified | 1097 |
| 223 | Ga0157369_10000258 | 3300013105 | Bacteria | 72711 |
| 224 | Ga0157369_10499701 | 3300013105 | Bacteria | 1258 |
| 225 | Ga0157374_10001052 | 3300013296 | Bacteria | 23995 |
| 226 | Ga0157374_10001435 | 3300013296 | Bacteria | 20148 |
| 227 | Ga0157374_10005580 | 3300013296 | Bacteria | 10593 |
| 228 | Ga0157374_10012766 | 3300013296 | Bacteria | 7319 |
| 229 | Ga0157374_10048161 | 3300013296 | Bacteria | 3955 |
| 230 | Ga0157374_10109111 | 3300013296 | Bacteria | 2660 |
| 231 | Ga0157378_10000541 | 3300013297 | Bacteria | 35976 |
| 232 | Ga0157378_10002142 | 3300013297 | Bacteria | 17530 |
| 233 | Ga0157378_10024706 | 3300013297 | Bacteria | 5290 |
| 234 | Ga0157378_10206842 | 3300013297 | Bacteria | 1859 |
| 235 | Ga0163162_10002555 | 3300013306 | Bacteria | 17229 |
| 236 | Ga0163162_10004210 | 3300013306 | Bacteria | 13826 |
| 237 | Ga0157372_10000335 | 3300013307 | Bacteria | 51775 |
| 238 | Ga0157372_10001168 | 3300013307 | Bacteria | 28395 |
| 239 | Ga0157372_10004868 | 3300013307 | Bacteria | 14272 |
| 240 | Ga0157372_10010989 | 3300013307 | Bacteria | 9635 |
| 241 | Ga0157372_10043120 | 3300013307 | Unclassified | 4993 |
| 242 | Ga0157372_10144870 | 3300013307 | Bacteria | 2739 |
| 243 | Ga0157372_10220384 | 3300013307 | Unclassified | 2199 |
| 244 | Ga0157372_10781105 | 3300013307 | Unclassified | 1110 |
| 245 | Ga0157372_10802984 | 3300013307 | Bacteria | 1093 |
| 246 | Ga0157375_10078465 | 3300013308 | Bacteria | 3335 |
| 247 | Ga0157375_10084316 | 3300013308 | Unclassified | 3226 |
| 248 | Ga0157375_11569969 | 3300013308 | Bacteria | 778 |
| 249 | Ga0163163_10004099 | 3300014325 | Bacteria | 12433 |
| 250 | Ga0163163_10027698 | 3300014325 | Bacteria | 5432 |
| 251 | Ga0163163_10028700 | 3300014325 | Bacteria | 5347 |
| 252 | Ga0163163_10030507 | 3300014325 | Bacteria | 5195 |
| 253 | Ga0163163_10210862 | 3300014325 | Bacteria | 1992 |
| 254 | Ga0157380_10027507 | 3300014326 | Unclassified | 4325 |
| 255 | Ga0157377_10001555 | 3300014745 | Bacteria | 9979 |
| 256 | Ga0157377_10120179 | 3300014745 | Unclassified | 1591 |
| 257 | Ga0157379_10057448 | 3300014968 | Unclassified | 3478 |
| 258 | Ga0157379_10062392 | 3300014968 | Bacteria | 3333 |
| 259 | Ga0157376_10026684 | 3300014969 | Bacteria | 4567 |
| 260 | Ga0163161_10008769 | 3300017792 | Bacteria | 6990 |
| 261 | Ga0224570_101606 | 3300022730 | Bacteria | 1642 |
| 262 | Ga0207697_10016188 | 3300025315 | Unclassified | 3075 |
| 263 | Ga0207656_10014138 | 3300025321 | Unclassified | 3068 |
| 264 | Ga0207656_10071485 | 3300025321 | Bacteria | 1543 |
| 265 | Ga0207656_10195614 | 3300025321 | Unclassified | 975 |
| 266 | Ga0207692_10002000 | 3300025898 | Bacteria | 7789 |
| 267 | Ga0207692_10325845 | 3300025898 | Bacteria | 941 |
| 268 | Ga0207642_10114315 | 3300025899 | Unclassified | 1380 |
| 269 | Ga0207642_10148907 | 3300025899 | Bacteria | 1243 |
| 270 | Ga0207710_10065474 | 3300025900 | Bacteria | 1657 |
| 271 | Ga0207688_10007283 | 3300025901 | Bacteria | 6021 |
| 272 | Ga0207680_10019827 | 3300025903 | Unclassified | 3605 |
| 273 | Ga0207647_10002874 | 3300025904 | Bacteria | 12974 |
| 274 | Ga0207647_10008899 | 3300025904 | Bacteria | 7160 |
| 275 | Ga0207647_10032472 | 3300025904 | Unclassified | 3352 |
| 276 | Ga0207685_10057151 | 3300025905 | Bacteria | 1529 |
| 277 | Ga0207685_10061440 | 3300025905 | Bacteria | 1489 |
| 278 | Ga0207685_10100452 | 3300025905 | Unclassified | 1236 |
| 279 | Ga0207699_10041384 | 3300025906 | Unclassified | 2661 |
| 280 | Ga0207645_10007489 | 3300025907 | Bacteria | 7704 |
| 281 | Ga0207643_10000639 | 3300025908 | Bacteria | 21958 |
| 282 | Ga0207684_10001907 | 3300025910 | Bacteria | 21656 |
| 283 | Ga0207684_10232864 | 3300025910 | Bacteria | 1589 |
| 284 | Ga0207654_10032167 | 3300025911 | Unclassified | 2896 |
| 285 | Ga0207654_10098528 | 3300025911 | Unclassified | 1796 |
| 286 | Ga0207654_10113626 | 3300025911 | Unclassified | 1689 |
| 287 | Ga0207654_10123476 | 3300025911 | Bacteria | 1629 |
| 288 | Ga0207707_10033457 | 3300025912 | Bacteria | 4499 |
| 289 | Ga0207707_10034516 | 3300025912 | Bacteria | 4426 |
| 290 | Ga0207707_10049869 | 3300025912 | Bacteria | 3647 |
| 291 | Ga0207707_10150627 | 3300025912 | Unclassified | 2034 |
| 292 | Ga0207707_10217226 | 3300025912 | Bacteria | 1665 |
| 293 | Ga0207707_10222184 | 3300025912 | Unclassified | 1644 |
| 294 | Ga0207695_10022649 | 3300025913 | Bacteria | 7122 |
| 295 | Ga0207695_10206793 | 3300025913 | Bacteria | 1875 |
| 296 | Ga0207695_10440806 | 3300025913 | Bacteria | 1186 |
| 297 | Ga0207693_10000402 | 3300025915 | Bacteria | 39488 |
| 298 | Ga0207693_10008118 | 3300025915 | Bacteria | 8605 |
| 299 | Ga0207693_10051323 | 3300025915 | Bacteria | 3237 |
| 300 | Ga0207693_10051802 | 3300025915 | Bacteria | 3220 |
| 301 | Ga0207693_10159841 | 3300025915 | Bacteria | 1772 |
| 302 | Ga0207663_10003860 | 3300025916 | Bacteria | 7397 |
| 303 | Ga0207663_10004728 | 3300025916 | Bacteria | 6803 |
| 304 | Ga0207663_10347560 | 3300025916 | Bacteria | 1122 |
| 305 | Ga0207660_10019093 | 3300025917 | Bacteria | 4578 |
| 306 | Ga0207657_10001261 | 3300025919 | Bacteria | 27065 |
| 307 | Ga0207649_10001661 | 3300025920 | Bacteria | 12866 |
| 308 | Ga0207649_10488438 | 3300025920 | Unclassified | 935 |
| 309 | Ga0207652_10168593 | 3300025921 | Bacteria | 1964 |
| 310 | Ga0207646_10282658 | 3300025922 | Bacteria | 1499 |
| 311 | Ga0207646_10483205 | 3300025922 | Bacteria | 1117 |
| 312 | Ga0207694_10000284 | 3300025924 | Bacteria | 47825 |
| 313 | Ga0207694_10053209 | 3300025924 | Bacteria | 3138 |
| 314 | Ga0207694_10171950 | 3300025924 | Bacteria | 1754 |
| 315 | Ga0207650_10000177 | 3300025925 | Bacteria | 75244 |
| 316 | Ga0207650_10017093 | 3300025925 | Bacteria | 5078 |
| 317 | Ga0207659_10361037 | 3300025926 | Unclassified | 1207 |
| 318 | Ga0207687_10003150 | 3300025927 | Bacteria | 11190 |
| 319 | Ga0207687_10064410 | 3300025927 | Bacteria | 2599 |
| 320 | Ga0207687_10067507 | 3300025927 | Unclassified | 2544 |
| 321 | Ga0207700_10006979 | 3300025928 | Bacteria | 6872 |
| 322 | Ga0207700_10025629 | 3300025928 | Unclassified | 4099 |
| 323 | Ga0207700_10028535 | 3300025928 | Unclassified | 3925 |
| 324 | Ga0207700_10037677 | 3300025928 | Bacteria | 3504 |
| 325 | Ga0207700_10202489 | 3300025928 | Bacteria | 1674 |
| 326 | Ga0207700_10222605 | 3300025928 | Bacteria | 1600 |
| 327 | Ga0207700_10259523 | 3300025928 | Bacteria | 1487 |
| 328 | Ga0207700_10308062 | 3300025928 | Bacteria | 1369 |
| 329 | Ga0207664_10096008 | 3300025929 | Bacteria | 2439 |
| 330 | Ga0207664_10294738 | 3300025929 | Unclassified | 1426 |
| 331 | Ga0207644_10149614 | 3300025931 | Bacteria | 1805 |
| 332 | Ga0207644_10202574 | 3300025931 | Bacteria | 1566 |
| 333 | Ga0207706_10000941 | 3300025933 | Bacteria | 29750 |
| 334 | Ga0207706_10019421 | 3300025933 | Bacteria | 6115 |
| 335 | Ga0207686_10019667 | 3300025934 | Unclassified | 3845 |
| 336 | Ga0207686_10133952 | 3300025934 | Bacteria | 1703 |
| 337 | Ga0207670_10060919 | 3300025936 | Bacteria | 2573 |
| 338 | Ga0207704_10003491 | 3300025938 | Bacteria | 7154 |
| 339 | Ga0207704_10019678 | 3300025938 | Bacteria | 3552 |
| 340 | Ga0207665_10000358 | 3300025939 | Bacteria | 31676 |
| 341 | Ga0207665_10037700 | 3300025939 | Bacteria | 3218 |
| 342 | Ga0207665_10184325 | 3300025939 | Unclassified | 1513 |
| 343 | Ga0207665_10282537 | 3300025939 | Bacteria | 1235 |
| 344 | Ga0207691_10001447 | 3300025940 | Bacteria | 23651 |
| 345 | Ga0207711_10183843 | 3300025941 | Bacteria | 1902 |
| 346 | Ga0207689_10000542 | 3300025942 | Bacteria | 35861 |
| 347 | Ga0207689_10002307 | 3300025942 | Bacteria | 17863 |
| 348 | Ga0207661_10016213 | 3300025944 | Bacteria | 5494 |
| 349 | Ga0207661_10065537 | 3300025944 | Bacteria | 2949 |
