F463133

General Info

Members Datasets Scaffolds Average Seq Length
555 250 1110 340

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0009577|Ga0439449_0009577_27_1247
Length 406
Sequence MERPENKIEGRITSPSIGYLMPSLSGTPPLNLRFQITNLYNYLSLMNGPSSFWQTTWKRLRKNKGAVAGLVVISLAMFTALFGYLFAPDPSPFANRIILEIGGQKPGFQQTFILVKKVIQPQQPGFIKQLMQGKPDQYEYIPIVSWQAEGDSLIVQKYIDEGLSERMSFILSTLASEPVVRKTFLLGTDKFGRDILSRLIIGTRVSLSVGFITVIISLTVGIFLGAVGGYFGGKTDELVMWLVNVIWSIPTLLLVFAVTLLLGKGFWQVFIAVGLTMWVSVARLVRGQVLVTKELQYIEAARALGFSPGRIILKHILPNILGPILVIAASNFASAIIIEAGLSFLGIGVQPPRPSWGLMIKENYNFIITQNPMLALAPGFAIMLLVLAFNLMGNGLRDALSVRSKL

Samples

Sample ID Description Type Environment
1 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
175 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
176 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
177 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
229 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
230 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
241 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
242 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
245 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
246 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 2818991444 Filimonas endophytica 3197 Isolate Unclassified
250 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.05
Nodule 0
Rhizoplane 0.54
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 12.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439449_0009577 3300042007 Bacteria 3668
2 JGI24740J21852_10007622 3300001979 Bacteria 4385
3 JGI24739J22299_10005191 3300001989 Bacteria 4964
4 JGI25406J46586_10001107 3300003203 Bacteria 12630
5 rootH2_10153927 3300003320 Bacteria 3538
6 rootH2_10157843 3300003320 Bacteria 4210
7 rootL2_10088716 3300003322 Bacteria 7091
8 rootL2_10250360 3300003322 Bacteria 3835
9 rootL2_10260837 3300003322 Bacteria 2145
10 rootH1_10010306 3300003323 Bacteria 26486
11 rootH1_10091716 3300003323 Bacteria 2337
12 JGI25160J50197_1005658 3300003354 Bacteria 5167
13 JGI25160J50197_1011008 3300003354 Bacteria 3237
14 Ga0055526_1032041 3300003771 Bacteria 1492
15 Ga0055528_1000060 3300003790 Bacteria 87471
16 Ga0055530_10000378 3300003791 Bacteria 40399
17 Ga0055543_1004307 3300004625 Bacteria 3913
18 Ga0070658_10030524 3300005327 Bacteria 4330
19 Ga0070676_10006487 3300005328 Bacteria 6252
20 Ga0070676_10010162 3300005328 Bacteria 5102
21 Ga0070676_10033667 3300005328 Bacteria 2940
22 Ga0070676_10048550 3300005328 Bacteria 2482
23 Ga0070676_10059953 3300005328 Bacteria 2258
24 Ga0070683_100010607 3300005329 Bacteria 7920
25 Ga0070683_100026609 3300005329 Bacteria 5211
26 Ga0070690_100003099 3300005330 Bacteria 9044
27 Ga0070670_100023427 3300005331 Bacteria 5314
28 Ga0070670_100131175 3300005331 Bacteria 2164
29 Ga0070670_100152846 3300005331 Bacteria 1998
30 Ga0070677_10024295 3300005333 Bacteria 2252
31 Ga0068869_100003697 3300005334 Bacteria 9411
32 Ga0068869_100020688 3300005334 Bacteria 4517
33 Ga0068869_100055233 3300005334 Bacteria 2894
34 Ga0070666_10000055 3300005335 Bacteria 92269
35 Ga0070666_10004569 3300005335 Bacteria 8439
36 Ga0070666_10085168 3300005335 Unclassified 2164
37 Ga0070680_100129435 3300005336 Unclassified 2111
38 Ga0070682_100000041 3300005337 Bacteria 142152
39 Ga0070682_100048406 3300005337 Bacteria 2646
40 Ga0068868_100015969 3300005338 Bacteria 5567
41 Ga0068868_100159761 3300005338 Unclassified 1860
42 Ga0068868_100168668 3300005338 Unclassified 1811
43 Ga0070660_100025464 3300005339 Unclassified 4397
44 Ga0070689_100081008 3300005340 Bacteria 2548
45 Ga0070687_100003360 3300005343 Bacteria 6198
46 Ga0070661_100030797 3300005344 Bacteria 3877
47 Ga0070668_100128667 3300005347 Bacteria 2030
48 Ga0070669_100043278 3300005353 Bacteria 3279
49 Ga0070675_100224150 3300005354 Unclassified 1638
50 Ga0070671_100092547 3300005355 Bacteria 2533
51 Ga0070674_100008425 3300005356 Bacteria 6140
52 Ga0070674_100088627 3300005356 Bacteria 2227
53 Ga0070674_100134857 3300005356 Unclassified 1845
54 Ga0070673_100026010 3300005364 Bacteria 4316
55 Ga0070673_100027929 3300005364 Bacteria 4190
56 Ga0070673_100031933 3300005364 Bacteria 3958
57 Ga0070673_100043636 3300005364 Bacteria 3466
58 Ga0070673_100092688 3300005364 Bacteria 2472
59 Ga0070673_100128902 3300005364 Bacteria 2120
60 Ga0070673_100415274 3300005364 Bacteria 1205
61 Ga0070688_100076382 3300005365 Bacteria 2155
62 Ga0070659_100243248 3300005366 Unclassified 1490
63 Ga0070667_100005019 3300005367 Bacteria 11075
64 Ga0070667_100013370 3300005367 Bacteria 6785
65 Ga0070667_100019186 3300005367 Bacteria 5670
66 Ga0070667_100024969 3300005367 Bacteria 4965
67 Ga0070667_100117229 3300005367 Bacteria 2313
68 Ga0070667_100135444 3300005367 Bacteria 2153
69 Ga0070667_100342979 3300005367 Unclassified 1351
70 Ga0070700_100083413 3300005441 Bacteria 2069
71 Ga0070678_100035659 3300005456 Bacteria 3475
72 Ga0070662_100012145 3300005457 Bacteria 5703
73 Ga0070662_100038343 3300005457 Unclassified 3404
74 Ga0070681_10040676 3300005458 Unclassified 4657
75 Ga0068867_100017424 3300005459 Bacteria 5103
76 Ga0068867_100021654 3300005459 Bacteria 4588
77 Ga0068867_100025016 3300005459 Bacteria 4281