| 350 | Ga0207661_10100415 | 3300025944 | Bacteria | 2429 |
| 351 | Ga0207679_10000143 | 3300025945 | Bacteria | 59141 |
| 352 | Ga0207679_10021292 | 3300025945 | Bacteria | 4394 |
| 353 | Ga0207667_10000487 | 3300025949 | Bacteria | 52501 |
| 354 | Ga0207667_10008691 | 3300025949 | Bacteria | 12035 |
| 355 | Ga0207667_10024560 | 3300025949 | Bacteria | 6613 |
| 356 | Ga0207667_10130156 | 3300025949 | Unclassified | 2592 |
| 357 | Ga0207667_10151125 | 3300025949 | Bacteria | 2390 |
| 358 | Ga0207667_10172327 | 3300025949 | Bacteria | 2224 |
| 359 | Ga0207667_10566164 | 3300025949 | Unclassified | 1148 |
| 360 | Ga0207667_10813166 | 3300025949 | Unclassified | 931 |
| 361 | Ga0207651_10030416 | 3300025960 | Bacteria | 3438 |
| 362 | Ga0207651_10084353 | 3300025960 | Bacteria | 2301 |
| 363 | Ga0207651_10551283 | 3300025960 | Bacteria | 1002 |
| 364 | Ga0207712_10021844 | 3300025961 | Unclassified | 4206 |
| 365 | Ga0207668_10013931 | 3300025972 | Bacteria | 4967 |
| 366 | Ga0207640_10047553 | 3300025981 | Unclassified | 2768 |
| 367 | Ga0207640_10078549 | 3300025981 | Bacteria | 2247 |
| 368 | Ga0207658_10015504 | 3300025986 | Bacteria | 5228 |
| 369 | Ga0207658_10632976 | 3300025986 | Unclassified | 963 |
| 370 | Ga0207677_10000998 | 3300026023 | Bacteria | 15626 |
| 371 | Ga0207677_10002399 | 3300026023 | Bacteria | 9824 |
| 372 | Ga0207677_10109793 | 3300026023 | Bacteria | 2052 |
| 373 | Ga0207677_10314679 | 3300026023 | Bacteria | 1299 |
| 374 | Ga0207677_10628603 | 3300026023 | Unclassified | 945 |
| 375 | Ga0207703_10006117 | 3300026035 | Bacteria | 9633 |
| 376 | Ga0207703_10010977 | 3300026035 | Bacteria | 7058 |
| 377 | Ga0207703_10017812 | 3300026035 | Bacteria | 5547 |
| 378 | Ga0207703_10083353 | 3300026035 | Bacteria | 2671 |
| 379 | Ga0207703_10176019 | 3300026035 | Bacteria | 1885 |
| 380 | Ga0207639_10012639 | 3300026041 | Bacteria | 5885 |
| 381 | Ga0207639_10518496 | 3300026041 | Bacteria | 1091 |
| 382 | Ga0207678_10001668 | 3300026067 | Bacteria | 20376 |
| 383 | Ga0207702_10000482 | 3300026078 | Bacteria | 44849 |
| 384 | Ga0207702_10003272 | 3300026078 | Bacteria | 14951 |
| 385 | Ga0207702_10028596 | 3300026078 | Unclassified | 4634 |
| 386 | Ga0207702_10039405 | 3300026078 | Unclassified | 3958 |
| 387 | Ga0207702_10077565 | 3300026078 | Bacteria | 2874 |
| 388 | Ga0207702_10275050 | 3300026078 | Bacteria | 1590 |
| 389 | Ga0207641_10003028 | 3300026088 | Bacteria | 15142 |
| 390 | Ga0207641_10209389 | 3300026088 | Unclassified | 1802 |
| 391 | Ga0207641_10307463 | 3300026088 | Bacteria | 1499 |
| 392 | Ga0207648_10008810 | 3300026089 | Bacteria | 9719 |
| 393 | Ga0207648_10019097 | 3300026089 | Bacteria | 6187 |
| 394 | Ga0207648_10363612 | 3300026089 | Bacteria | 1306 |
| 395 | Ga0207676_10001159 | 3300026095 | Bacteria | 19817 |
| 396 | Ga0207676_10002377 | 3300026095 | Bacteria | 13429 |
| 397 | Ga0207674_10000195 | 3300026116 | Bacteria | 75067 |
| 398 | Ga0207674_10000229 | 3300026116 | Bacteria | 69982 |
| 399 | Ga0207674_10009145 | 3300026116 | Bacteria | 11363 |
| 400 | Ga0207674_10014217 | 3300026116 | Bacteria | 8795 |
| 401 | Ga0207674_10034006 | 3300026116 | Bacteria | 5332 |
| 402 | Ga0207675_100399215 | 3300026118 | Unclassified | 1355 |
| 403 | Ga0207683_10003688 | 3300026121 | Bacteria | 13306 |
| 404 | Ga0207698_10027346 | 3300026142 | Bacteria | 4048 |
| 405 | Ga0207698_10062953 | 3300026142 | Bacteria | 2900 |
| 406 | Ga0207698_10158217 | 3300026142 | Unclassified | 1977 |
| 407 | Ga0207698_10271381 | 3300026142 | Unclassified | 1564 |
| 408 | Ga0268265_10056860 | 3300028380 | Bacteria | 2979 |
| 409 | Ga0268264_10080074 | 3300028381 | Bacteria | 2788 |
| 410 | Ga0268264_10102638 | 3300028381 | Bacteria | 2489 |
| 411 | Ga0268264_10192689 | 3300028381 | Unclassified | 1859 |
| 412 | Ga0268264_10346169 | 3300028381 | Unclassified | 1413 |
| 413 | Ga0265762_1000119 | 3300030760 | Bacteria | 11713 |
| 414 | Ga0265762_1057041 | 3300030760 | Bacteria | 795 |
| 415 | Ga0265765_1003676 | 3300030879 | Unclassified | 1548 |
| 416 | Ga0265760_10003665 | 3300031090 | Bacteria | 4452 |
| 417 | Ga0265760_10004688 | 3300031090 | Bacteria | 3914 |
| 418 | Ga0265760_10008406 | 3300031090 | Bacteria | 2953 |
| 419 | Ga0265760_10010644 | 3300031090 | Bacteria | 2628 |
| 420 | Ga0265328_10045711 | 3300031239 | Unclassified | 1610 |
| 421 | Ga0265325_10026032 | 3300031241 | Bacteria | 3172 |
| 422 | Ga0265340_10041679 | 3300031247 | Unclassified | 2256 |
| 423 | Ga0265339_10164856 | 3300031249 | Unclassified | 1113 |
| 424 | Ga0265314_10109198 | 3300031711 | Unclassified | 1761 |
| 425 | Ga0316214_1012801 | 3300033545 | Bacteria | 1147 |
| 426 | Ga0373926_0015941 | 3300035083 | Bacteria | 2566 |
| 427 | Ga0373934_0147038 | 3300035086 | Bacteria | 964 |
| 428 | Ga0373923_0036252 | 3300035111 | Bacteria | 2012 |
| 429 | Ga0373936_0004184 | 3300035113 | Bacteria | 5439 |
| 430 | Ga0373945_0021506 | 3300035116 | Bacteria | 2217 |
| 431 | Ga0373954_0301359 | 3300035118 | Bacteria | 791 |
| 432 | Ga0373956_0012621 | 3300035119 | Bacteria | 3505 |
| 433 | Ga0373956_0043386 | 3300035119 | Bacteria | 2002 |
| 434 | Ga0373956_0104490 | 3300035119 | Bacteria | 1316 |
| 435 | Ga0373943_0000047 | 3300035170 | Bacteria | 41181 |
| 436 | Ga0373943_0001571 | 3300035170 | Bacteria | 10341 |
| 437 | Ga0373946_0037452 | 3300035171 | Bacteria | 1971 |
| 438 | Ga0373955_0012079 | 3300035172 | Bacteria | 4142 |
| 439 | Ga0373955_0128684 | 3300035172 | Bacteria | 1477 |
| 440 | Ga0373955_0164239 | 3300035172 | Bacteria | 1312 |
| 441 | Ga0373924_0020440 | 3300035410 | Unclassified | 2574 |
| 442 | Ga0373924_0036100 | 3300035410 | Unclassified | 2007 |
| 443 | Ga0373924_0132583 | 3300035410 | Bacteria | 1084 |
| 444 | Ga0373931_0025417 | 3300035691 | Bacteria | 3008 |
| 445 | Ga0373935_0000841 | 3300035692 | Bacteria | 16552 |
| 446 | Ga0373935_0001112 | 3300035692 | Bacteria | 14666 |
| 447 | Ga0373935_0001333 | 3300035692 | Bacteria | 13657 |
| 448 | Ga0373935_0149794 | 3300035692 | Bacteria | 1582 |
| 449 | Ga0373935_0225206 | 3300035692 | Unclassified | 1304 |
| 450 | Ga0373927_0000447 | 3300035695 | Bacteria | 31498 |
| 451 | Ga0373927_0004796 | 3300035695 | Bacteria | 9410 |
| 452 | Ga0373927_0082982 | 3300035695 | Bacteria | 2078 |
| 453 | Ga0373927_0089947 | 3300035695 | Bacteria | 1993 |
| 454 | Ga0373927_0107307 | 3300035695 | Bacteria | 1819 |
| 455 | Ga0373933_0012118 | 3300035724 | Bacteria | 4761 |
| 456 | Ga0373933_0072959 | 3300035724 | Bacteria | 2091 |
| 457 | Ga0373947_0000112 | 3300035725 | Bacteria | 40758 |
| 458 | Ga0373947_0027135 | 3300035725 | Bacteria | 3350 |
| 459 | Ga0373947_0052737 | 3300035725 | Bacteria | 2450 |
| 460 | Ga0373947_0100168 | 3300035725 | Bacteria | 1820 |
| 461 | Ga0373937_0000204 | 3300036401 | Bacteria | 57131 |
| 462 | Ga0373937_0121435 | 3300036401 | Bacteria | 2435 |
| 463 | Ga0373937_0138477 | 3300036401 | Bacteria | 2276 |
| 464 | Ga0373937_0147343 | 3300036401 | Unclassified | 2204 |
| 465 | Ga0373937_0317780 | 3300036401 | Bacteria | 1473 |
| 466 | Ga0373925_0000770 | 3300037068 | Bacteria | 29427 |
| 467 | Ga0373925_0001810 | 3300037068 | Bacteria | 17840 |
| 468 | Ga0373925_0008172 | 3300037068 | Bacteria | 7620 |
| 469 | Ga0373925_0008202 | 3300037068 | Bacteria | 7604 |
| 470 | Ga0373925_0042863 | 3300037068 | Bacteria | 3357 |
| 471 | Ga0395901_0254013 | 3300038443 | Unclassified | 1831 |
| 472 | Ga0466963_0001070 | 3300044694 | Bacteria | 14274 |
| 473 | Ga0453684_0435579 | 3300044712 | Unclassified | 1462 |
| 474 | Ga0451576_0358914 | 3300045051 | Bacteria | 1526 |
| 475 | Ga0451576_0394431 | 3300045051 | Bacteria | 1451 |
| 476 | Ga0451576_0462429 | 3300045051 | Unclassified | 1332 |
| 477 | Ga0466958_0254892 | 3300045836 | Unclassified | 1123 |
| 478 | Ga0466967_0005563 | 3300045976 | Bacteria | 8753 |
| 479 | Ga0466967_0377625 | 3300045976 | Bacteria | 1376 |
| 480 | Ga0495603_0057720 | 3300046455 | Unclassified | 2296 |
| 481 | Ga0495603_0390896 | 3300046455 | Unclassified | 797 |
| 482 | Ga0495651_0131872 | 3300046462 | Bacteria | 1823 |
| 483 | Ga0495580_0001544 | 3300046472 | Bacteria | 20251 |
| 484 | Ga0495580_0007898 | 3300046472 | Bacteria | 8510 |
| 485 | Ga0495580_0008448 | 3300046472 | Bacteria | 8191 |
| 486 | Ga0495580_0020794 | 3300046472 | Unclassified | 4851 |
| 487 | Ga0495580_0124153 | 3300046472 | Bacteria | 1792 |
| 488 | Ga0495580_0131868 | 3300046472 | Bacteria | 1733 |
| 489 | Ga0495582_0048059 | 3300046473 | Bacteria | 2350 |
| 490 | Ga0495582_0258575 | 3300046473 | Bacteria | 999 |
| 491 | Ga0495639_0101969 | 3300046475 | Bacteria | 1356 |
| 492 | Ga0495664_0200912 | 3300046477 | Unclassified | 1208 |
| 493 | Ga0495628_0211608 | 3300046516 | Bacteria | 1458 |
| 494 | Ga0495652_0352663 | 3300046529 | Bacteria | 1054 |
| 495 | Ga0495665_0006637 | 3300046531 | Bacteria | 6245 |
| 496 | Ga0495665_0020860 | 3300046531 | Bacteria | 3520 |
| 497 | Ga0495667_0430715 | 3300046559 | Bacteria | 830 |
| 498 | Ga0495635_0262559 | 3300046663 | Bacteria | 1163 |
| 499 | Ga0495599_0412917 | 3300046678 | Bacteria | 803 |
| 500 | Ga0495623_0001371 | 3300046679 | Bacteria | 16530 |
| 501 | Ga0495658_0022720 | 3300046683 | Bacteria | 3321 |
| 502 | Ga0495669_0105202 | 3300046684 | Unclassified | 1314 |
| 503 | Ga0495581_0018527 | 3300047315 | Bacteria | 4043 |
| 504 | Ga0495581_0041757 | 3300047315 | Bacteria | 2655 |
| 505 | Ga0495604_0090018 | 3300047317 | Bacteria | 2280 |
| 506 | Ga0495674_0034545 | 3300047319 | Bacteria | 4572 |
| 507 | Ga0496100_0359218 | 3300048903 | Bacteria | 1102 |
| 508 | Ga0496101_0209200 | 3300048904 | Unclassified | 1511 |
| 509 | Ga0496102_0241091 | 3300048905 | Bacteria | 1705 |
| 510 | Ga0496102_0275079 | 3300048905 | Bacteria | 1587 |
| 511 | Ga0496102_0485209 | 3300048905 | Unclassified | 1157 |
| 512 | Ga0496104_0101247 | 3300048907 | Bacteria | 2758 |
| 513 | Ga0496104_0224142 | 3300048907 | Bacteria | 1792 |
| 514 | Ga0496105_0020434 | 3300048908 | Bacteria | 5350 |
| 515 | Ga0496107_0280146 | 3300048910 | Bacteria | 1241 |
| 516 | Ga0496108_0000689 | 3300048911 | Bacteria | 26147 |
| 517 | Ga0496108_0013237 | 3300048911 | Bacteria | 6724 |
| 518 | Ga0496109_0001300 | 3300048912 | Bacteria | 20670 |
| 519 | Ga0496109_0034301 | 3300048912 | Bacteria | 4570 |
| 520 | Ga0496110_0008161 | 3300048913 | Bacteria | 8412 |
| 521 | Ga0496110_0042861 | 3300048913 | Bacteria | 3950 |
| 522 | Ga0496110_0251347 | 3300048913 | Bacteria | 1609 |
| 523 | Ga0496111_0102159 | 3300048914 | Bacteria | 2107 |
| 524 | Ga0496111_0197289 | 3300048914 | Unclassified | 1496 |
| 525 | Ga0496112_0006571 | 3300048915 | Bacteria | 10232 |
| 526 | Ga0496112_0027881 | 3300048915 | Bacteria | 5448 |
| 527 | Ga0496112_0042724 | 3300048915 | Unclassified | 4435 |
| 528 | Ga0496112_0043787 | 3300048915 | Bacteria | 4383 |
| 529 | Ga0496112_0072910 | 3300048915 | Bacteria | 3394 |
| 530 | Ga0496112_0083914 | 3300048915 | Bacteria | 3151 |
| 531 | Ga0496112_0085247 | 3300048915 | Bacteria | 3126 |
| 532 | Ga0496113_0003019 | 3300048916 | Bacteria | 9971 |
| 533 | Ga0496113_0004283 | 3300048916 | Bacteria | 8742 |
| 534 | Ga0496115_0065577 | 3300048918 | Bacteria | 2933 |
| 535 | Ga0501031_0645590 | 3300049568 | Unclassified | 680 |
| 536 | Ga0501040_0129757 | 3300049576 | Unclassified | 1772 |
| 537 | Ga0501042_0307744 | 3300049578 | Unclassified | 1145 |
| 538 | Ga0501071_0015344 | 3300049587 | Bacteria | 5258 |
| 539 | Ga0501075_0030607 | 3300049591 | Bacteria | 3988 |
| 540 | Ga0501076_0080135 | 3300049592 | Unclassified | 2620 |
| 541 | Ga0501079_0134427 | 3300049741 | Unclassified | 1925 |
| 542 | Ga0501080_0141223 | 3300049742 | Unclassified | 2226 |
| 543 | Ga0501081_0291844 | 3300049743 | Bacteria | 1195 |
| 544 | nmdc:mga0n895_133536_c1 | 3300050512 | Bacteria | 2508 |
| 545 | nmdc:mga0n895_1564_c1 | 3300050512 | Bacteria | 17207 |
| 546 | nmdc:mga0rr50_40678_c1 | 3300050513 | Bacteria | 3381 |
| 547 | nmdc:mga0rr50_6304_c1 | 3300050513 | Bacteria | 7204 |
| 548 | nmdc:mga0rr50_7316_c1 | 3300050513 | Bacteria | 6796 |
| 549 | nmdc:mga08x19_2888_c1 | 3300050514 | Bacteria | 10345 |
| 550 | nmdc:mga08x19_3182_c1 | 3300050514 | Bacteria | 9850 |
| 551 | nmdc:mga08x19_35485_c1 | 3300050514 | Bacteria | 3155 |
| 552 | nmdc:mga0a205_1800_c1 | 3300050515 | Bacteria | 18534 |
| 553 | Ga0495619_0129171 | 3300053085 | Bacteria | 1736 |
| 554 | Ga0501082_0029757 | 3300060353 | Bacteria | 4705 |
| 555 | Ga0530510_0021704 | 3300061734 | Bacteria | 4568 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0645590 | Ga0501031_0645590_83_670 | 188 |
| 2 | 3300049587 | Ga0501071_0015344 | Ga0501071_0015344_2996_3583 | 188 |
| 3 | 3300049592 | Ga0501076_0080135 | Ga0501076_0080135_1997_2584 | 188 |
| 4 | 3300060353 | Ga0501082_0029757 | Ga0501082_0029757_1410_1997 | 188 |
| 5 | 3300005329 | Ga0070683_100183174 | Ga0070683_1001831744 | 215 |
| 6 | 3300005331 | Ga0070670_100048417 | Ga0070670_1000484174 | 215 |
| 7 | 3300005456 | Ga0070678_100033339 | Ga0070678_1000333394 | 215 |
| 8 | 3300005563 | Ga0068855_100063779 | Ga0068855_1000637792 | 215 |
| 9 | 3300005577 | Ga0068857_100029113 | Ga0068857_1000291135 | 215 |
| 10 | 3300005616 | Ga0068852_100621350 | Ga0068852_1006213502 | 215 |
| 11 | 3300005618 | Ga0068864_100018702 | Ga0068864_1000187025 | 215 |
| 12 | 3300005841 | Ga0068863_100008272 | Ga0068863_10000827212 | 215 |
| 13 | 3300010375 | Ga0105239_10384835 | Ga0105239_103848352 | 215 |
| 14 | 3300013296 | Ga0157374_10109111 | Ga0157374_101091114 | 215 |
| 15 | 3300014325 | Ga0163163_10030507 | Ga0163163_100305074 | 215 |
| 16 | 3300025944 | Ga0207661_10100415 | Ga0207661_101004154 | 215 |
| 17 | 3300026088 | Ga0207641_10209389 | Ga0207641_102093892 | 215 |
| 18 | 3300026116 | Ga0207674_10009145 | Ga0207674_100091454 | 215 |
| 19 | 3300044712 | Ga0453684_0435579 | Ga0453684_0435579_141_857 | 215 |
| 20 | 3300046684 | Ga0495669_0105202 | Ga0495669_0105202_165_881 | 215 |
| 21 | 3300048911 | Ga0496108_0013237 | Ga0496108_0013237_3551_4267 | 215 |
| 22 | 3300048912 | Ga0496109_0034301 | Ga0496109_0034301_1250_1966 | 215 |
| 23 | 3300048915 | Ga0496112_0072910 | Ga0496112_0072910_2332_3048 | 215 |
| 24 | 3300049576 | Ga0501040_0129757 | Ga0501040_0129757_101_787 | 218 |
| 25 | 3300049578 | Ga0501042_0307744 | Ga0501042_0307744_93_779 | 218 |
| 26 | 3300049591 | Ga0501075_0030607 | Ga0501075_0030607_2887_3573 | 218 |
| 27 | 3300049741 | Ga0501079_0134427 | Ga0501079_0134427_833_1519 | 218 |
| 28 | 3300049742 | Ga0501080_0141223 | Ga0501080_0141223_1471_2157 | 218 |
| 29 | 3300049743 | Ga0501081_0291844 | Ga0501081_0291844_57_743 | 218 |
| 30 | 3300061734 | Ga0530510_0021704 | Ga0530510_0021704_2372_3058 | 218 |
| 31 | 3300013307 | Ga0157372_10144870 | Ga0157372_101448702 | 221 |
| 32 | 3300005436 | Ga0070713_100058739 | Ga0070713_1000587392 | 231 |
| 33 | 3300035692 | Ga0373935_0225206 | Ga0373935_0225206_97_810 | 231 |
| 34 | 3300035695 | Ga0373927_0107307 | Ga0373927_0107307_419_1132 | 231 |
| 35 | 3300035725 | Ga0373947_0100168 | Ga0373947_0100168_745_1458 | 231 |
| 36 | 3300005563 | Ga0068855_100765441 | Ga0068855_1007654412 | 232 |
| 37 | 3300009174 | Ga0105241_10044572 | Ga0105241_100445724 | 232 |
| 38 | 3300009545 | Ga0105237_10501110 | Ga0105237_105011102 | 232 |
| 39 | 3300009551 | Ga0105238_10317607 | Ga0105238_103176071 | 232 |
| 40 | 3300013100 | Ga0157373_10360623 | Ga0157373_103606231 | 232 |
| 41 | 3300014325 | Ga0163163_10004099 | Ga0163163_1000409913 | 232 |
| 42 | 3300025949 | Ga0207667_10130156 | Ga0207667_101301562 | 232 |