78 Ga0068867_100209978 3300005459 Bacteria 1563
79 Ga0070685_10003458 3300005466 Bacteria 8029
80 Ga0070685_10010448 3300005466 Bacteria 4825
81 Ga0070685_10019950 3300005466 Bacteria 3624
82 Ga0070698_100005877 3300005471 Bacteria 13398
83 Ga0070698_100012587 3300005471 Bacteria 8958
84 Ga0070698_100016585 3300005471 Bacteria 7775
85 Ga0070698_100093247 3300005471 Bacteria 2991
86 Ga0070679_100037839 3300005530 Bacteria 4794
87 Ga0070684_100027800 3300005535 Unclassified 4777
88 Ga0068853_100000595 3300005539 Bacteria 24814
89 Ga0068853_100010504 3300005539 Bacteria 7487
90 Ga0068853_100040345 3300005539 Unclassified 3983
91 Ga0068853_100070809 3300005539 Bacteria 3036
92 Ga0068853_100089270 3300005539 Bacteria 2707
93 Ga0068853_100112970 3300005539 Unclassified 2414
94 Ga0068853_100116708 3300005539 Bacteria 2377
95 Ga0068853_100132520 3300005539 Unclassified 2232
96 Ga0068853_100138667 3300005539 Bacteria 2182
97 Ga0068853_100235583 3300005539 Bacteria 1676
98 Ga0070672_100040962 3300005543 Unclassified 3558
99 Ga0070672_100043080 3300005543 Bacteria 3478
100 Ga0070672_100082040 3300005543 Bacteria 2586
101 Ga0070672_100092260 3300005543 Bacteria 2445
102 Ga0070672_100268351 3300005543 Bacteria 1440
103 Ga0070686_100012522 3300005544 Bacteria 4833
104 Ga0070696_100306107 3300005546 Unclassified 1219
105 Ga0070665_100000014 3300005548 Bacteria 484881
106 Ga0070665_100019007 3300005548 Bacteria 6892
107 Ga0070704_100202317 3300005549 Unclassified 1604
108 Ga0068855_100009267 3300005563 Bacteria 11893
109 Ga0068855_100034302 3300005563 Bacteria 6054
110 Ga0068855_100074195 3300005563 Bacteria 3951
111 Ga0068855_100087415 3300005563 Bacteria 3603
112 Ga0068855_100190250 3300005563 Unclassified 2315
113 Ga0070664_100009648 3300005564 Bacteria 7831
114 Ga0070664_100213544 3300005564 Bacteria 1725
115 Ga0068857_100037368 3300005577 Bacteria 4301
116 Ga0068857_100038645 3300005577 Unclassified 4226
117 Ga0068857_100093965 3300005577 Bacteria 2685
118 Ga0068854_100016725 3300005578 Bacteria 4894
119 Ga0068854_100157071 3300005578 Unclassified 1758
120 Ga0068854_100212374 3300005578 Bacteria 1527
121 Ga0068856_100029902 3300005614 Bacteria 5323
122 Ga0068856_100047645 3300005614 Bacteria 4223
123 Ga0068852_100003367 3300005616 Bacteria 11159
124 Ga0068852_100003929 3300005616 Bacteria 10444
125 Ga0068852_100004742 3300005616 Bacteria 9652
126 Ga0068852_100144813 3300005616 Bacteria 2203
127 Ga0068859_100000003 3300005617 Bacteria 479218
128 Ga0068859_100001878 3300005617 Bacteria 21383
129 Ga0068859_100016964 3300005617 Bacteria 7309
130 Ga0068859_100049549 3300005617 Bacteria 4218
131 Ga0068859_100262777 3300005617 Bacteria 1817
132 Ga0068859_100400415 3300005617 Bacteria 1469
133 Ga0068864_100005880 3300005618 Bacteria 10053
134 Ga0068864_100033275 3300005618 Bacteria 4382
135 Ga0068864_100457911 3300005618 Bacteria 1221
136 Ga0068866_10012497 3300005718 Bacteria 3700
137 Ga0068861_100112292 3300005719 Bacteria 2185
138 Ga0068851_10004654 3300005834 Bacteria 6194
139 Ga0068870_10054329 3300005840 Unclassified 2130
140 Ga0068870_10134867 3300005840 Bacteria 1438
141 Ga0068863_100004065 3300005841 Bacteria 14447
142 Ga0068863_100006876 3300005841 Bacteria 11145
143 Ga0068863_100079031 3300005841 Bacteria 3115
144 Ga0068863_100156181 3300005841 Bacteria 2184
145 Ga0068863_100188510 3300005841 Bacteria 1982
146 Ga0068863_100205976 3300005841 Bacteria 1893
147 Ga0068863_100273236 3300005841 Bacteria 1636
148 Ga0068863_100392044 3300005841 Bacteria 1357
149 Ga0068858_100005095 3300005842 Bacteria 12876
150 Ga0068858_100032938 3300005842 Bacteria 4812
151 Ga0068858_100058456 3300005842 Bacteria 3565
152 Ga0068860_100000024 3300005843 Bacteria 271902
153 Ga0068860_100000691 3300005843 Bacteria 38802
154 Ga0068860_100001083 3300005843 Bacteria 30039
155 Ga0068860_100010599 3300005843 Bacteria 9103
156 Ga0068860_100010971 3300005843 Bacteria 8932
157 Ga0068860_100027949 3300005843 Bacteria 5432
158 Ga0068860_100031366 3300005843 Bacteria 5108
159 Ga0068860_100161926 3300005843 Bacteria 2158
160 Ga0068860_100409985 3300005843 Unclassified 1342
161 Ga0068862_100125972 3300005844 Bacteria 2261
162 Ga0068862_100150637 3300005844 Bacteria 2070
163 Ga0081540_1006450 3300005983 Bacteria 8540
164 Ga0081539_10033535 3300005985 Bacteria 3124
165 Ga0075366_10078426 3300006195 Bacteria 1971
166 Ga0097621_100010257 3300006237 Bacteria 6844
167 Ga0097621_100059914 3300006237 Bacteria 3118
168 Ga0097621_100075408 3300006237 Unclassified 2796
169 Ga0097621_100101113 3300006237 Bacteria 2426
170 Ga0097621_100225131 3300006237 Bacteria 1635
171 Ga0097621_100232522 3300006237 Bacteria 1610
172 Ga0075370_10061243 3300006353 Bacteria 2144
173 Ga0068871_100015533 3300006358 Bacteria 5703
174 Ga0068871_100056393 3300006358 Bacteria 3194
175 Ga0068871_100176318 3300006358 Bacteria 1835
176 Ga0068871_100263895 3300006358 Bacteria 1503
177 Ga0068871_100275702 3300006358 Unclassified 1470
178 Ga0068871_100303091 3300006358 Bacteria 1403
179 Ga0075428_100000528 3300006844 Bacteria 38898
180 Ga0075428_100202156 3300006844 Bacteria 2147
181 Ga0068865_100010251 3300006881 Bacteria 5828
182 Ga0068865_100032955 3300006881 Bacteria 3466