| 43 | 3300026078 | Ga0207702_10077565 | Ga0207702_100775654 | 232 |
| 44 | 3300035172 | Ga0373955_0128684 | Ga0373955_0128684_433_1149 | 232 |
| 45 | 3300046472 | Ga0495580_0124153 | Ga0495580_0124153_622_1338 | 232 |
| 46 | 3300046559 | Ga0495667_0430715 | Ga0495667_0430715_22_738 | 232 |
| 47 | 3300046663 | Ga0495635_0262559 | Ga0495635_0262559_113_829 | 232 |
| 48 | 3300048913 | Ga0496110_0251347 | Ga0496110_0251347_407_1123 | 232 |
| 49 | 3300053085 | Ga0495619_0129171 | Ga0495619_0129171_671_1387 | 232 |
| 50 | 3300005468 | Ga0070707_100022230 | Ga0070707_1000222303 | 233 |
| 51 | 3300005518 | Ga0070699_100002709 | Ga0070699_1000027097 | 233 |
| 52 | 3300045051 | Ga0451576_0358914 | Ga0451576_0358914_385_1155 | 233 |
| 53 | 3300046462 | Ga0495651_0131872 | Ga0495651_0131872_201_902 | 233 |
| 54 | 3300005337 | Ga0070682_100023124 | Ga0070682_1000231243 | 234 |
| 55 | 3300005340 | Ga0070689_100026875 | Ga0070689_1000268754 | 234 |
| 56 | 3300005347 | Ga0070668_100056334 | Ga0070668_1000563343 | 234 |
| 57 | 3300005353 | Ga0070669_100031734 | Ga0070669_1000317342 | 234 |
| 58 | 3300005434 | Ga0070709_10065582 | Ga0070709_100655822 | 234 |
| 59 | 3300005435 | Ga0070714_100091694 | Ga0070714_1000916942 | 234 |
| 60 | 3300005435 | Ga0070714_100173064 | Ga0070714_1001730643 | 234 |
| 61 | 3300005435 | Ga0070714_100266166 | Ga0070714_1002661662 | 234 |
| 62 | 3300005435 | Ga0070714_100339711 | Ga0070714_1003397112 | 234 |
| 63 | 3300005436 | Ga0070713_100113612 | Ga0070713_1001136123 | 234 |
| 64 | 3300005436 | Ga0070713_100279556 | Ga0070713_1002795561 | 234 |
| 65 | 3300005437 | Ga0070710_10011795 | Ga0070710_100117952 | 234 |
| 66 | 3300005439 | Ga0070711_100012311 | Ga0070711_1000123112 | 234 |
| 67 | 3300005439 | Ga0070711_100012589 | Ga0070711_1000125893 | 234 |
| 68 | 3300005439 | Ga0070711_100038547 | Ga0070711_1000385473 | 234 |
| 69 | 3300005439 | Ga0070711_100078540 | Ga0070711_1000785402 | 234 |
| 70 | 3300005439 | Ga0070711_100345000 | Ga0070711_1003450001 | 234 |
| 71 | 3300005445 | Ga0070708_101001314 | Ga0070708_1010013141 | 234 |
| 72 | 3300005457 | Ga0070662_100005317 | Ga0070662_1000053174 | 234 |
| 73 | 3300005467 | Ga0070706_100000278 | Ga0070706_10000027848 | 234 |
| 74 | 3300005468 | Ga0070707_100076687 | Ga0070707_1000766874 | 234 |
| 75 | 3300005471 | Ga0070698_100051792 | Ga0070698_1000517921 | 234 |
| 76 | 3300005471 | Ga0070698_100110325 | Ga0070698_1001103253 | 234 |
| 77 | 3300005518 | Ga0070699_100020254 | Ga0070699_1000202546 | 234 |
| 78 | 3300005530 | Ga0070679_100091382 | Ga0070679_1000913822 | 234 |
| 79 | 3300005536 | Ga0070697_100000049 | Ga0070697_1000000499 | 234 |
| 80 | 3300005536 | Ga0070697_100000158 | Ga0070697_10000015823 | 234 |
| 81 | 3300005536 | Ga0070697_100005879 | Ga0070697_1000058797 | 234 |
| 82 | 3300005545 | Ga0070695_100048381 | Ga0070695_1000483813 | 234 |
| 83 | 3300005546 | Ga0070696_100008369 | Ga0070696_1000083692 | 234 |
| 84 | 3300005549 | Ga0070704_100150447 | Ga0070704_1001504472 | 234 |
| 85 | 3300005563 | Ga0068855_100137310 | Ga0068855_1001373102 | 234 |
| 86 | 3300005578 | Ga0068854_100004626 | Ga0068854_1000046265 | 234 |
| 87 | 3300005614 | Ga0068856_100008311 | Ga0068856_1000083116 | 234 |
| 88 | 3300005614 | Ga0068856_100020557 | Ga0068856_1000205576 | 234 |
| 89 | 3300005616 | Ga0068852_100161338 | Ga0068852_1001613383 | 234 |
| 90 | 3300005842 | Ga0068858_100077679 | Ga0068858_1000776794 | 234 |
| 91 | 3300005843 | Ga0068860_100011500 | Ga0068860_1000115007 | 234 |
| 92 | 3300005983 | Ga0081540_1110156 | Ga0081540_11101562 | 234 |
| 93 | 3300005983 | Ga0081540_1147245 | Ga0081540_11472452 | 234 |
| 94 | 3300006028 | Ga0070717_10226286 | Ga0070717_102262862 | 234 |
| 95 | 3300006028 | Ga0070717_10236080 | Ga0070717_102360802 | 234 |
| 96 | 3300006163 | Ga0070715_10050443 | Ga0070715_100504434 | 234 |
| 97 | 3300006163 | Ga0070715_10122083 | Ga0070715_101220832 | 234 |
| 98 | 3300006173 | Ga0070716_100003540 | Ga0070716_1000035409 | 234 |
| 99 | 3300006175 | Ga0070712_100002390 | Ga0070712_1000023908 | 234 |
| 100 | 3300006175 | Ga0070712_100012269 | Ga0070712_1000122694 | 234 |
| 101 | 3300006175 | Ga0070712_100059128 | Ga0070712_1000591282 | 234 |
| 102 | 3300006175 | Ga0070712_100552249 | Ga0070712_1005522491 | 234 |
| 103 | 3300006175 | Ga0070712_100890687 | Ga0070712_1008906871 | 234 |
| 104 | 3300006358 | Ga0068871_100018971 | Ga0068871_1000189712 | 234 |
| 105 | 3300006852 | Ga0075433_10001098 | Ga0075433_100010988 | 234 |
| 106 | 3300006871 | Ga0075434_100000195 | Ga0075434_10000019539 | 234 |
| 107 | 3300006914 | Ga0075436_100004841 | Ga0075436_1000048419 | 234 |
| 108 | 3300006914 | Ga0075436_100042255 | Ga0075436_1000422554 | 234 |
| 109 | 3300006914 | Ga0075436_100561083 | Ga0075436_1005610831 | 234 |
| 110 | 3300007076 | Ga0075435_100000065 | Ga0075435_10000006536 | 234 |
| 111 | 3300009093 | Ga0105240_10029292 | Ga0105240_100292924 | 234 |
| 112 | 3300009093 | Ga0105240_10504761 | Ga0105240_105047612 | 234 |
| 113 | 3300009093 | Ga0105240_10624398 | Ga0105240_106243982 | 234 |
| 114 | 3300009098 | Ga0105245_10054629 | Ga0105245_100546292 | 234 |
| 115 | 3300009098 | Ga0105245_10324423 | Ga0105245_103244231 | 234 |
| 116 | 3300009101 | Ga0105247_10006341 | Ga0105247_100063414 | 234 |
| 117 | 3300009174 | Ga0105241_10087172 | Ga0105241_100871723 | 234 |
| 118 | 3300009174 | Ga0105241_10165548 | Ga0105241_101655482 | 234 |
| 119 | 3300009174 | Ga0105241_10184527 | Ga0105241_101845273 | 234 |
| 120 | 3300009174 | Ga0105241_10330440 | Ga0105241_103304402 | 234 |
| 121 | 3300009176 | Ga0105242_10009165 | Ga0105242_100091658 | 234 |
| 122 | 3300009176 | Ga0105242_10499047 | Ga0105242_104990472 | 234 |
| 123 | 3300009177 | Ga0105248_10021967 | Ga0105248_100219675 | 234 |
| 124 | 3300009545 | Ga0105237_10403751 | Ga0105237_104037513 | 234 |
| 125 | 3300009551 | Ga0105238_10014582 | Ga0105238_100145824 | 234 |
| 126 | 3300009551 | Ga0105238_10227665 | Ga0105238_102276652 | 234 |
| 127 | 3300009551 | Ga0105238_10346525 | Ga0105238_103465252 | 234 |
| 128 | 3300009553 | Ga0105249_10024924 | Ga0105249_100249243 | 234 |
| 129 | 3300010159 | Ga0099796_10063845 | Ga0099796_100638452 | 234 |
| 130 | 3300010375 | Ga0105239_10114979 | Ga0105239_101149793 | 234 |
| 131 | 3300010375 | Ga0105239_10221559 | Ga0105239_102215592 | 234 |
| 132 | 3300011119 | Ga0105246_10007122 | Ga0105246_100071223 | 234 |
| 133 | 3300013100 | Ga0157373_10180002 | Ga0157373_101800022 | 234 |
| 134 | 3300013100 | Ga0157373_10244058 | Ga0157373_102440581 | 234 |
| 135 | 3300013104 | Ga0157370_10166681 | Ga0157370_101666811 | 234 |
| 136 | 3300013104 | Ga0157370_10516345 | Ga0157370_105163452 | 234 |
| 137 | 3300013296 | Ga0157374_10005580 | Ga0157374_100055801 | 234 |
| 138 | 3300013296 | Ga0157374_10048161 | Ga0157374_100481614 | 234 |
| 139 | 3300013297 | Ga0157378_10024706 | Ga0157378_100247062 | 234 |
| 140 | 3300013297 | Ga0157378_10206842 | Ga0157378_102068422 | 234 |
| 141 | 3300013306 | Ga0163162_10002555 | Ga0163162_1000255512 | 234 |
| 142 | 3300013307 | Ga0157372_10010989 | Ga0157372_100109898 | 234 |
| 143 | 3300013307 | Ga0157372_10220384 | Ga0157372_102203842 | 234 |
| 144 | 3300013307 | Ga0157372_10802984 | Ga0157372_108029842 | 234 |
| 145 | 3300013308 | Ga0157375_11569969 | Ga0157375_115699691 | 234 |
| 146 | 3300014325 | Ga0163163_10028700 | Ga0163163_100287007 | 234 |
| 147 | 3300014968 | Ga0157379_10062392 | Ga0157379_100623923 | 234 |
| 148 | 3300022730 | Ga0224570_101606 | Ga0224570_1016063 | 234 |
| 149 | 3300025321 | Ga0207656_10071485 | Ga0207656_100714851 | 234 |
| 150 | 3300025898 | Ga0207692_10002000 | Ga0207692_100020002 | 234 |
| 151 | 3300025898 | Ga0207692_10325845 | Ga0207692_103258452 | 234 |
| 152 | 3300025900 | Ga0207710_10065474 | Ga0207710_100654742 | 234 |
| 153 | 3300025903 | Ga0207680_10019827 | Ga0207680_100198271 | 234 |
| 154 | 3300025905 | Ga0207685_10057151 | Ga0207685_100571511 | 234 |
| 155 | 3300025905 | Ga0207685_10061440 | Ga0207685_100614402 | 234 |
| 156 | 3300025905 | Ga0207685_10100452 | Ga0207685_101004522 | 234 |
| 157 | 3300025906 | Ga0207699_10041384 | Ga0207699_100413843 | 234 |
| 158 | 3300025910 | Ga0207684_10001907 | Ga0207684_100019079 | 234 |
| 159 | 3300025911 | Ga0207654_10032167 | Ga0207654_100321672 | 234 |
| 160 | 3300025911 | Ga0207654_10098528 | Ga0207654_100985282 | 234 |
| 161 | 3300025911 | Ga0207654_10113626 | Ga0207654_101136261 | 234 |
| 162 | 3300025912 | Ga0207707_10034516 | Ga0207707_100345162 | 234 |
| 163 | 3300025912 | Ga0207707_10150627 | Ga0207707_101506273 | 234 |
| 164 | 3300025912 | Ga0207707_10217226 | Ga0207707_102172262 | 234 |
| 165 | 3300025912 | Ga0207707_10222184 | Ga0207707_102221842 | 234 |
| 166 | 3300025913 | Ga0207695_10022649 | Ga0207695_100226496 | 234 |
| 167 | 3300025915 | Ga0207693_10000402 | Ga0207693_100004027 | 234 |
| 168 | 3300025915 | Ga0207693_10008118 | Ga0207693_100081188 | 234 |
| 169 | 3300025915 | Ga0207693_10051802 | Ga0207693_100518022 | 234 |
| 170 | 3300025915 | Ga0207693_10159841 | Ga0207693_101598412 | 234 |
| 171 | 3300025916 | Ga0207663_10003860 | Ga0207663_100038607 | 234 |
| 172 | 3300025916 | Ga0207663_10004728 | Ga0207663_100047286 | 234 |
| 173 | 3300025916 | Ga0207663_10347560 | Ga0207663_103475602 | 234 |
| 174 | 3300025917 | Ga0207660_10019093 | Ga0207660_100190934 | 234 |
| 175 | 3300025921 | Ga0207652_10168593 | Ga0207652_101685933 | 234 |
| 176 | 3300025922 | Ga0207646_10282658 | Ga0207646_102826581 | 234 |
| 177 | 3300025922 | Ga0207646_10483205 | Ga0207646_104832052 | 234 |
| 178 | 3300025928 | Ga0207700_10006979 | Ga0207700_100069795 | 234 |
| 179 | 3300025928 | Ga0207700_10222605 | Ga0207700_102226052 | 234 |
| 180 | 3300025929 | Ga0207664_10096008 | Ga0207664_100960082 | 234 |
| 181 | 3300025929 | Ga0207664_10294738 | Ga0207664_102947381 | 234 |
| 182 | 3300025933 | Ga0207706_10000941 | Ga0207706_1000094127 | 234 |
| 183 | 3300025934 | Ga0207686_10019667 | Ga0207686_100196674 | 234 |
| 184 | 3300025934 | Ga0207686_10133952 | Ga0207686_101339522 | 234 |
| 185 | 3300025939 | Ga0207665_10000358 | Ga0207665_100003589 | 234 |
| 186 | 3300025939 | Ga0207665_10037700 | Ga0207665_100377003 | 234 |
| 187 | 3300025939 | Ga0207665_10184325 | Ga0207665_101843252 | 234 |
| 188 | 3300025949 | Ga0207667_10024560 | Ga0207667_100245605 | 234 |
| 189 | 3300025949 | Ga0207667_10151125 | Ga0207667_101511253 | 234 |
| 190 | 3300025949 | Ga0207667_10566164 | Ga0207667_105661642 | 234 |
| 191 | 3300025949 | Ga0207667_10813166 | Ga0207667_108131661 | 234 |
| 192 | 3300025961 | Ga0207712_10021844 | Ga0207712_100218441 | 234 |
| 193 | 3300025972 | Ga0207668_10013931 | Ga0207668_100139314 | 234 |
| 194 | 3300025981 | Ga0207640_10047553 | Ga0207640_100475532 | 234 |
| 195 | 3300025986 | Ga0207658_10015504 | Ga0207658_100155041 | 234 |
| 196 | 3300026023 | Ga0207677_10002399 | Ga0207677_1000239910 | 234 |
| 197 | 3300026023 | Ga0207677_10314679 | Ga0207677_103146792 | 234 |
| 198 | 3300026035 | Ga0207703_10017812 | Ga0207703_100178126 | 234 |
| 199 | 3300026078 | Ga0207702_10028596 | Ga0207702_100285962 | 234 |
| 200 | 3300026078 | Ga0207702_10039405 | Ga0207702_100394052 | 234 |
| 201 | 3300026089 | Ga0207648_10363612 | Ga0207648_103636122 | 234 |
| 202 | 3300026116 | Ga0207674_10014217 | Ga0207674_100142176 | 234 |
| 203 | 3300026142 | Ga0207698_10027346 | Ga0207698_100273462 | 234 |
| 204 | 3300026142 | Ga0207698_10158217 | Ga0207698_101582173 | 234 |
| 205 | 3300028380 | Ga0268265_10056860 | Ga0268265_100568603 | 234 |
| 206 | 3300028381 | Ga0268264_10102638 | Ga0268264_101026382 | 234 |
| 207 | 3300030760 | Ga0265762_1000119 | Ga0265762_10001197 | 234 |
| 208 | 3300030760 | Ga0265762_1057041 | Ga0265762_10570411 | 234 |
| 209 | 3300030879 | Ga0265765_1003676 | Ga0265765_10036762 | 234 |
| 210 | 3300031090 | Ga0265760_10003665 | Ga0265760_100036653 | 234 |
| 211 | 3300031090 | Ga0265760_10004688 | Ga0265760_100046884 | 234 |
| 212 | 3300031090 | Ga0265760_10008406 | Ga0265760_100084062 | 234 |
| 213 | 3300031090 | Ga0265760_10010644 | Ga0265760_100106443 | 234 |
| 214 | 3300031239 | Ga0265328_10045711 | Ga0265328_100457112 | 234 |
| 215 | 3300031241 | Ga0265325_10026032 | Ga0265325_100260322 | 234 |
| 216 | 3300031247 | Ga0265340_10041679 | Ga0265340_100416792 | 234 |
| 217 | 3300031249 | Ga0265339_10164856 | Ga0265339_101648561 | 234 |
| 218 | 3300031711 | Ga0265314_10109198 | Ga0265314_101091982 | 234 |
| 219 | 3300033545 | Ga0316214_1012801 | Ga0316214_10128012 | 234 |
| 220 | 3300035086 | Ga0373934_0147038 | Ga0373934_0147038_200_904 | 234 |
| 221 | 3300035116 | Ga0373945_0021506 | Ga0373945_0021506_119_853 | 234 |
| 222 | 3300035119 | Ga0373956_0043386 | Ga0373956_0043386_104_808 | 234 |
| 223 | 3300035119 | Ga0373956_0104490 | Ga0373956_0104490_160_864 | 234 |
| 224 | 3300035170 | Ga0373943_0000047 | Ga0373943_0000047_9576_10310 | 234 |
| 225 | 3300035171 | Ga0373946_0037452 | Ga0373946_0037452_1159_1893 | 234 |
| 226 | 3300035172 | Ga0373955_0012079 | Ga0373955_0012079_2134_2838 | 234 |
| 227 | 3300035172 | Ga0373955_0164239 | Ga0373955_0164239_160_864 | 234 |
| 228 | 3300035410 | Ga0373924_0132583 | Ga0373924_0132583_154_858 | 234 |
| 229 | 3300035692 | Ga0373935_0000841 | Ga0373935_0000841_2999_3733 | 234 |
| 230 | 3300035695 | Ga0373927_0000447 | Ga0373927_0000447_29985_30719 | 234 |
| 231 | 3300035695 | Ga0373927_0082982 | Ga0373927_0082982_303_1007 | 234 |
| 232 | 3300035724 | Ga0373933_0012118 | Ga0373933_0012118_2905_3609 | 234 |
| 233 | 3300035724 | Ga0373933_0072959 | Ga0373933_0072959_153_857 | 234 |
| 234 | 3300035725 | Ga0373947_0000112 | Ga0373947_0000112_35983_36717 | 234 |
| 235 | 3300036401 | Ga0373937_0121435 | Ga0373937_0121435_575_1279 | 234 |
| 236 | 3300036401 | Ga0373937_0138477 | Ga0373937_0138477_1384_2088 | 234 |
| 237 | 3300036401 | Ga0373937_0317780 | Ga0373937_0317780_29_733 | 234 |
| 238 | 3300037068 | Ga0373925_0000770 | Ga0373925_0000770_934_1668 | 234 |
| 239 | 3300037068 | Ga0373925_0008172 | Ga0373925_0008172_5391_6095 | 234 |
| 240 | 3300038443 | Ga0395901_0254013 | Ga0395901_0254013_503_1210 | 234 |
| 241 | 3300045051 | Ga0451576_0394431 | Ga0451576_0394431_47_751 | 234 |
| 242 | 3300045051 | Ga0451576_0462429 | Ga0451576_0462429_133_840 | 234 |
| 243 | 3300046455 | Ga0495603_0057720 | Ga0495603_0057720_480_1184 | 234 |
| 244 | 3300046455 | Ga0495603_0390896 | Ga0495603_0390896_22_726 | 234 |
| 245 | 3300046472 | Ga0495580_0001544 | Ga0495580_0001544_14885_15589 | 234 |
| 246 | 3300046472 | Ga0495580_0008448 | Ga0495580_0008448_2486_3190 | 234 |
| 247 | 3300046473 | Ga0495582_0258575 | Ga0495582_0258575_64_768 | 234 |
| 248 | 3300046475 | Ga0495639_0101969 | Ga0495639_0101969_409_1113 | 234 |
| 249 | 3300046477 | Ga0495664_0200912 | Ga0495664_0200912_332_1066 | 234 |
| 250 | 3300046516 | Ga0495628_0211608 | Ga0495628_0211608_414_1148 | 234 |
| 251 | 3300046529 | Ga0495652_0352663 | Ga0495652_0352663_232_936 | 234 |
| 252 | 3300046678 | Ga0495599_0412917 | Ga0495599_0412917_88_792 | 234 |
| 253 | 3300046679 | Ga0495623_0001371 | Ga0495623_0001371_15401_16105 | 234 |
| 254 | 3300046683 | Ga0495658_0022720 | Ga0495658_0022720_412_1116 | 234 |
| 255 | 3300047315 | Ga0495581_0041757 | Ga0495581_0041757_562_1266 | 234 |
| 256 | 3300047317 | Ga0495604_0090018 | Ga0495604_0090018_268_1002 | 234 |
| 257 | 3300047319 | Ga0495674_0034545 | Ga0495674_0034545_1254_1988 | 234 |
| 258 | 3300048905 | Ga0496102_0241091 | Ga0496102_0241091_193_897 | 234 |
| 259 | 3300048907 | Ga0496104_0224142 | Ga0496104_0224142_312_1016 | 234 |