183 Ga0068865_100212409 3300006881 Unclassified 1509
184 Ga0097620_100000003 3300006931 Bacteria 479218
185 Ga0097620_100001878 3300006931 Bacteria 21383
186 Ga0097620_100016964 3300006931 Bacteria 7309
187 Ga0097620_100049547 3300006931 Bacteria 4218
188 Ga0097620_100262781 3300006931 Bacteria 1817
189 Ga0097620_100400405 3300006931 Bacteria 1469
190 Ga0105240_10000106 3300009093 Bacteria 171825
191 Ga0105240_10000895 3300009093 Bacteria 53295
192 Ga0105240_10002904 3300009093 Bacteria 27043
193 Ga0105240_10004054 3300009093 Bacteria 22536
194 Ga0105240_10006297 3300009093 Bacteria 17467
195 Ga0105240_10006529 3300009093 Bacteria 17125
196 Ga0105240_10042709 3300009093 Bacteria 5775
197 Ga0105240_10059025 3300009093 Bacteria 4789
198 Ga0105240_10167903 3300009093 Bacteria 2601
199 Ga0111539_10034712 3300009094 Bacteria 6111
200 Ga0111539_10455718 3300009094 Bacteria 1489
201 Ga0105247_10005675 3300009101 Bacteria 7821
202 Ga0114129_10001087 3300009147 Bacteria 35667
203 Ga0105243_10244684 3300009148 Bacteria 1598
204 Ga0105241_10000333 3300009174 Bacteria 35848
205 Ga0105241_10006665 3300009174 Bacteria 8498
206 Ga0105242_10046108 3300009176 Bacteria 3536
207 Ga0105237_10000561 3300009545 Bacteria 51951
208 Ga0105237_10001918 3300009545 Bacteria 26563
209 Ga0105237_10002430 3300009545 Bacteria 23126
210 Ga0105237_10008942 3300009545 Bacteria 10785
211 Ga0105237_10014100 3300009545 Bacteria 8362
212 Ga0105237_10018452 3300009545 Bacteria 7219
213 Ga0105237_10098083 3300009545 Bacteria 2921
214 Ga0105237_10099104 3300009545 Bacteria 2906
215 Ga0105237_10156915 3300009545 Bacteria 2273
216 Ga0105238_10001211 3300009551 Bacteria 25984
217 Ga0105238_10036147 3300009551 Bacteria 5020
218 Ga0105238_10135965 3300009551 Bacteria 2435
219 Ga0105249_10006125 3300009553 Bacteria 10434
220 Ga0105249_10007649 3300009553 Bacteria 9420
221 Ga0105249_10041123 3300009553 Bacteria 4201
222 Ga0105249_10054386 3300009553 Bacteria 3661
223 Ga0105249_10056662 3300009553 Bacteria 3588
224 Ga0105249_10175988 3300009553 Bacteria 2078
225 Ga0105249_10217021 3300009553 Bacteria 1880
226 Ga0105239_10000580 3300010375 Bacteria 52245
227 Ga0105239_10003763 3300010375 Bacteria 18449
228 Ga0105239_10015245 3300010375 Bacteria 8516
229 Ga0105239_10031587 3300010375 Bacteria 5822
230 Ga0105239_10069729 3300010375 Bacteria 3862
231 Ga0105239_10150909 3300010375 Bacteria 2593
232 Ga0105239_10182175 3300010375 Bacteria 2350
233 Ga0105246_10017063 3300011119 Bacteria 4610
234 Ga0105246_10049725 3300011119 Bacteria 2872
235 Ga0157373_10027854 3300013100 Bacteria 4076
236 Ga0157373_10036914 3300013100 Bacteria 3505
237 Ga0157371_10019638 3300013102 Bacteria 4978
238 Ga0157371_10169602 3300013102 Unclassified 1559
239 Ga0157370_10004404 3300013104 Bacteria 16158
240 Ga0157369_10047185 3300013105 Bacteria 4678
241 Ga0157374_10000011 3300013296 Bacteria 466749
242 Ga0157374_10004638 3300013296 Bacteria 11530
243 Ga0157374_10033206 3300013296 Bacteria 4707
244 Ga0157374_10070119 3300013296 Unclassified 3302
245 Ga0157374_10157436 3300013296 Bacteria 2211
246 Ga0157374_10285030 3300013296 Bacteria 1631
247 Ga0157378_10007622 3300013297 Bacteria 9448
248 Ga0157378_10012126 3300013297 Bacteria 7549
249 Ga0157378_10030079 3300013297 Bacteria 4798
250 Ga0157378_10038433 3300013297 Unclassified 4242
251 Ga0157378_10069590 3300013297 Bacteria 3157
252 Ga0157378_10134653 3300013297 Bacteria 2290
253 Ga0163162_10000612 3300013306 Bacteria 33144
254 Ga0163162_10007231 3300013306 Bacteria 10776
255 Ga0163162_10009116 3300013306 Bacteria 9647
256 Ga0163162_10027673 3300013306 Bacteria 5608
257 Ga0163162_10063273 3300013306 Bacteria 3742
258 Ga0163162_10082776 3300013306 Bacteria 3281
259 Ga0163162_10104804 3300013306 Bacteria 2922
260 Ga0163162_10266747 3300013306 Bacteria 1843
261 Ga0157372_10000171 3300013307 Bacteria 71956
262 Ga0157372_10004704 3300013307 Bacteria 14497
263 Ga0157372_10046427 3300013307 Bacteria 4822
264 Ga0157372_10094322 3300013307 Bacteria 3408
265 Ga0157372_10345234 3300013307 Bacteria 1734
266 Ga0157372_10417014 3300013307 Bacteria 1564
267 Ga0157372_10506995 3300013307 Unclassified 1407
268 Ga0157375_10054957 3300013308 Bacteria 3924
269 Ga0157375_10067613 3300013308 Bacteria 3571
270 Ga0157375_10076477 3300013308 Bacteria 3374
271 Ga0157375_10090619 3300013308 Bacteria 3117
272 Ga0157375_10109548 3300013308 Bacteria 2858
273 Ga0157375_10302491 3300013308 Bacteria 1763
274 Ga0163163_10068512 3300014325 Unclassified 3531
275 Ga0163163_10130029 3300014325 Bacteria 2558
276 Ga0157380_10001258 3300014326 Bacteria 16460
277 Ga0157380_10011994 3300014326 Bacteria 6272
278 Ga0157380_10048233 3300014326 Bacteria 3353
279 Ga0157380_10058664 3300014326 Bacteria 3069
280 Ga0157380_10203437 3300014326 Bacteria 1758
281 Ga0157380_10286114 3300014326 Unclassified 1511
282 Ga0157377_10033210 3300014745 Unclassified 2815
283 Ga0157377_10061691 3300014745 Bacteria 2143
284 Ga0157377_10074208 3300014745 Bacteria 1973
285 Ga0157379_10066239 3300014968 Bacteria 3229
286 Ga0157379_10127216 3300014968 Bacteria 2293
287 Ga0157379_10199350 3300014968 Bacteria 1810
288 Ga0157376_10020146 3300014969 Bacteria 5154
289 Ga0157376_10031329 3300014969 Bacteria 4256