| 260 | 3300048915 | Ga0496112_0085247 | Ga0496112_0085247_1191_1895 | 234 |
| 261 | 3300050512 | nmdc:mga0n895_133536_c1 | nmdc:mga0n895_133536_c1_847_1551 | 234 |
| 262 | 3300050512 | nmdc:mga0n895_1564_c1 | nmdc:mga0n895_1564_c1_12452_13156 | 234 |
| 263 | 3300050513 | nmdc:mga0rr50_40678_c1 | nmdc:mga0rr50_40678_c1_2274_2978 | 234 |
| 264 | 3300050513 | nmdc:mga0rr50_7316_c1 | nmdc:mga0rr50_7316_c1_5894_6598 | 234 |
| 265 | 3300050514 | nmdc:mga08x19_3182_c1 | nmdc:mga08x19_3182_c1_8211_8915 | 234 |
| 266 | 3300050514 | nmdc:mga08x19_35485_c1 | nmdc:mga08x19_35485_c1_575_1279 | 234 |
| 267 | 3300050515 | nmdc:mga0a205_1800_c1 | nmdc:mga0a205_1800_c1_11575_12279 | 234 |
| 268 | 3300005329 | Ga0070683_100184167 | Ga0070683_1001841672 | 235 |
| 269 | 3300005338 | Ga0068868_100012948 | Ga0068868_1000129481 | 235 |
| 270 | 3300005436 | Ga0070713_100054518 | Ga0070713_1000545183 | 235 |
| 271 | 3300005458 | Ga0070681_10303423 | Ga0070681_103034232 | 235 |
| 272 | 3300005468 | Ga0070707_100216107 | Ga0070707_1002161072 | 235 |
| 273 | 3300005535 | Ga0070684_100057935 | Ga0070684_1000579352 | 235 |
| 274 | 3300005539 | Ga0068853_100024017 | Ga0068853_1000240176 | 235 |
| 275 | 3300005578 | Ga0068854_100854600 | Ga0068854_1008546001 | 235 |
| 276 | 3300005616 | Ga0068852_100093344 | Ga0068852_1000933444 | 235 |
| 277 | 3300005834 | Ga0068851_10423839 | Ga0068851_104238391 | 235 |
| 278 | 3300006028 | Ga0070717_10020604 | Ga0070717_100206042 | 235 |
| 279 | 3300006914 | Ga0075436_100275532 | Ga0075436_1002755322 | 235 |
| 280 | 3300009093 | Ga0105240_10017855 | Ga0105240_1001785511 | 235 |
| 281 | 3300009093 | Ga0105240_10078716 | Ga0105240_100787163 | 235 |
| 282 | 3300009098 | Ga0105245_10002858 | Ga0105245_100028584 | 235 |
| 283 | 3300009098 | Ga0105245_10550211 | Ga0105245_105502112 | 235 |
| 284 | 3300009174 | Ga0105241_10153074 | Ga0105241_101530742 | 235 |
| 285 | 3300009545 | Ga0105237_10236827 | Ga0105237_102368271 | 235 |
| 286 | 3300013105 | Ga0157369_10499701 | Ga0157369_104997012 | 235 |
| 287 | 3300013307 | Ga0157372_10004868 | Ga0157372_100048684 | 235 |
| 288 | 3300025910 | Ga0207684_10232864 | Ga0207684_102328642 | 235 |
| 289 | 3300025912 | Ga0207707_10049869 | Ga0207707_100498692 | 235 |
| 290 | 3300025913 | Ga0207695_10440806 | Ga0207695_104408062 | 235 |
| 291 | 3300025924 | Ga0207694_10053209 | Ga0207694_100532094 | 235 |
| 292 | 3300025924 | Ga0207694_10171950 | Ga0207694_101719502 | 235 |
| 293 | 3300025927 | Ga0207687_10003150 | Ga0207687_100031505 | 235 |
| 294 | 3300025928 | Ga0207700_10202489 | Ga0207700_102024891 | 235 |
| 295 | 3300025928 | Ga0207700_10259523 | Ga0207700_102595232 | 235 |
| 296 | 3300025928 | Ga0207700_10308062 | Ga0207700_103080622 | 235 |
| 297 | 3300026041 | Ga0207639_10518496 | Ga0207639_105184961 | 235 |
| 298 | 3300026078 | Ga0207702_10275050 | Ga0207702_102750502 | 235 |
| 299 | 3300026142 | Ga0207698_10062953 | Ga0207698_100629533 | 235 |
| 300 | 3300035083 | Ga0373926_0015941 | Ga0373926_0015941_1078_1800 | 235 |
| 301 | 3300035111 | Ga0373923_0036252 | Ga0373923_0036252_1064_1771 | 235 |
| 302 | 3300035119 | Ga0373956_0012621 | Ga0373956_0012621_1212_1931 | 235 |
| 303 | 3300035170 | Ga0373943_0001571 | Ga0373943_0001571_7426_8148 | 235 |
| 304 | 3300035410 | Ga0373924_0020440 | Ga0373924_0020440_273_980 | 235 |
| 305 | 3300035692 | Ga0373935_0001333 | Ga0373935_0001333_6930_7637 | 235 |
| 306 | 3300035692 | Ga0373935_0149794 | Ga0373935_0149794_19_741 | 235 |
| 307 | 3300035695 | Ga0373927_0004796 | Ga0373927_0004796_7505_8227 | 235 |
| 308 | 3300035695 | Ga0373927_0089947 | Ga0373927_0089947_385_1092 | 235 |
| 309 | 3300035725 | Ga0373947_0027135 | Ga0373947_0027135_241_948 | 235 |
| 310 | 3300035725 | Ga0373947_0052737 | Ga0373947_0052737_637_1359 | 235 |
| 311 | 3300036401 | Ga0373937_0000204 | Ga0373937_0000204_394_1101 | 235 |
| 312 | 3300037068 | Ga0373925_0008202 | Ga0373925_0008202_5791_6513 | 235 |
| 313 | 3300037068 | Ga0373925_0042863 | Ga0373925_0042863_911_1618 | 235 |
| 314 | 3300044694 | Ga0466963_0001070 | Ga0466963_0001070_12075_12782 | 235 |
| 315 | 3300045836 | Ga0466958_0254892 | Ga0466958_0254892_72_779 | 235 |
| 316 | 3300045976 | Ga0466967_0005563 | Ga0466967_0005563_819_1526 | 235 |
| 317 | 3300045976 | Ga0466967_0377625 | Ga0466967_0377625_198_905 | 235 |
| 318 | 3300046472 | Ga0495580_0131868 | Ga0495580_0131868_680_1402 | 235 |
| 319 | 3300046473 | Ga0495582_0048059 | Ga0495582_0048059_212_934 | 235 |
| 320 | 3300046531 | Ga0495665_0020860 | Ga0495665_0020860_1219_1926 | 235 |
| 321 | 3300048908 | Ga0496105_0020434 | Ga0496105_0020434_1003_1710 | 235 |
| 322 | 3300048910 | Ga0496107_0280146 | Ga0496107_0280146_288_995 | 235 |
| 323 | 3300048915 | Ga0496112_0027881 | Ga0496112_0027881_313_1020 | 235 |
| 324 | 3300048916 | Ga0496113_0003019 | Ga0496113_0003019_7464_8171 | 235 |
| 325 | 3300005338 | Ga0068868_100012287 | Ga0068868_1000122872 | 236 |
| 326 | 3300005437 | Ga0070710_10020546 | Ga0070710_100205462 | 236 |
| 327 | 3300005458 | Ga0070681_10003480 | Ga0070681_100034809 | 236 |
| 328 | 3300005530 | Ga0070679_100063805 | Ga0070679_1000638053 | 236 |
| 329 | 3300005535 | Ga0070684_100243220 | Ga0070684_1002432202 | 236 |
| 330 | 3300005539 | Ga0068853_100041531 | Ga0068853_1000415312 | 236 |
| 331 | 3300005577 | Ga0068857_100031365 | Ga0068857_1000313652 | 236 |
| 332 | 3300005614 | Ga0068856_100001986 | Ga0068856_1000019863 | 236 |
| 333 | 3300005834 | Ga0068851_10107976 | Ga0068851_101079762 | 236 |
| 334 | 3300005842 | Ga0068858_100237633 | Ga0068858_1002376331 | 236 |
| 335 | 3300006173 | Ga0070716_100080483 | Ga0070716_1000804831 | 236 |
| 336 | 3300006237 | Ga0097621_100002603 | Ga0097621_1000026038 | 236 |
| 337 | 3300006358 | Ga0068871_100001192 | Ga0068871_10000119212 | 236 |
| 338 | 3300009093 | Ga0105240_10065441 | Ga0105240_100654415 | 236 |
| 339 | 3300009174 | Ga0105241_10023905 | Ga0105241_100239052 | 236 |
| 340 | 3300009545 | Ga0105237_10183979 | Ga0105237_101839792 | 236 |
| 341 | 3300009551 | Ga0105238_10000417 | Ga0105238_1000041723 | 236 |
| 342 | 3300013102 | Ga0157371_10528214 | Ga0157371_105282141 | 236 |
| 343 | 3300013105 | Ga0157369_10000258 | Ga0157369_100002583 | 236 |
| 344 | 3300013296 | Ga0157374_10001052 | Ga0157374_100010529 | 236 |
| 345 | 3300013297 | Ga0157378_10002142 | Ga0157378_1000214213 | 236 |
| 346 | 3300013307 | Ga0157372_10000335 | Ga0157372_1000033540 | 236 |
| 347 | 3300025321 | Ga0207656_10195614 | Ga0207656_101956141 | 236 |
| 348 | 3300025913 | Ga0207695_10206793 | Ga0207695_102067932 | 236 |
| 349 | 3300025915 | Ga0207693_10051323 | Ga0207693_100513233 | 236 |
| 350 | 3300025924 | Ga0207694_10000284 | Ga0207694_1000028438 | 236 |
| 351 | 3300025928 | Ga0207700_10025629 | Ga0207700_100256292 | 236 |
| 352 | 3300025928 | Ga0207700_10028535 | Ga0207700_100285353 | 236 |
| 353 | 3300025928 | Ga0207700_10037677 | Ga0207700_100376771 | 236 |
| 354 | 3300025939 | Ga0207665_10282537 | Ga0207665_102825372 | 236 |
| 355 | 3300025949 | Ga0207667_10000487 | Ga0207667_1000048740 | 236 |
| 356 | 3300026023 | Ga0207677_10109793 | Ga0207677_101097933 | 236 |
| 357 | 3300026035 | Ga0207703_10176019 | Ga0207703_101760191 | 236 |
| 358 | 3300026041 | Ga0207639_10012639 | Ga0207639_100126392 | 236 |
| 359 | 3300026078 | Ga0207702_10000482 | Ga0207702_1000048222 | 236 |
| 360 | 3300026116 | Ga0207674_10034006 | Ga0207674_100340063 | 236 |
| 361 | 3300035113 | Ga0373936_0004184 | Ga0373936_0004184_2181_2897 | 236 |
| 362 | 3300035118 | Ga0373954_0301359 | Ga0373954_0301359_44_754 | 236 |
| 363 | 3300035410 | Ga0373924_0036100 | Ga0373924_0036100_142_852 | 236 |
| 364 | 3300035692 | Ga0373935_0001112 | Ga0373935_0001112_8306_9022 | 236 |
| 365 | 3300036401 | Ga0373937_0147343 | Ga0373937_0147343_335_1045 | 236 |
| 366 | 3300037068 | Ga0373925_0001810 | Ga0373925_0001810_5466_6182 | 236 |
| 367 | 3300046472 | Ga0495580_0007898 | Ga0495580_0007898_3168_3884 | 236 |
| 368 | 3300046472 | Ga0495580_0020794 | Ga0495580_0020794_4123_4839 | 236 |
| 369 | 3300046531 | Ga0495665_0006637 | Ga0495665_0006637_4640_5356 | 236 |
| 370 | 3300047315 | Ga0495581_0018527 | Ga0495581_0018527_2712_3428 | 236 |
| 371 | 3300048905 | Ga0496102_0275079 | Ga0496102_0275079_618_1328 | 236 |
| 372 | 3300048907 | Ga0496104_0101247 | Ga0496104_0101247_121_831 | 236 |
| 373 | 3300048913 | Ga0496110_0042861 | Ga0496110_0042861_1245_1955 | 236 |
| 374 | 3300048914 | Ga0496111_0102159 | Ga0496111_0102159_224_934 | 236 |
| 375 | 3300048915 | Ga0496112_0043787 | Ga0496112_0043787_1556_2266 | 236 |
| 376 | 3300048918 | Ga0496115_0065577 | Ga0496115_0065577_779_1489 | 236 |
| 377 | 3300050513 | nmdc:mga0rr50_6304_c1 | nmdc:mga0rr50_6304_c1_3263_3979 | 236 |
| 378 | 3300050514 | nmdc:mga08x19_2888_c1 | nmdc:mga08x19_2888_c1_5178_5894 | 236 |
| 379 | 2162886012 | MBSR1b_contig_1528414 | MBSR1b_0500.00002250 | 237 |
| 380 | 2162886012 | MBSR1b_contig_1782974 | MBSR1b_0977.00005380 | 237 |
| 381 | 3300005329 | Ga0070683_100012083 | Ga0070683_1000120832 | 237 |
| 382 | 3300005330 | Ga0070690_100012194 | Ga0070690_1000121943 | 237 |
| 383 | 3300005331 | Ga0070670_100003670 | Ga0070670_1000036709 | 237 |
| 384 | 3300005331 | Ga0070670_100144680 | Ga0070670_1001446802 | 237 |
| 385 | 3300005333 | Ga0070677_10006410 | Ga0070677_100064103 | 237 |
| 386 | 3300005334 | Ga0068869_100032444 | Ga0068869_1000324442 | 237 |
| 387 | 3300005335 | Ga0070666_10131503 | Ga0070666_101315032 | 237 |
| 388 | 3300005338 | Ga0068868_100019511 | Ga0068868_1000195112 | 237 |
| 389 | 3300005339 | Ga0070660_100015331 | Ga0070660_1000153315 | 237 |
| 390 | 3300005340 | Ga0070689_100088201 | Ga0070689_1000882014 | 237 |
| 391 | 3300005340 | Ga0070689_100134408 | Ga0070689_1001344082 | 237 |
| 392 | 3300005344 | Ga0070661_100090559 | Ga0070661_1000905592 | 237 |
| 393 | 3300005347 | Ga0070668_100127627 | Ga0070668_1001276272 | 237 |
| 394 | 3300005353 | Ga0070669_100317792 | Ga0070669_1003177922 | 237 |
| 395 | 3300005354 | Ga0070675_100079695 | Ga0070675_1000796953 | 237 |
| 396 | 3300005355 | Ga0070671_100164765 | Ga0070671_1001647652 | 237 |
| 397 | 3300005356 | Ga0070674_100052947 | Ga0070674_1000529474 | 237 |
| 398 | 3300005364 | Ga0070673_100018739 | Ga0070673_1000187393 | 237 |
| 399 | 3300005364 | Ga0070673_100137793 | Ga0070673_1001377932 | 237 |
| 400 | 3300005366 | Ga0070659_100002666 | Ga0070659_1000026667 | 237 |
| 401 | 3300005367 | Ga0070667_100119940 | Ga0070667_1001199403 | 237 |
| 402 | 3300005367 | Ga0070667_100699570 | Ga0070667_1006995701 | 237 |
| 403 | 3300005440 | Ga0070705_100200943 | Ga0070705_1002009431 | 237 |
| 404 | 3300005455 | Ga0070663_100018203 | Ga0070663_1000182036 | 237 |
| 405 | 3300005456 | Ga0070678_100263519 | Ga0070678_1002635191 | 237 |
| 406 | 3300005458 | Ga0070681_10001100 | Ga0070681_1000110020 | 237 |
| 407 | 3300005459 | Ga0068867_100073676 | Ga0068867_1000736762 | 237 |
| 408 | 3300005459 | Ga0068867_100360599 | Ga0068867_1003605992 | 237 |
| 409 | 3300005466 | Ga0070685_10093924 | Ga0070685_100939241 | 237 |
| 410 | 3300005535 | Ga0070684_100009298 | Ga0070684_1000092987 | 237 |
| 411 | 3300005539 | Ga0068853_100006343 | Ga0068853_1000063435 | 237 |
| 412 | 3300005539 | Ga0068853_100132907 | Ga0068853_1001329071 | 237 |
| 413 | 3300005543 | Ga0070672_100087257 | Ga0070672_1000872574 | 237 |
| 414 | 3300005544 | Ga0070686_100087276 | Ga0070686_1000872762 | 237 |
| 415 | 3300005563 | Ga0068855_100003643 | Ga0068855_10000364320 | 237 |
| 416 | 3300005564 | Ga0070664_100000538 | Ga0070664_10000053813 | 237 |
| 417 | 3300005564 | Ga0070664_100022774 | Ga0070664_1000227744 | 237 |
| 418 | 3300005577 | Ga0068857_100000081 | Ga0068857_1000000814 | 237 |
| 419 | 3300005577 | Ga0068857_100021579 | Ga0068857_1000215796 | 237 |
| 420 | 3300005578 | Ga0068854_100094421 | Ga0068854_1000944212 | 237 |
| 421 | 3300005614 | Ga0068856_100000394 | Ga0068856_10000039418 | 237 |
| 422 | 3300005614 | Ga0068856_100027370 | Ga0068856_1000273705 | 237 |
| 423 | 3300005615 | Ga0070702_100036892 | Ga0070702_1000368922 | 237 |
| 424 | 3300005616 | Ga0068852_100306019 | Ga0068852_1003060192 | 237 |
| 425 | 3300005616 | Ga0068852_100909533 | Ga0068852_1009095331 | 237 |
| 426 | 3300005617 | Ga0068859_100000290 | Ga0068859_10000029043 | 237 |
| 427 | 3300005618 | Ga0068864_100001275 | Ga0068864_10000127512 | 237 |
| 428 | 3300005618 | Ga0068864_100089470 | Ga0068864_1000894702 | 237 |
| 429 | 3300005718 | Ga0068866_10205089 | Ga0068866_102050892 | 237 |
| 430 | 3300005719 | Ga0068861_100277429 | Ga0068861_1002774292 | 237 |
| 431 | 3300005834 | Ga0068851_10026488 | Ga0068851_100264882 | 237 |
| 432 | 3300005841 | Ga0068863_100134013 | Ga0068863_1001340132 | 237 |
| 433 | 3300005842 | Ga0068858_100001619 | Ga0068858_10000161926 | 237 |
| 434 | 3300005842 | Ga0068858_100002791 | Ga0068858_10000279119 | 237 |
| 435 | 3300005842 | Ga0068858_100126941 | Ga0068858_1001269412 | 237 |
| 436 | 3300005843 | Ga0068860_100005894 | Ga0068860_1000058942 | 237 |
| 437 | 3300005843 | Ga0068860_100065442 | Ga0068860_1000654422 | 237 |
| 438 | 3300005843 | Ga0068860_100160110 | Ga0068860_1001601102 | 237 |
| 439 | 3300005844 | Ga0068862_100036273 | Ga0068862_1000362735 | 237 |
| 440 | 3300006028 | Ga0070717_10004359 | Ga0070717_100043594 | 237 |
| 441 | 3300006163 | Ga0070715_10063341 | Ga0070715_100633412 | 237 |
| 442 | 3300006237 | Ga0097621_100004265 | Ga0097621_1000042657 | 237 |
| 443 | 3300006237 | Ga0097621_100159158 | Ga0097621_1001591582 | 237 |
| 444 | 3300006358 | Ga0068871_100007456 | Ga0068871_1000074562 | 237 |
| 445 | 3300006358 | Ga0068871_100185995 | Ga0068871_1001859954 | 237 |
| 446 | 3300006881 | Ga0068865_100008484 | Ga0068865_1000084848 | 237 |
| 447 | 3300006881 | Ga0068865_100186635 | Ga0068865_1001866351 | 237 |
| 448 | 3300006931 | Ga0097620_100000290 | Ga0097620_10000029043 | 237 |
| 449 | 3300009092 | Ga0105250_10028996 | Ga0105250_100289963 | 237 |
| 450 | 3300009098 | Ga0105245_10008495 | Ga0105245_100084952 | 237 |
| 451 | 3300009098 | Ga0105245_10065607 | Ga0105245_100656072 | 237 |
| 452 | 3300009174 | Ga0105241_10117430 | Ga0105241_101174302 | 237 |
| 453 | 3300009174 | Ga0105241_10227097 | Ga0105241_102270972 | 237 |
| 454 | 3300009177 | Ga0105248_10258562 | Ga0105248_102585622 | 237 |
| 455 | 3300009177 | Ga0105248_10382344 | Ga0105248_103823442 | 237 |
| 456 | 3300009545 | Ga0105237_10063189 | Ga0105237_100631892 | 237 |
| 457 | 3300009545 | Ga0105237_10681760 | Ga0105237_106817601 | 237 |
| 458 | 3300009553 | Ga0105249_10107413 | Ga0105249_101074133 | 237 |
| 459 | 3300010375 | Ga0105239_10014364 | Ga0105239_100143644 | 237 |
| 460 | 3300010375 | Ga0105239_10150419 | Ga0105239_101504192 | 237 |
| 461 | 3300011119 | Ga0105246_10011181 | Ga0105246_100111815 | 237 |
| 462 | 3300011119 | Ga0105246_10087410 | Ga0105246_100874102 | 237 |
| 463 | 3300013100 | Ga0157373_10548369 | Ga0157373_105483691 | 237 |
| 464 | 3300013102 | Ga0157371_10098202 | Ga0157371_100982022 | 237 |
| 465 | 3300013296 | Ga0157374_10001435 | Ga0157374_100014352 | 237 |
| 466 | 3300013296 | Ga0157374_10012766 | Ga0157374_100127662 | 237 |
| 467 | 3300013297 | Ga0157378_10000541 | Ga0157378_1000054120 | 237 |
| 468 | 3300013306 | Ga0163162_10004210 | Ga0163162_100042102 | 237 |
| 469 | 3300013307 | Ga0157372_10001168 | Ga0157372_1000116817 | 237 |
| 470 | 3300013307 | Ga0157372_10043120 | Ga0157372_100431205 | 237 |
| 471 | 3300013307 | Ga0157372_10781105 | Ga0157372_107811051 | 237 |
| 472 | 3300013308 | Ga0157375_10078465 | Ga0157375_100784651 | 237 |