290 Ga0157376_10033480 3300014969 Bacteria 4138
291 Ga0157376_10065020 3300014969 Bacteria 3078
292 Ga0163161_10012726 3300017792 Bacteria 5844
293 Ga0163161_10063450 3300017792 Bacteria 2693
294 Ga0209673_1000258 3300025273 Bacteria 100207
295 Ga0209564_1008584 3300025295 Bacteria 5017
296 Ga0209564_1035408 3300025295 Bacteria 1446
297 Ga0209758_1010462 3300025297 Bacteria 5546
298 Ga0209758_1016212 3300025297 Bacteria 3799
299 Ga0209050_1001018 3300025298 Bacteria 34976
300 Ga0207426_1000040 3300025302 Bacteria 433920
301 Ga0207426_1000916 3300025302 Bacteria 29477
302 Ga0207697_10055171 3300025315 Unclassified 1647
303 Ga0207710_10017508 3300025900 Bacteria 3040
304 Ga0207688_10020363 3300025901 Bacteria 3621
305 Ga0207680_10001322 3300025903 Bacteria 11693
306 Ga0207680_10005910 3300025903 Bacteria 5878
307 Ga0207680_10078072 3300025903 Unclassified 2073
308 Ga0207647_10009941 3300025904 Bacteria 6738
309 Ga0207647_10085150 3300025904 Bacteria 1891
310 Ga0207645_10000193 3300025907 Bacteria 49552
311 Ga0207645_10003937 3300025907 Bacteria 11090
312 Ga0207643_10090611 3300025908 Unclassified 1782
313 Ga0207705_10034144 3300025909 Bacteria 3636
314 Ga0207654_10000560 3300025911 Bacteria 21041
315 Ga0207654_10090306 3300025911 Bacteria 1866
316 Ga0207707_10261963 3300025912 Unclassified 1500
317 Ga0207695_10000087 3300025913 Bacteria 276412
318 Ga0207695_10000522 3300025913 Bacteria 81461
319 Ga0207695_10000582 3300025913 Bacteria 74405
320 Ga0207695_10000909 3300025913 Bacteria 53303
321 Ga0207695_10106289 3300025913 Unclassified 2793
322 Ga0207695_10179338 3300025913 Unclassified 2039
323 Ga0207671_10002341 3300025914 Bacteria 20437
324 Ga0207671_10004140 3300025914 Bacteria 14026
325 Ga0207671_10024076 3300025914 Bacteria 4582
326 Ga0207671_10030798 3300025914 Bacteria 3999
327 Ga0207671_10046649 3300025914 Bacteria 3206
328 Ga0207671_10059635 3300025914 Bacteria 2830
329 Ga0207671_10125927 3300025914 Bacteria 1962
330 Ga0207660_10143611 3300025917 Unclassified 1827
331 Ga0207662_10006841 3300025918 Bacteria 6173
332 Ga0207657_10002165 3300025919 Bacteria 21284
333 Ga0207646_10336890 3300025922 Unclassified 1363
334 Ga0207681_10035003 3300025923 Bacteria 3307
335 Ga0207694_10094427 3300025924 Bacteria 2363
336 Ga0207650_10245861 3300025925 Bacteria 1447
337 Ga0207659_10110056 3300025926 Unclassified 2093
338 Ga0207644_10076344 3300025931 Bacteria 2465
339 Ga0207644_10088369 3300025931 Unclassified 2305
340 Ga0207644_10095299 3300025931 Unclassified 2225
341 Ga0207706_10003305 3300025933 Bacteria 15441
342 Ga0207706_10005451 3300025933 Bacteria 11857
343 Ga0207686_10000977 3300025934 Bacteria 17010
344 Ga0207686_10026282 3300025934 Bacteria 3395
345 Ga0207670_10007292 3300025936 Bacteria 6157
346 Ga0207669_10002991 3300025937 Bacteria 7272
347 Ga0207669_10110551 3300025937 Bacteria 1841
348 Ga0207704_10046554 3300025938 Bacteria 2586
349 Ga0207704_10168099 3300025938 Bacteria 1569
350 Ga0207691_10001141 3300025940 Bacteria 26346
351 Ga0207691_10016933 3300025940 Bacteria 6916
352 Ga0207691_10068462 3300025940 Bacteria 3207
353 Ga0207691_10133767 3300025940 Unclassified 2189
354 Ga0207689_10004338 3300025942 Bacteria 12918
355 Ga0207689_10008230 3300025942 Bacteria 9087
356 Ga0207689_10009258 3300025942 Bacteria 8517
357 Ga0207689_10009429 3300025942 Bacteria 8430
358 Ga0207689_10039783 3300025942 Bacteria 3892
359 Ga0207689_10096102 3300025942 Bacteria 2434
360 Ga0207661_10007387 3300025944 Bacteria 7819
361 Ga0207679_10014606 3300025945 Bacteria 5166
362 Ga0207667_10000584 3300025949 Bacteria 47412
363 Ga0207667_10003743 3300025949 Bacteria 18757
364 Ga0207651_10003386 3300025960 Bacteria 7828
365 Ga0207651_10247192 3300025960 Unclassified 1457
366 Ga0207651_10274514 3300025960 Bacteria 1390
367 Ga0207712_10001111 3300025961 Bacteria 18799
368 Ga0207712_10003616 3300025961 Bacteria 9750
369 Ga0207712_10020217 3300025961 Bacteria 4358
370 Ga0207668_10000514 3300025972 Bacteria 24251
371 Ga0207668_10090546 3300025972 Unclassified 2246
372 Ga0207640_10083103 3300025981 Unclassified 2195
373 Ga0207640_10091877 3300025981 Bacteria 2104
374 Ga0207640_10191236 3300025981 Bacteria 1543
375 Ga0207658_10007630 3300025986 Bacteria 7367
376 Ga0207658_10083641 3300025986 Unclassified 2454
377 Ga0207658_10167609 3300025986 Bacteria 1806
378 Ga0207658_10217215 3300025986 Bacteria 1606
379 Ga0207658_10432471 3300025986 Bacteria 1162
380 Ga0207677_10057237 3300026023 Bacteria 2676
381 Ga0207677_10062503 3300026023 Bacteria 2583
382 Ga0207677_10068700 3300026023 Unclassified 2488
383 Ga0207677_10080875 3300026023 Unclassified 2329
384 Ga0207703_10004431 3300026035 Bacteria 11534
385 Ga0207703_10006541 3300026035 Bacteria 9294
386 Ga0207703_10201342 3300026035 Bacteria 1769
387 Ga0207639_10040260 3300026041 Bacteria 3487
388 Ga0207639_10150323 3300026041 Unclassified 1950
389 Ga0207639_10246398 3300026041 Bacteria 1556
390 Ga0207639_10369630 3300026041 Bacteria 1285
391 Ga0207708_10071529 3300026075 Bacteria 2657
392 Ga0207708_10271935 3300026075 Unclassified 1371
393 Ga0207708_10385751 3300026075 Unclassified 1156
394 Ga0207702_10064704 3300026078 Bacteria 3130
395 Ga0207641_10000026 3300026088 Bacteria 245091
396 Ga0207641_10000318 3300026088 Bacteria 59432
397 Ga0207641_10012887 3300026088 Bacteria 6859
398 Ga0207641_10017491 3300026088 Bacteria 5869
399 Ga0207641_10035371 3300026088 Bacteria 4161
400 Ga0207641_10231771 3300026088 Bacteria 1716
401 Ga0207641_10436344 3300026088 Bacteria 1263
402 Ga0207648_10000914 3300026089 Bacteria 33242
403 Ga0207648_10032681 3300026089 Bacteria 4592
404 Ga0207648_10062843 3300026089 Bacteria 3237
405 Ga0207648_10190090 3300026089 Unclassified 1819
406 Ga0207648_10237059 3300026089 Bacteria 1624
407 Ga0207648_10387667 3300026089 Bacteria 1264
408 Ga0207676_10024459 3300026095 Bacteria 4468
409 Ga0207676_10030721 3300026095 Bacteria 4035
410 Ga0207676_10043230 3300026095 Unclassified 3468
411 Ga0207676_10170169 3300026095 Bacteria 1897
412 Ga0207674_10009967 3300026116 Bacteria 10811
413 Ga0207674_10047052 3300026116 Bacteria 4425
414 Ga0207675_100018920 3300026118 Bacteria 6429
415 Ga0207675_100019544 3300026118 Bacteria 6323
416 Ga0207675_100040792 3300026118 Bacteria 4335
417 Ga0207675_100063356 3300026118 Bacteria 3454
418 Ga0207675_100100592 3300026118 Bacteria 2723
419 Ga0207683_10015050 3300026121 Bacteria 6584
420 Ga0207683_10231661 3300026121 Unclassified 1685
421 Ga0207698_10002724 3300026142 Bacteria 10521
422 Ga0207698_10051408 3300026142 Bacteria 3151
423 Ga0207698_10056007 3300026142 Unclassified 3042
424 Ga0207698_10056268 3300026142 Bacteria 3036
425 Ga0268266_10000048 3300028379 Bacteria 310336
426 Ga0268266_10008503 3300028379 Bacteria 9122
427 Ga0268266_10104142 3300028379 Bacteria 2505
428 Ga0268265_10037171 3300028380 Bacteria 3572
429 Ga0268265_10303811 3300028380 Bacteria 1438
430 Ga0268264_10000028 3300028381 Bacteria 426662
431 Ga0268264_10000558 3300028381 Bacteria 45913
432 Ga0268264_10007750 3300028381 Bacteria 8939
433 Ga0268264_10014547 3300028381 Bacteria 6464
434 Ga0268264_10022172 3300028381 Bacteria 5184
435 Ga0268264_10312312 3300028381 Bacteria 1483
436 Ga0307517_10123252 3300028786 Bacteria 1905
437 Ga0307515_10000001 3300028794 Bacteria 4259510
438 Ga0307515_10001257 3300028794 Bacteria 57814
439 Ga0307511_10000076 3300030521 Bacteria 82520
440 Ga0265327_10000013 3300031251 Bacteria 519549
441 Ga0265327_10000115 3300031251 Bacteria 173854
442 Ga0307513_10046889 3300031456 Bacteria 4706
443 Ga0307509_10029821 3300031507 Bacteria 6047
444 Ga0307508_10000111 3300031616 Bacteria 96733
445 Ga0307516_10000159 3300031730 Bacteria 84553
446 Ga0307414_10076775 3300032004 Bacteria 2429
447 Ga0307507_10113778 3300033179 Unclassified 2197
448 Ga0307510_10000949 3300033180 Bacteria 30604
449 Ga0373927_0020503 3300035695 Bacteria 4336
450 Ga0373937_0211741 3300036401 Bacteria 1824
451 Ga0373937_0214647 3300036401 Bacteria 1811
452 Ga0373937_0260314 3300036401 Bacteria 1636
453 Ga0436363_0220785 3300039450 Bacteria 1324
454 Ga0439436_0001213 3300041404 Bacteria 7335
455 Ga0439436_0026910 3300041404 Bacteria 1684
456 Ga0439439_0002695 3300041406 Bacteria 3810
457 Ga0451802_1059356 3300041460 Bacteria 1926
458 Ga0451841_1359142 3300041498 Bacteria 1198
459 Ga0451853_0782917 3300041512 Bacteria 1550
460 Ga0439445_0019312 3300042004 Bacteria 1698
461 Ga0439449_0007699 3300042007 Bacteria 4089
462 Ga0439457_001516 3300042014 Bacteria 6969
463 Ga0439457_012653 3300042014 Bacteria 1900
464 Ga0451577_0104217 3300042876 Unclassified 2535
465 Ga0466972_0000049 3300044658 Bacteria 118829
466 Ga0466972_0000057 3300044658 Bacteria 110775
467 Ga0466972_0000901 3300044658 Bacteria 14287
468 Ga0466972_0017565 3300044658 Bacteria 3581
469 Ga0466965_0029525 3300044683 Bacteria 2669
470 Ga0466965_0036341 3300044683 Unclassified 2417
471 Ga0466965_0060052 3300044683 Bacteria 1899
472 Ga0453684_0049686 3300044712 Bacteria 5527
473 Ga0453684_0140637 3300044712 Bacteria 2883
474 Ga0466968_0132032 3300044735 Bacteria 1137
475 Ga0466970_0000465 3300044765 Bacteria 20048
476 Ga0466957_0000101 3300044842 Bacteria 34646
477 Ga0466957_0246763 3300044842 Bacteria 1186
478 Ga0466959_0005634 3300045049 Bacteria 8614
479 Ga0466958_0034594 3300045836 Bacteria 3015
480 Ga0466967_0261141 3300045976 Bacteria 1657
481 Ga0495627_037979 3300046453 Unclassified 1491
482 Ga0495651_0206470 3300046462 Bacteria 1371
483 Ga0495650_0006071 3300046471 Bacteria 7626
484 Ga0495630_0074091 3300046517 Bacteria 2564
485 Ga0495630_0122687 3300046517 Bacteria 1971
486 Ga0495621_0005864 3300046539 Bacteria 3558
487 Ga0495633_0000089 3300046558 Bacteria 123616
488 Ga0495668_0000023 3300046616 Bacteria 363848
489 Ga0495668_0002514 3300046616 Bacteria 14989
490 Ga0495611_0000669 3300046648 Bacteria 19528
491 Ga0495611_0087910 3300046648 Bacteria 1434
492 Ga0495625_0046749 3300046660 Bacteria 3122
493 Ga0495647_0085545 3300046681 Bacteria 1285
494 Ga0495658_0066493 3300046683 Bacteria 2082
495 Ga0495649_0024726 3300046694 Bacteria 3349
496 Ga0495672_0119624 3300047320 Unclassified 1402
497 Ga0495672_0147009 3300047320 Bacteria 1225
498 Ga0495687_000429 3300047443 Bacteria 51940
499 Ga0495686_0000005 3300047472 Bacteria 827143
500 Ga0495686_0071517 3300047472 Bacteria 2135
501 Ga0496109_0220929 3300048912 Unclassified 1782
502 Ga0496115_0109968 3300048918 Bacteria 2264
503 Ga0501031_0002497 3300049568 Bacteria 11722
504 Ga0501034_0019990 3300049571 Bacteria 6838
505 Ga0501036_0002439 3300049572 Bacteria 14561
506 Ga0501036_0008374 3300049572 Bacteria 8475
507 Ga0501037_0003269 3300049573 Bacteria 11765
508 Ga0501037_0037210 3300049573 Bacteria 3587
509 Ga0501038_0009021 3300049574 Bacteria 9152
510 Ga0501039_0010018 3300049575 Bacteria 7228
511 Ga0501042_0113170 3300049578 Unclassified 1954
512 Ga0501043_0026166 3300049579 Bacteria 4577
513 Ga0501043_0307318 3300049579 Bacteria 1211
514 Ga0501046_0022150 3300049580 Bacteria 5236
515 Ga0501047_0007060 3300049581 Bacteria 10547
516 Ga0501047_0051111 3300049581 Bacteria 3992
517 Ga0501048_0046772 3300049582 Unclassified 3089
518 Ga0501068_0085057 3300049584 Unclassified 1946
519 Ga0501070_0008420 3300049586 Bacteria 8711
520 Ga0501073_0004719 3300049589 Bacteria 10240
521 Ga0501073_0174416 3300049589 Bacteria 1488
522 Ga0501074_0002102 3300049590 Bacteria 13745
523 Ga0501219_000115 3300049703 Bacteria 14190
524 Ga0501225_0002813 3300049705 Bacteria 5346
525 Ga0501079_0060691 3300049741 Unclassified 2917
526 Ga0501080_0047276 3300049742 Unclassified 4005
527 Ga0501083_0097795 3300049744 Unclassified 1936
528 Ga0501241_011459 3300049758 Bacteria 1609
529 Ga0501263_001008 3300049760 Bacteria 2483
530 Ga0501266_000698 3300049763 Bacteria 4372
531 Ga0501035_0048280 3300049822 Bacteria 3818
532 Ga0501044_0014267 3300049823 Bacteria 8579
533 Ga0501044_0157063 3300049823 Unclassified 2253
534 Ga0501044_0202424 3300049823 Bacteria 1943
535 Ga0501284_00002 3300050005 Bacteria 220402
536 nmdc:mga05p37_3043_c1 3300050507 Bacteria 19467
537 nmdc:mga09592_144679_c1 3300050508 Bacteria 2050
538 nmdc:mga08y16_168668_c1 3300050511 Bacteria 2274
539 nmdc:mga08y16_493862_c1 3300050511 Bacteria 1244
540 Ga0500578_0000605 3300053086 Bacteria 43458
541 Ga0500644_0027933 3300053088 Bacteria 1760
542 Ga0500583_0000055 3300053092 Bacteria 72367
543 Ga0500583_0031014 3300053092 Bacteria 2345
544 Ga0500562_000148 3300053108 Bacteria 20782
545 Ga0500594_0041296 3300053118 Bacteria 1263
546 Ga0500642_0002303 3300053130 Bacteria 5582
547 Ga0500568_0000080 3300053139 Bacteria 92694
548 Ga0500588_0001975 3300053146 Bacteria 4055
549 Ga0500622_0001787 3300053156 Bacteria 16424
550 Ga0500622_0005886 3300053156 Bacteria 7244
551 Ga0500611_000003 3300053727 Bacteria 333431
552 Ga0501082_0204392 3300060353 Unclassified 1718
553 Ga0466962_0019364 3300061719 Bacteria 3271
554 2819585694 2818991444 Bacteria 6968812
555 2929159498 2929154850 Bacteria 6753285
556 Ga0439449_0009577
557 JGI24740J21852_10007622
558 JGI24739J22299_10005191
559 JGI25406J46586_10001107
560 rootH2_10153927
561 rootH2_10157843
562 rootL2_10088716
563 rootL2_10250360
564 rootL2_10260837
565 rootH1_10010306
566 rootH1_10091716
567 JGI25160J50197_1005658
568 JGI25160J50197_1011008
569 Ga0055526_1032041
570 Ga0055528_1000060
571 Ga0055530_10000378
572 Ga0055543_1004307
573 Ga0070658_10030524
574 Ga0070676_10006487
575 Ga0070676_10010162
576 Ga0070676_10033667
577 Ga0070676_10048550
578 Ga0070676_10059953
579 Ga0070683_100010607
580 Ga0070683_100026609
581 Ga0070690_100003099
582 Ga0070670_100023427
583 Ga0070670_100131175
584 Ga0070670_100152846
585 Ga0070677_10024295
586 Ga0068869_100003697
587 Ga0068869_100020688
588 Ga0068869_100055233
589 Ga0070666_10000055
590 Ga0070666_10004569
591 Ga0070666_10085168
592 Ga0070680_100129435
593 Ga0070682_100000041
594 Ga0070682_100048406
595 Ga0068868_100015969
596 Ga0068868_100159761
597 Ga0068868_100168668
598 Ga0070660_100025464
599 Ga0070689_100081008
600 Ga0070687_100003360
601 Ga0070661_100030797
602 Ga0070668_100128667
603 Ga0070669_100043278
604 Ga0070675_100224150
605 Ga0070671_100092547
606 Ga0070674_100008425
607 Ga0070674_100088627
608 Ga0070674_100134857
609 Ga0070673_100026010
610 Ga0070673_100027929
611 Ga0070673_100031933
612 Ga0070673_100043636
613 Ga0070673_100092688
614 Ga0070673_100128902
615 Ga0070673_100415274
616 Ga0070688_100076382
617 Ga0070659_100243248
618 Ga0070667_100005019
619 Ga0070667_100013370
620 Ga0070667_100019186
621 Ga0070667_100024969
622 Ga0070667_100117229
623 Ga0070667_100135444
624 Ga0070667_100342979
625 Ga0070700_100083413
626 Ga0070678_100035659
627 Ga0070662_100012145
628 Ga0070662_100038343
629 Ga0070681_10040676
630 Ga0068867_100017424
631 Ga0068867_100021654
632 Ga0068867_100025016
633 Ga0068867_100209978
634 Ga0070685_10003458
635 Ga0070685_10010448
636 Ga0070685_10019950
637 Ga0070698_100005877
638 Ga0070698_100012587
639 Ga0070698_100016585
640 Ga0070698_100093247
641 Ga0070679_100037839
642 Ga0070684_100027800
643 Ga0068853_100000595
644 Ga0068853_100010504
645 Ga0068853_100040345
646 Ga0068853_100070809
647 Ga0068853_100089270
648 Ga0068853_100112970
649 Ga0068853_100116708
650 Ga0068853_100132520
651 Ga0068853_100138667
652 Ga0068853_100235583
653 Ga0070672_100040962
654 Ga0070672_100043080
655 Ga0070672_100082040
656 Ga0070672_100092260
657 Ga0070672_100268351
658 Ga0070686_100012522
659 Ga0070696_100306107
660 Ga0070665_100000014
661 Ga0070665_100019007
662 Ga0070704_100202317
663 Ga0068855_100009267
664 Ga0068855_100034302
665 Ga0068855_100074195
666 Ga0068855_100087415
667 Ga0068855_100190250
668 Ga0070664_100009648
669 Ga0070664_100213544
670 Ga0068857_100037368
671 Ga0068857_100038645
672 Ga0068857_100093965
673 Ga0068854_100016725
674 Ga0068854_100157071
675 Ga0068854_100212374
676 Ga0068856_100029902
677 Ga0068856_100047645
678 Ga0068852_100003367
679 Ga0068852_100003929
680 Ga0068852_100004742
681 Ga0068852_100144813
682 Ga0068859_100000003
683 Ga0068859_100001878
684 Ga0068859_100016964
685 Ga0068859_100049549
686 Ga0068859_100262777
687 Ga0068859_100400415
688 Ga0068864_100005880
689 Ga0068864_100033275
690 Ga0068864_100457911
691 Ga0068866_10012497
692 Ga0068861_100112292
693 Ga0068851_10004654
694 Ga0068870_10054329
695 Ga0068870_10134867
696 Ga0068863_100004065
697 Ga0068863_100006876
698 Ga0068863_100079031
699 Ga0068863_100156181
700 Ga0068863_100188510
701 Ga0068863_100205976
702 Ga0068863_100273236
703 Ga0068863_100392044
704 Ga0068858_100005095
705 Ga0068858_100032938
706 Ga0068858_100058456
707 Ga0068860_100000024
708 Ga0068860_100000691
709 Ga0068860_100001083
710 Ga0068860_100010599
711 Ga0068860_100010971
712 Ga0068860_100027949
713 Ga0068860_100031366
714 Ga0068860_100161926
715 Ga0068860_100409985
716 Ga0068862_100125972
717 Ga0068862_100150637
718 Ga0081540_1006450
719 Ga0081539_10033535
720 Ga0075366_10078426
721 Ga0097621_100010257
722 Ga0097621_100059914
723 Ga0097621_100075408
724 Ga0097621_100101113
725 Ga0097621_100225131
726 Ga0097621_100232522
727 Ga0075370_10061243
728 Ga0068871_100015533
729 Ga0068871_100056393
730 Ga0068871_100176318
731 Ga0068871_100263895
732 Ga0068871_100275702
733 Ga0068871_100303091
734 Ga0075428_100000528
735 Ga0075428_100202156
736 Ga0068865_100010251
737 Ga0068865_100032955
738 Ga0068865_100212409
739 Ga0097620_100000003
740 Ga0097620_100001878
741 Ga0097620_100016964
742 Ga0097620_100049547
743 Ga0097620_100262781
744 Ga0097620_100400405
745 Ga0105240_10000106
746 Ga0105240_10000895
747 Ga0105240_10002904
748 Ga0105240_10004054
749 Ga0105240_10006297
750 Ga0105240_10006529
751 Ga0105240_10042709
752 Ga0105240_10059025
753 Ga0105240_10167903
754 Ga0111539_10034712
755 Ga0111539_10455718
756 Ga0105247_10005675
757 Ga0114129_10001087
758 Ga0105243_10244684
759 Ga0105241_10000333
760 Ga0105241_10006665
761 Ga0105242_10046108
762 Ga0105237_10000561
763 Ga0105237_10001918
764 Ga0105237_10002430
765 Ga0105237_10008942
766 Ga0105237_10014100
767 Ga0105237_10018452
768 Ga0105237_10098083
769 Ga0105237_10099104
770 Ga0105237_10156915
771 Ga0105238_10001211
772 Ga0105238_10036147
773 Ga0105238_10135965
774 Ga0105249_10006125
775 Ga0105249_10007649
776 Ga0105249_10041123
777 Ga0105249_10054386
778 Ga0105249_10056662
779 Ga0105249_10175988
780 Ga0105249_10217021
781 Ga0105239_10000580
782 Ga0105239_10003763
783 Ga0105239_10015245
784 Ga0105239_10031587
785 Ga0105239_10069729
786 Ga0105239_10150909
787 Ga0105239_10182175
788 Ga0105246_10017063
789 Ga0105246_10049725
790 Ga0157373_10027854
791 Ga0157373_10036914
792 Ga0157371_10019638
793 Ga0157371_10169602
794 Ga0157370_10004404
795 Ga0157369_10047185
796 Ga0157374_10000011
797 Ga0157374_10004638
798 Ga0157374_10033206
799 Ga0157374_10070119
800 Ga0157374_10157436
801 Ga0157374_10285030
802 Ga0157378_10007622
803 Ga0157378_10012126
804 Ga0157378_10030079
805 Ga0157378_10038433
806 Ga0157378_10069590
807 Ga0157378_10134653
808 Ga0163162_10000612
809 Ga0163162_10007231
810 Ga0163162_10009116
811 Ga0163162_10027673
812 Ga0163162_10063273
813 Ga0163162_10082776
814 Ga0163162_10104804
815 Ga0163162_10266747
816 Ga0157372_10000171
817 Ga0157372_10004704
818 Ga0157372_10046427
819 Ga0157372_10094322
820 Ga0157372_10345234
821 Ga0157372_10417014
822 Ga0157372_10506995
823 Ga0157375_10054957
824 Ga0157375_10067613
825 Ga0157375_10076477
826 Ga0157375_10090619
827 Ga0157375_10109548
828 Ga0157375_10302491
829 Ga0163163_10068512
830 Ga0163163_10130029
831 Ga0157380_10001258
832 Ga0157380_10011994
833 Ga0157380_10048233
834 Ga0157380_10058664
835 Ga0157380_10203437
836 Ga0157380_10286114
837 Ga0157377_10033210
838 Ga0157377_10061691
839 Ga0157377_10074208
840 Ga0157379_10066239
841 Ga0157379_10127216
842 Ga0157379_10199350
843 Ga0157376_10020146
844 Ga0157376_10031329
845 Ga0157376_10033480
846 Ga0157376_10065020
847 Ga0163161_10012726
848 Ga0163161_10063450
849 Ga0209673_1000258
850 Ga0209564_1008584
851 Ga0209564_1035408
852 Ga0209758_1010462
853 Ga0209758_1016212
854 Ga0209050_1001018
855 Ga0207426_1000040
856 Ga0207426_1000916
857 Ga0207697_10055171
858 Ga0207710_10017508
859 Ga0207688_10020363
860 Ga0207680_10001322
861 Ga0207680_10005910
862 Ga0207680_10078072
863 Ga0207647_10009941
864 Ga0207647_10085150
865 Ga0207645_10000193
866 Ga0207645_10003937
867 Ga0207643_10090611
868 Ga0207705_10034144
869 Ga0207654_10000560
870 Ga0207654_10090306
871 Ga0207707_10261963
872 Ga0207695_10000087
873 Ga0207695_10000522
874 Ga0207695_10000582
875 Ga0207695_10000909
876 Ga0207695_10106289
877 Ga0207695_10179338
878 Ga0207671_10002341
879 Ga0207671_10004140
880 Ga0207671_10024076
881 Ga0207671_10030798
882 Ga0207671_10046649
883 Ga0207671_10059635
884 Ga0207671_10125927
885 Ga0207660_10143611
886 Ga0207662_10006841
887 Ga0207657_10002165
888 Ga0207646_10336890
889 Ga0207681_10035003
890 Ga0207694_10094427
891 Ga0207650_10245861
892 Ga0207659_10110056
893 Ga0207644_10076344
894 Ga0207644_10088369
895 Ga0207644_10095299
896 Ga0207706_10003305
897 Ga0207706_10005451
898 Ga0207686_10000977
899 Ga0207686_10026282
900 Ga0207670_10007292
901 Ga0207669_10002991
902 Ga0207669_10110551
903 Ga0207704_10046554
904 Ga0207704_10168099
905 Ga0207691_10001141
906 Ga0207691_10016933
907 Ga0207691_10068462
908 Ga0207691_10133767
909 Ga0207689_10004338
910 Ga0207689_10008230
911 Ga0207689_10009258
912 Ga0207689_10009429
913 Ga0207689_10039783
914 Ga0207689_10096102
915 Ga0207661_10007387
916 Ga0207679_10014606
917 Ga0207667_10000584
918 Ga0207667_10003743
919 Ga0207651_10003386
920 Ga0207651_10247192
921 Ga0207651_10274514
922 Ga0207712_10001111
923 Ga0207712_10003616
924 Ga0207712_10020217
925 Ga0207668_10000514
926 Ga0207668_10090546
927 Ga0207640_10083103
928 Ga0207640_10091877
929 Ga0207640_10191236
930 Ga0207658_10007630
931 Ga0207658_10083641
932 Ga0207658_10167609
933 Ga0207658_10217215
934 Ga0207658_10432471
935 Ga0207677_10057237
936 Ga0207677_10062503
937 Ga0207677_10068700
938 Ga0207677_10080875
939 Ga0207703_10004431
940 Ga0207703_10006541
941 Ga0207703_10201342
942 Ga0207639_10040260
943 Ga0207639_10150323
944 Ga0207639_10246398
945 Ga0207639_10369630
946 Ga0207708_10071529
947 Ga0207708_10271935
948 Ga0207708_10385751
949 Ga0207702_10064704
950 Ga0207641_10000026
951 Ga0207641_10000318
952 Ga0207641_10012887
953 Ga0207641_10017491
954 Ga0207641_10035371
955 Ga0207641_10231771
956 Ga0207641_10436344
957 Ga0207648_10000914
958 Ga0207648_10032681
959 Ga0207648_10062843
960 Ga0207648_10190090
961 Ga0207648_10237059
962 Ga0207648_10387667
963 Ga0207676_10024459
964 Ga0207676_10030721
965 Ga0207676_10043230
966 Ga0207676_10170169
967 Ga0207674_10009967
968 Ga0207674_10047052
969 Ga0207675_100018920
970 Ga0207675_100019544
971 Ga0207675_100040792
972 Ga0207675_100063356
973 Ga0207675_100100592
974 Ga0207683_10015050
975 Ga0207683_10231661
976 Ga0207698_10002724
977 Ga0207698_10051408
978 Ga0207698_10056007
979 Ga0207698_10056268
980 Ga0268266_10000048
981 Ga0268266_10008503
982 Ga0268266_10104142
983 Ga0268265_10037171
984 Ga0268265_10303811
985 Ga0268264_10000028
986 Ga0268264_10000558
987 Ga0268264_10007750
988 Ga0268264_10014547
989 Ga0268264_10022172
990 Ga0268264_10312312
991 Ga0307517_10123252
992 Ga0307515_10000001
993 Ga0307515_10001257
994 Ga0307511_10000076
995 Ga0265327_10000013
996 Ga0265327_10000115
997 Ga0307513_10046889
998 Ga0307509_10029821
999 Ga0307508_10000111
1000 Ga0307516_10000159
1001 Ga0307414_10076775
1002 Ga0307507_10113778
1003 Ga0307510_10000949
1004 Ga0373927_0020503
1005 Ga0373937_0211741
1006 Ga0373937_0214647
1007 Ga0373937_0260314
1008 Ga0436363_0220785
1009 Ga0439436_0001213
1010 Ga0439436_0026910
1011 Ga0439439_0002695
1012 Ga0451802_1059356
1013 Ga0451841_1359142
1014 Ga0451853_0782917
1015 Ga0439445_0019312
1016 Ga0439449_0007699
1017 Ga0439457_001516
1018 Ga0439457_012653
1019 Ga0451577_0104217
1020 Ga0466972_0000049
1021 Ga0466972_0000057
1022 Ga0466972_0000901
1023 Ga0466972_0017565
1024 Ga0466965_0029525
1025 Ga0466965_0036341
1026 Ga0466965_0060052
1027 Ga0453684_0049686
1028 Ga0453684_0140637
1029 Ga0466968_0132032
1030 Ga0466970_0000465
1031 Ga0466957_0000101
1032 Ga0466957_0246763
1033 Ga0466959_0005634
1034 Ga0466958_0034594
1035 Ga0466967_0261141
1036 Ga0495627_037979
1037 Ga0495651_0206470
1038 Ga0495650_0006071
1039 Ga0495630_0074091
1040 Ga0495630_0122687
1041 Ga0495621_0005864
1042 Ga0495633_0000089
1043 Ga0495668_0000023
1044 Ga0495668_0002514
1045 Ga0495611_0000669
1046 Ga0495611_0087910
1047 Ga0495625_0046749
1048 Ga0495647_0085545
1049 Ga0495658_0066493
1050 Ga0495649_0024726
1051 Ga0495672_0119624
1052 Ga0495672_0147009
1053 Ga0495687_000429
1054 Ga0495686_0000005
1055 Ga0495686_0071517
1056 Ga0496109_0220929
1057 Ga0496115_0109968
1058 Ga0501031_0002497
1059 Ga0501034_0019990
1060 Ga0501036_0002439
1061 Ga0501036_0008374
1062 Ga0501037_0003269
1063 Ga0501037_0037210
1064 Ga0501038_0009021
1065 Ga0501039_0010018
1066 Ga0501042_0113170
1067 Ga0501043_0026166
1068 Ga0501043_0307318
1069 Ga0501046_0022150
1070 Ga0501047_0007060
1071 Ga0501047_0051111
1072 Ga0501048_0046772
1073 Ga0501068_0085057
1074 Ga0501070_0008420
1075 Ga0501073_0004719
1076 Ga0501073_0174416
1077 Ga0501074_0002102
1078 Ga0501219_000115
1079 Ga0501225_0002813
1080 Ga0501079_0060691
1081 Ga0501080_0047276
1082 Ga0501083_0097795
1083 Ga0501241_011459
1084 Ga0501263_001008
1085 Ga0501266_000698
1086 Ga0501035_0048280
1087 Ga0501044_0014267
1088 Ga0501044_0157063
1089 Ga0501044_0202424
1090 Ga0501284_00002
1091 nmdc:mga05p37_3043_c1
1092 nmdc:mga09592_144679_c1
1093 nmdc:mga08y16_168668_c1
1094 nmdc:mga08y16_493862_c1
1095 Ga0500578_0000605
1096 Ga0500644_0027933
1097 Ga0500583_0000055
1098 Ga0500583_0031014
1099 Ga0500562_000148
1100 Ga0500594_0041296
1101 Ga0500642_0002303
1102 Ga0500568_0000080
1103 Ga0500588_0001975
1104 Ga0500622_0001787
1105 Ga0500622_0005886
1106 Ga0500611_000003
1107 Ga0501082_0204392
1108 Ga0466962_0019364
1109 2819585694
1110 2929159498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

217

405

0.95

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

51

100

0.93

Map