| 473 | 3300013308 | Ga0157375_10084316 | Ga0157375_100843162 | 237 |
| 474 | 3300014325 | Ga0163163_10027698 | Ga0163163_100276981 | 237 |
| 475 | 3300014325 | Ga0163163_10210862 | Ga0163163_102108621 | 237 |
| 476 | 3300014326 | Ga0157380_10027507 | Ga0157380_100275076 | 237 |
| 477 | 3300014745 | Ga0157377_10001555 | Ga0157377_100015552 | 237 |
| 478 | 3300014745 | Ga0157377_10120179 | Ga0157377_101201792 | 237 |
| 479 | 3300014968 | Ga0157379_10057448 | Ga0157379_100574482 | 237 |
| 480 | 3300014969 | Ga0157376_10026684 | Ga0157376_100266843 | 237 |
| 481 | 3300017792 | Ga0163161_10008769 | Ga0163161_100087697 | 237 |
| 482 | 3300025315 | Ga0207697_10016188 | Ga0207697_100161882 | 237 |
| 483 | 3300025321 | Ga0207656_10014138 | Ga0207656_100141382 | 237 |
| 484 | 3300025899 | Ga0207642_10114315 | Ga0207642_101143151 | 237 |
| 485 | 3300025899 | Ga0207642_10148907 | Ga0207642_101489072 | 237 |
| 486 | 3300025901 | Ga0207688_10007283 | Ga0207688_100072834 | 237 |
| 487 | 3300025904 | Ga0207647_10002874 | Ga0207647_100028746 | 237 |
| 488 | 3300025904 | Ga0207647_10008899 | Ga0207647_100088995 | 237 |
| 489 | 3300025904 | Ga0207647_10032472 | Ga0207647_100324722 | 237 |
| 490 | 3300025907 | Ga0207645_10007489 | Ga0207645_100074897 | 237 |
| 491 | 3300025908 | Ga0207643_10000639 | Ga0207643_1000063918 | 237 |
| 492 | 3300025911 | Ga0207654_10123476 | Ga0207654_101234762 | 237 |
| 493 | 3300025912 | Ga0207707_10033457 | Ga0207707_100334571 | 237 |
| 494 | 3300025919 | Ga0207657_10001261 | Ga0207657_1000126120 | 237 |
| 495 | 3300025920 | Ga0207649_10001661 | Ga0207649_100016615 | 237 |
| 496 | 3300025920 | Ga0207649_10488438 | Ga0207649_104884382 | 237 |
| 497 | 3300025925 | Ga0207650_10000177 | Ga0207650_100001778 | 237 |
| 498 | 3300025925 | Ga0207650_10017093 | Ga0207650_100170931 | 237 |
| 499 | 3300025926 | Ga0207659_10361037 | Ga0207659_103610372 | 237 |
| 500 | 3300025927 | Ga0207687_10064410 | Ga0207687_100644102 | 237 |
| 501 | 3300025927 | Ga0207687_10067507 | Ga0207687_100675072 | 237 |
| 502 | 3300025931 | Ga0207644_10149614 | Ga0207644_101496142 | 237 |
| 503 | 3300025931 | Ga0207644_10202574 | Ga0207644_102025741 | 237 |
| 504 | 3300025933 | Ga0207706_10019421 | Ga0207706_100194213 | 237 |
| 505 | 3300025936 | Ga0207670_10060919 | Ga0207670_100609192 | 237 |
| 506 | 3300025938 | Ga0207704_10003491 | Ga0207704_100034917 | 237 |
| 507 | 3300025938 | Ga0207704_10019678 | Ga0207704_100196782 | 237 |
| 508 | 3300025940 | Ga0207691_10001447 | Ga0207691_100014476 | 237 |
| 509 | 3300025941 | Ga0207711_10183843 | Ga0207711_101838431 | 237 |
| 510 | 3300025942 | Ga0207689_10000542 | Ga0207689_1000054232 | 237 |
| 511 | 3300025942 | Ga0207689_10002307 | Ga0207689_100023077 | 237 |
| 512 | 3300025944 | Ga0207661_10016213 | Ga0207661_100162138 | 237 |
| 513 | 3300025944 | Ga0207661_10065537 | Ga0207661_100655372 | 237 |
| 514 | 3300025945 | Ga0207679_10000143 | Ga0207679_1000014341 | 237 |
| 515 | 3300025945 | Ga0207679_10021292 | Ga0207679_100212922 | 237 |
| 516 | 3300025949 | Ga0207667_10008691 | Ga0207667_100086912 | 237 |
| 517 | 3300025949 | Ga0207667_10172327 | Ga0207667_101723271 | 237 |
| 518 | 3300025960 | Ga0207651_10030416 | Ga0207651_100304163 | 237 |
| 519 | 3300025960 | Ga0207651_10084353 | Ga0207651_100843531 | 237 |
| 520 | 3300025960 | Ga0207651_10551283 | Ga0207651_105512831 | 237 |
| 521 | 3300025981 | Ga0207640_10078549 | Ga0207640_100785492 | 237 |
| 522 | 3300025986 | Ga0207658_10632976 | Ga0207658_106329761 | 237 |
| 523 | 3300026023 | Ga0207677_10000998 | Ga0207677_1000099812 | 237 |
| 524 | 3300026023 | Ga0207677_10628603 | Ga0207677_106286032 | 237 |
| 525 | 3300026035 | Ga0207703_10006117 | Ga0207703_100061178 | 237 |
| 526 | 3300026035 | Ga0207703_10010977 | Ga0207703_100109775 | 237 |
| 527 | 3300026035 | Ga0207703_10083353 | Ga0207703_100833531 | 237 |
| 528 | 3300026067 | Ga0207678_10001668 | Ga0207678_1000166821 | 237 |
| 529 | 3300026078 | Ga0207702_10003272 | Ga0207702_1000327211 | 237 |
| 530 | 3300026088 | Ga0207641_10003028 | Ga0207641_100030289 | 237 |
| 531 | 3300026088 | Ga0207641_10307463 | Ga0207641_103074632 | 237 |
| 532 | 3300026089 | Ga0207648_10008810 | Ga0207648_100088104 | 237 |
| 533 | 3300026089 | Ga0207648_10019097 | Ga0207648_100190972 | 237 |
| 534 | 3300026095 | Ga0207676_10001159 | Ga0207676_1000115910 | 237 |
| 535 | 3300026095 | Ga0207676_10002377 | Ga0207676_1000237711 | 237 |
| 536 | 3300026116 | Ga0207674_10000195 | Ga0207674_100001958 | 237 |
| 537 | 3300026116 | Ga0207674_10000229 | Ga0207674_1000022919 | 237 |
| 538 | 3300026118 | Ga0207675_100399215 | Ga0207675_1003992152 | 237 |
| 539 | 3300026121 | Ga0207683_10003688 | Ga0207683_100036882 | 237 |
| 540 | 3300026142 | Ga0207698_10271381 | Ga0207698_102713812 | 237 |
| 541 | 3300028381 | Ga0268264_10080074 | Ga0268264_100800742 | 237 |
| 542 | 3300028381 | Ga0268264_10192689 | Ga0268264_101926892 | 237 |
| 543 | 3300028381 | Ga0268264_10346169 | Ga0268264_103461692 | 237 |
| 544 | 3300035691 | Ga0373931_0025417 | Ga0373931_0025417_1839_2552 | 237 |
| 545 | 3300048903 | Ga0496100_0359218 | Ga0496100_0359218_308_1021 | 237 |
| 546 | 3300048904 | Ga0496101_0209200 | Ga0496101_0209200_64_777 | 237 |
| 547 | 3300048905 | Ga0496102_0485209 | Ga0496102_0485209_236_949 | 237 |
| 548 | 3300048911 | Ga0496108_0000689 | Ga0496108_0000689_5056_5769 | 237 |
| 549 | 3300048912 | Ga0496109_0001300 | Ga0496109_0001300_5244_5957 | 237 |
| 550 | 3300048913 | Ga0496110_0008161 | Ga0496110_0008161_5463_6176 | 237 |
| 551 | 3300048914 | Ga0496111_0197289 | Ga0496111_0197289_692_1405 | 237 |
| 552 | 3300048915 | Ga0496112_0006571 | Ga0496112_0006571_3093_3806 | 237 |
| 553 | 3300048915 | Ga0496112_0042724 | Ga0496112_0042724_3418_4131 | 237 |
| 554 | 3300048915 | Ga0496112_0083914 | Ga0496112_0083914_389_1102 | 237 |
| 555 | 3300048916 | Ga0496113_0004283 | Ga0496113_0004283_2741_3454 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r79-assembly3.cif.gz_B | crystal structure of an uncharactertized protein from agrobacterium tumefaciens | 0.9482 | 2 | 231 |
| 5nm8-assembly2.cif.gz_B | structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942, with plp bound | 0.939 | 2 | 229 |
| 6kzw-assembly2.cif.gz_B | crystal structure of yggs family pyridoxal phosphate-dependent enzyme pipy from fusobacterium nucleatum | 0.9364 | 1 | 228 |
| 5nm8-assembly2.cif.gz_B | structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942, with plp bound | 0.9347 | 2 | 229 |
| 7uat-assembly1.cif.gz_A | the crystal structure of the k36a mutant of e. coli yggs in complex with plp | 0.9345 | 2 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5nm8B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.939 | 2 | 229 | 3.20.20.10 |
| 5nm8B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9347 | 2 | 229 | 3.20.20.10 |
| 1w8gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9339 | 2 | 230 | 3.20.20.10 |
| 1w8gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.93 | 2 | 230 | 3.20.20.10 |
| 3r79B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9227 | 2 | 231 | 3.20.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9ZR95-F1-model_v4 | YggS family pyridoxal phosphate-dependent enzyme | 0.9911 | 1 | 229 |
GO:0030170
|
| AF-A0A2V9T6E7-F1-model_v4 | YggS family pyridoxal phosphate-dependent enzyme | 0.9883 | 42 | 231 |
GO:0030170
|
| AF-A0A2V9ZR95-F1-model_v4 | YggS family pyridoxal phosphate-dependent enzyme | 0.9869 | 1 | 229 |
GO:0030170
|
| AF-A0A2V9YRX8-F1-model_v4 | Alanine racemase N-terminal domain-containing protein | 0.9833 | 106 | 231 |
GO:0030170
|
| AF-A0A7C5MDQ5-F1-model_v4 | Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) | 0.9778 | 3 | 232 |
GO:0030170
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar