F463141
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 555 | 326 | 1110 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300046462|Ga0495651_0002551|Ga0495651_0002551_210_1133 |
| Length | 307 |
| Sequence | MSRSDSGYSDEVTDSNGEEPPPLGVKCECEKKSKTPHQRGAVQIPNLVKKSNMQKIATWNVNSLKVRLPQVLQWLADNPVDVLALQETKLTDDKFPAAEIEAAGYHVAFSGQKTYNGVAILSRHPITDVVKNNPLYDDLQQRIIAATIDGMRIVCAYIPNGQAPDTEKYQYKLKWLDALHDWLQDECRQHPKLALMGDYNIAPEDRDVHDPAAWVGQNLVSPPERAAFVRLQGLGLTDAFRMFEQPEKLFSWWDYRQMGFRLNRGMRIDHILLSSPLAAQCSACVIDKVPRKWEQPSDHAPVIATLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 49 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 50 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 68 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 80 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 109 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 113 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 119 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 120 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 125 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 126 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 127 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 128 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 129 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 130 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 131 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 132 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 133 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 134 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 135 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 136 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 137 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 138 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 139 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 215 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 216 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 219 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 220 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 221 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 222 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 225 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 249 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 251 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 256 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 260 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 264 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 265 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 266 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 267 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 268 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 269 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 270 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 271 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 272 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 275 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 278 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 279 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 280 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 281 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 282 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 283 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 284 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 285 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 286 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 287 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 288 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 289 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 290 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 291 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 292 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 293 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 294 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 295 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 296 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 297 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 298 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 299 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 300 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 301 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 302 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 303 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 304 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 305 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 306 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 307 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 308 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 309 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 310 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 311 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 312 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 313 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 314 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 315 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 316 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 317 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 318 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 319 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 320 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 321 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 322 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 323 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 324 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 325 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 326 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.81 |
| Metatranscriptomes | 0.36 |
| Isolates | 8.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.15 |
| Nodule | 1.08 |
| Rhizoplane | 2.88 |
| Rhizosphere | 70.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495651_0002551 | 3300046462 | Bacteria | 14085 |
| 2 | JGI25155J39150_1000331 | 3300002704 | Bacteria | 15383 |
| 3 | JGI25155J39150_1000387 | 3300002704 | Bacteria | 12533 |
| 4 | JGI25156J39149_1000848 | 3300002705 | Bacteria | 15364 |
| 5 | JGI25156J39149_1002710 | 3300002705 | Bacteria | 6191 |
| 6 | JGI25162J39368_1000941 | 3300002737 | Bacteria | 18693 |
| 7 | JGI25162J39368_1007041 | 3300002737 | Bacteria | 1817 |
| 8 | JGI25154J39366_1000290 | 3300002738 | Bacteria | 30181 |
| 9 | JGI25154J39366_1000391 | 3300002738 | Bacteria | 23872 |
| 10 | JGI25157J39369_1001917 | 3300002741 | Bacteria | 6288 |
| 11 | JGI25164J39214_1009618 | 3300002772 | Bacteria | 947 |
| 12 | JGI25165J46597_1001005 | 3300003214 | Bacteria | 18693 |
| 13 | rootL2_10039155 | 3300003322 | Bacteria | 9743 |
| 14 | Ga0007416J51690_1099222 | 3300003577 | Bacteria | 970 |
| 15 | Ga0055538_1000030 | 3300003751 | Bacteria | 200831 |
| 16 | Ga0055538_1000368 | 3300003751 | Bacteria | 18693 |
| 17 | Ga0055539_1000040 | 3300003752 | Bacteria | 200831 |
| 18 | Ga0055539_1000374 | 3300003752 | Bacteria | 18693 |
| 19 | Ga0055533_1000050 | 3300003756 | Bacteria | 200831 |
| 20 | Ga0055533_1000368 | 3300003756 | Bacteria | 18693 |
| 21 | Ga0055532_1000016 | 3300003758 | Bacteria | 327509 |
| 22 | Ga0055525_1000060 | 3300003759 | Bacteria | 200831 |
| 23 | Ga0055525_1000516 | 3300003759 | Bacteria | 18693 |
| 24 | Ga0055535_1006588 | 3300003761 | Bacteria | 2327 |
| 25 | Ga0055529_1000342 | 3300003763 | Bacteria | 52150 |
| 26 | Ga0055526_1000010 | 3300003771 | Bacteria | 241512 |
| 27 | Ga0055537_1000592 | 3300003773 | Bacteria | 20163 |
| 28 | Ga0055524_1000025 | 3300003775 | Bacteria | 216427 |
| 29 | Ga0055524_1009482 | 3300003775 | Bacteria | 3955 |
| 30 | Ga0055534_1000428 | 3300003784 | Bacteria | 25148 |
| 31 | Ga0055528_1000298 | 3300003790 | Bacteria | 42146 |
| 32 | Ga0055541_1000027 | 3300003841 | Bacteria | 200831 |
| 33 | Ga0055541_1000258 | 3300003841 | Bacteria | 18693 |
| 34 | Ga0055543_1003841 | 3300004625 | Bacteria | 4265 |
| 35 | Ga0065165_1000438 | 3300005262 | Bacteria | 65397 |
| 36 | Ga0065714_10089834 | 3300005288 | Bacteria | 1966 |
| 37 | Ga0065707_10185809 | 3300005295 | Bacteria | 1389 |
| 38 | Ga0070660_100002479 | 3300005339 | Bacteria | 12654 |
| 39 | Ga0070661_100012765 | 3300005344 | Bacteria | 5881 |
| 40 | Ga0070674_100031732 | 3300005356 | Bacteria | 3503 |
| 41 | Ga0070709_10482045 | 3300005434 | Bacteria | 939 |
| 42 | Ga0070714_100071332 | 3300005435 | Unclassified | 3003 |
| 43 | Ga0070678_100015633 | 3300005456 | Bacteria | 4830 |
| 44 | Ga0070662_100193259 | 3300005457 | Bacteria | 1611 |
| 45 | Ga0068867_100034699 | 3300005459 | Bacteria | 3658 |
| 46 | Ga0070704_100267604 | 3300005549 | Bacteria | 1411 |
| 47 | Ga0068855_100001055 | 3300005563 | Bacteria | 34206 |
| 48 | Ga0070664_100011397 | 3300005564 | Bacteria | 7213 |
| 49 | Ga0068854_100014480 | 3300005578 | Bacteria | 5200 |
| 50 | Ga0068856_100647884 | 3300005614 | Bacteria | 1077 |
| 51 | Ga0068852_100169750 | 3300005616 | Bacteria | 2044 |
| 52 | Ga0068860_100119924 | 3300005843 | Bacteria | 2518 |
| 53 | Ga0075366_10001681 | 3300006195 | Bacteria | 11110 |
| 54 | Ga0075366_10280747 | 3300006195 | Bacteria | 1018 |
| 55 | Ga0097621_100231136 | 3300006237 | Bacteria | 1614 |
| 56 | Ga0068871_100084635 | 3300006358 | Bacteria | 2632 |
| 57 | Ga0075428_100001103 | 3300006844 | Bacteria | 28744 |
| 58 | Ga0075429_100001612 | 3300006880 | Bacteria | 18622 |
| 59 | Ga0079104_1010838 | 3300006946 | Bacteria | 2970 |
| 60 | Ga0099826_10000005 | 3300006948 | Bacteria | 465206 |
| 61 | Ga0099795_10031637 | 3300007788 | Bacteria | 1823 |
| 62 | Ga0105240_10004718 | 3300009093 | Bacteria | 20573 |
| 63 | Ga0105240_10013236 | 3300009093 | Bacteria | 11348 |
| 64 | Ga0105240_10225485 | 3300009093 | Bacteria | 2181 |
| 65 | Ga0111539_10006197 | 3300009094 | Bacteria | 15433 |
| 66 | Ga0105242_10062283 | 3300009176 | Bacteria | 3070 |
| 67 | Ga0105248_10087249 | 3300009177 | Bacteria | 3511 |
| 68 | Ga0105237_10038041 | 3300009545 | Bacteria | 4861 |
| 69 | Ga0105238_10000194 | 3300009551 | Bacteria | 67211 |
| 70 | Ga0105238_10038772 | 3300009551 | Bacteria | 4837 |
| 71 | Ga0105239_10034172 | 3300010375 | Bacteria | 5582 |
| 72 | Ga0157370_10135726 | 3300013104 | Bacteria | 2293 |
| 73 | Ga0157374_10107514 | 3300013296 | Bacteria | 2681 |
| 74 | Ga0157372_10166592 | 3300013307 | Bacteria | 2548 |
| 75 | Ga0157375_10694492 | 3300013308 | Bacteria | 1171 |
| 76 | Ga0182008_10000724 | 3300014497 | Bacteria | 23482 |
| 77 | Ga0182008_10128118 | 3300014497 | Bacteria | 1264 |
| 78 | Ga0182006_1000004 | 3300015261 | Bacteria | 622190 |
| 79 | Ga0182006_1017377 | 3300015261 | Bacteria | 3057 |
| 80 | Ga0182006_1017650 | 3300015261 | Bacteria | 3029 |
| 81 | Ga0182007_10000017 | 3300015262 | Bacteria | 199097 |
| 82 | Ga0182007_10008300 | 3300015262 | Bacteria | 4274 |
| 83 | Ga0182005_1000030 | 3300015265 | Bacteria | 213092 |
| 84 | Ga0182005_1000962 | 3300015265 | Bacteria | 12513 |
| 85 | Ga0163161_10007639 | 3300017792 | Bacteria | 7478 |
| 86 | Ga0163161_10070889 | 3300017792 | Bacteria | 2549 |
| 87 | Ga0163161_10679374 | 3300017792 | Bacteria | 856 |
| 88 | Ga0213872_10000283 | 3300021361 | Bacteria | 43308 |
| 89 | Ga0213872_10000448 | 3300021361 | Bacteria | 33688 |
| 90 | Ga0213872_10008525 | 3300021361 | Bacteria | 4958 |
| 91 | Ga0213872_10022207 | 3300021361 | Bacteria | 2922 |
| 92 | Ga0209435_100016 | 3300025206 | Bacteria | 305566 |
| 93 | Ga0209435_100256 | 3300025206 | Bacteria | 13443 |
| 94 | Ga0209760_101393 | 3300025207 | Bacteria | 2582 |
| 95 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 96 | Ga0209784_100020 | 3300025224 | Bacteria | 412353 |
| 97 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 98 | Ga0209566_100020 | 3300025225 | Bacteria | 412353 |
| 99 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 100 | Ga0209674_100035 | 3300025226 | Bacteria | 412353 |
| 101 | Ga0209147_100023 | 3300025229 | Bacteria | 437803 |
| 102 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 103 | Ga0209563_100038 | 3300025230 | Bacteria | 412353 |
| 104 | Ga0207427_100502 | 3300025231 | Bacteria | 20805 |
| 105 | Ga0209437_100066 | 3300025233 | Bacteria | 327883 |
| 106 | Ga0209437_100080 | 3300025233 | Bacteria | 275402 |
| 107 | Ga0209258_100210 | 3300025242 | Bacteria | 117131 |
| 108 | Ga0209646_1000033 | 3300025246 | Bacteria | 369507 |
| 109 | Ga0209646_1000036 | 3300025246 | Bacteria | 358864 |
| 110 | Ga0209646_1000200 | 3300025246 | Bacteria | 71297 |
| 111 | Ga0209026_1000031 | 3300025250 | Bacteria | 325747 |
| 112 | Ga0209026_1008366 | 3300025250 | Bacteria | 2169 |
| 113 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 114 | Ga0209677_100031 | 3300025253 | Bacteria | 329719 |
| 115 | Ga0209759_1000045 | 3300025256 | Bacteria | 235654 |
| 116 | Ga0209759_1000384 | 3300025256 | Bacteria | 55139 |
| 117 | Ga0209233_1000060 | 3300025261 | Bacteria | 412379 |
| 118 | Ga0209565_1000068 | 3300025263 | Bacteria | 171201 |
| 119 | Ga0209565_1003187 | 3300025263 | Bacteria | 5435 |
| 120 | Ga0209455_1000047 | 3300025272 | Bacteria | 379709 |
| 121 | Ga0209455_1005495 | 3300025272 | Bacteria | 3904 |
| 122 | Ga0209673_1000119 | 3300025273 | Bacteria | 171203 |
| 123 | Ga0209130_1000057 | 3300025284 | Bacteria | 210593 |
| 124 | Ga0209675_1000068 | 3300025291 | Bacteria | 171202 |
| 125 | Ga0209675_1020404 | 3300025291 | Bacteria | 1797 |
| 126 | Ga0209564_1000060 | 3300025295 | Bacteria | 325890 |
| 127 | Ga0209564_1000141 | 3300025295 | Bacteria | 179852 |
| 128 | Ga0209564_1000149 | 3300025295 | Bacteria | 170958 |
| 129 | Ga0209564_1019340 | 3300025295 | Bacteria | 2550 |
| 130 | Ga0209256_1000040 | 3300025299 | Bacteria | 366839 |
| 131 | Ga0209256_1001036 | 3300025299 | Bacteria | 32591 |
| 132 | Ga0207656_10174922 | 3300025321 | Bacteria | 1028 |
| 133 | Ga0207655_1011084 | 3300025728 | Bacteria | 5403 |
| 134 | Ga0207695_10000851 | 3300025913 | Bacteria | 56040 |
| 135 | Ga0207695_10011378 | 3300025913 | Bacteria | 10784 |
| 136 | Ga0207695_10041692 | 3300025913 | Bacteria | 4911 |
| 137 | Ga0207657_10005609 | 3300025919 | Bacteria | 13096 |
| 138 | Ga0207657_10262481 | 3300025919 | Bacteria | 1374 |
| 139 | Ga0207649_10011361 | 3300025920 | Bacteria | 4909 |
| 140 | Ga0207694_10000615 | 3300025924 | Bacteria | 32370 |
| 141 | Ga0207694_10196847 | 3300025924 | Bacteria | 1639 |
| 142 | Ga0207659_10237884 | 3300025926 | Bacteria | 1472 |
| 143 | Ga0207690_10001939 | 3300025932 | Bacteria | 12686 |
| 144 | Ga0207690_10180556 | 3300025932 | Bacteria | 1589 |
| 145 | Ga0207686_10077140 | 3300025934 | Bacteria | 2163 |
| 146 | Ga0207709_10034294 | 3300025935 | Bacteria | 2990 |
| 147 | Ga0207704_10460712 | 3300025938 | Bacteria | 1017 |
| 148 | Ga0207679_10008944 | 3300025945 | Bacteria | 6396 |
| 149 | Ga0207667_10000073 | 3300025949 | Bacteria | 174391 |
| 150 | Ga0207667_10000076 | 3300025949 | Bacteria | 166704 |
| 151 | Ga0207667_10015829 | 3300025949 | Bacteria | 8548 |
| 152 | Ga0207667_10100844 | 3300025949 | Bacteria | 2978 |
| 153 | Ga0207658_10347751 | 3300025986 | Bacteria | 1290 |
| 154 | Ga0207702_10190639 | 3300026078 | Bacteria | 1894 |
| 155 | Ga0207675_100303332 | 3300026118 | Bacteria | 1556 |
| 156 | Ga0207683_10002101 | 3300026121 | Bacteria | 17552 |
| 157 | Ga0207698_10723071 | 3300026142 | Bacteria | 992 |
| 158 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 159 | Ga0209588_1025807 | 3300027671 | Bacteria | 1862 |
| 160 | Ga0207428_10002526 | 3300027907 | Bacteria | 18263 |
| 161 | Ga0207428_10032970 | 3300027907 | Bacteria | 4258 |
| 162 | Ga0268264_10058489 | 3300028381 | Bacteria | 3228 |
| 163 | Ga0307515_10005473 | 3300028794 | Bacteria | 25705 |
| 164 | Ga0265324_10000018 | 3300029957 | Bacteria | 184238 |
| 165 | Ga0265325_10000363 | 3300031241 | Bacteria | 31799 |
| 166 | Ga0307509_10000050 | 3300031507 | Bacteria | 165692 |
| 167 | Ga0307408_100000740 | 3300031548 | Bacteria | 26386 |
| 168 | Ga0265314_10014128 | 3300031711 | Bacteria | 6409 |
| 169 | Ga0265314_10027818 | 3300031711 | Bacteria | 4226 |
| 170 | Ga0307516_10406761 | 3300031730 | Bacteria | 1020 |
| 171 | Ga0307518_10025524 | 3300031838 | Bacteria | 4261 |
| 172 | Ga0373923_0052377 | 3300035111 | Bacteria | 1714 |
| 173 | Ga0373937_0095554 | 3300036401 | Bacteria | 2755 |
| 174 | Ga0395899_0004633 | 3300037312 | Bacteria | 10721 |
| 175 | Ga0395899_0027570 | 3300037312 | Bacteria | 4281 |
| 176 | Ga0395899_0035781 | 3300037312 | Bacteria | 3726 |
| 177 | Ga0395900_0003354 | 3300037418 | Bacteria | 17306 |
| 178 | Ga0395900_0157336 | 3300037418 | Bacteria | 2320 |
| 179 | Ga0395900_0203968 | 3300037418 | Bacteria | 1999 |
| 180 | Ga0395900_0653567 | 3300037418 | Bacteria | 988 |
| 181 | Ga0395898_0020581 | 3300037466 | Bacteria | 6701 |
| 182 | Ga0395905_0002331 | 3300037471 | Bacteria | 21198 |
| 183 | Ga0395905_0011968 | 3300037471 | Bacteria | 8365 |
| 184 | Ga0395905_0033008 | 3300037471 | Bacteria | 4866 |
| 185 | Ga0395901_0201605 | 3300038443 | Bacteria | 2085 |
| 186 | Ga0395901_0206228 | 3300038443 | Bacteria | 2059 |
| 187 | Ga0395901_0749060 | 3300038443 | Bacteria | 970 |
| 188 | Ga0436361_0114843 | 3300039447 | Bacteria | 5669 |
| 189 | Ga0436361_0280623 | 3300039447 | Bacteria | 20224 |
| 190 | Ga0436361_0615250 | 3300039447 | Bacteria | 17905 |
| 191 | Ga0436361_1026213 | 3300039447 | Bacteria | 1832 |
| 192 | Ga0439461_0000887 | 3300041410 | Bacteria | 4439 |
| 193 | Ga0439446_0001108 | 3300042156 | Bacteria | 5964 |
| 194 | Ga0439434_0001969 | 3300042435 | Bacteria | 5949 |
| 195 | Ga0451577_0000409 | 3300042876 | Bacteria | 77928 |
| 196 | Ga0451577_0120782 | 3300042876 | Bacteria | 2347 |
| 197 | Ga0451577_0376954 | 3300042876 | Bacteria | 1287 |
| 198 | Ga0466972_0042347 | 3300044658 | Bacteria | 2214 |
| 199 | Ga0466972_0060036 | 3300044658 | Bacteria | 1825 |
| 200 | Ga0453683_0011565 | 3300044673 | Bacteria | 5814 |
| 201 | Ga0453683_0082009 | 3300044673 | Bacteria | 2021 |
| 202 | Ga0466965_0001702 | 3300044683 | Bacteria | 9028 |
| 203 | Ga0466965_0022133 | 3300044683 | Bacteria | 3064 |
| 204 | Ga0466965_0033198 | 3300044683 | Bacteria | 2522 |
| 205 | Ga0466966_0045365 | 3300044684 | Bacteria | 2810 |
| 206 | Ga0466964_0013674 | 3300044706 | Bacteria | 3080 |
| 207 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 208 | Ga0453684_0624808 | 3300044712 | Bacteria | 1178 |
| 209 | Ga0466971_0048903 | 3300044719 | Bacteria | 1902 |
| 210 | Ga0466968_0000467 | 3300044735 | Bacteria | 13601 |
| 211 | Ga0466968_0001884 | 3300044735 | Bacteria | 7586 |
| 212 | Ga0466970_0042537 | 3300044765 | Bacteria | 2416 |
| 213 | Ga0451576_0000335 | 3300045051 | Bacteria | 113806 |
| 214 | Ga0451576_0012915 | 3300045051 | Bacteria | 9361 |
| 215 | Ga0451576_0057728 | 3300045051 | Bacteria | 4057 |
| 216 | Ga0451576_0065459 | 3300045051 | Bacteria | 3784 |
| 217 | Ga0451576_0079479 | 3300045051 | Bacteria | 3412 |
| 218 | Ga0495617_034349 | 3300046452 | Bacteria | 1702 |
| 219 | Ga0495617_039497 | 3300046452 | Bacteria | 1578 |
| 220 | Ga0495590_0058105 | 3300046457 | Bacteria | 1352 |
| 221 | Ga0495638_0007066 | 3300046460 | Bacteria | 8099 |
| 222 | Ga0495651_0119465 | 3300046462 | Bacteria | 1938 |
| 223 | Ga0495650_0001069 | 3300046471 | Bacteria | 30311 |
| 224 | Ga0495605_0004560 | 3300046474 | Bacteria | 8113 |
| 225 | Ga0495584_0000544 | 3300046491 | Bacteria | 25572 |
| 226 | Ga0495584_0011324 | 3300046491 | Bacteria | 4567 |
| 227 | Ga0495584_0013518 | 3300046491 | Bacteria | 4167 |
| 228 | Ga0495584_0120379 | 3300046491 | Bacteria | 1329 |
| 229 | Ga0495585_0007028 | 3300046492 | Bacteria | 6928 |
| 230 | Ga0495585_0014777 | 3300046492 | Bacteria | 4541 |
| 231 | Ga0495596_0001359 | 3300046500 | Bacteria | 14095 |
| 232 | Ga0495607_0012096 | 3300046501 | Bacteria | 5709 |
| 233 | Ga0495607_0015886 | 3300046501 | Bacteria | 4869 |
| 234 | Ga0495607_0046718 | 3300046501 | Bacteria | 2540 |
| 235 | Ga0495607_0110712 | 3300046501 | Bacteria | 1456 |
| 236 | Ga0495583_0000228 | 3300046506 | Bacteria | 93924 |
| 237 | Ga0495583_0003802 | 3300046506 | Bacteria | 11208 |
| 238 | Ga0495583_0021620 | 3300046506 | Bacteria | 3304 |
| 239 | Ga0495583_0042789 | 3300046506 | Bacteria | 2112 |
| 240 | Ga0495606_0000622 | 3300046507 | Bacteria | 55871 |
| 241 | Ga0495606_0003966 | 3300046507 | Bacteria | 15179 |
| 242 | Ga0495606_0005790 | 3300046507 | Bacteria | 11670 |
| 243 | Ga0495606_0018737 | 3300046507 | Bacteria | 5179 |
| 244 | Ga0495606_0032141 | 3300046507 | Bacteria | 3639 |
| 245 | Ga0495606_0073162 | 3300046507 | Bacteria | 2151 |
| 246 | Ga0495616_0001055 | 3300046513 | Bacteria | 19703 |
| 247 | Ga0495616_0012451 | 3300046513 | Bacteria | 4829 |
| 248 | Ga0495616_0018674 | 3300046513 | Bacteria | 3800 |
| 249 | Ga0495628_0000767 | 3300046516 | Bacteria | 29619 |
| 250 | Ga0495628_0011286 | 3300046516 | Bacteria | 7556 |
| 251 | Ga0495631_0017335 | 3300046518 | Bacteria | 3409 |
| 252 | Ga0495632_0003177 | 3300046519 | Bacteria | 11844 |
| 253 | Ga0495643_0003417 | 3300046522 | Bacteria | 11654 |
| 254 | Ga0495643_0155878 | 3300046522 | Bacteria | 1127 |
| 255 | Ga0495644_0003542 | 3300046523 | Bacteria | 6173 |
| 256 | Ga0495644_0005059 | 3300046523 | Bacteria | 5156 |
| 257 | Ga0495644_0043730 | 3300046523 | Bacteria | 1685 |
| 258 | Ga0495644_0053362 | 3300046523 | Bacteria | 1518 |
| 259 | Ga0495648_0002442 | 3300046524 | Bacteria | 17173 |
| 260 | Ga0495663_0014412 | 3300046525 | Bacteria | 2215 |
| 261 | Ga0495663_0020978 | 3300046525 | Bacteria | 1878 |
| 262 | Ga0495642_0015478 | 3300046528 | Bacteria | 2965 |
| 263 | Ga0495642_0024499 | 3300046528 | Bacteria | 2387 |
| 264 | Ga0495642_0042583 | 3300046528 | Bacteria | 1850 |
| 265 | Ga0495652_0029454 | 3300046529 | Bacteria | 4823 |
| 266 | Ga0495652_0042994 | 3300046529 | Bacteria | 3894 |
| 267 | Ga0495652_0079292 | 3300046529 | Bacteria | 2715 |
| 268 | Ga0495652_0123596 | 3300046529 | Bacteria | 2059 |
| 269 | Ga0495654_0019800 | 3300046530 | Bacteria | 3514 |
| 270 | Ga0495665_0100875 | 3300046531 | Bacteria | 1515 |
| 271 | Ga0495586_0043564 | 3300046535 | Bacteria | 2417 |
| 272 | Ga0495609_0000094 | 3300046538 | Bacteria | 105073 |
| 273 | Ga0495609_0001186 | 3300046538 | Bacteria | 17979 |
| 274 | Ga0495609_0014204 | 3300046538 | Bacteria | 3747 |
| 275 | Ga0495609_0087657 | 3300046538 | Bacteria | 1355 |
| 276 | Ga0495621_0153406 | 3300046539 | Bacteria | 907 |
| 277 | Ga0495597_0036123 | 3300046542 | Bacteria | 2226 |
| 278 | Ga0495597_0054761 | 3300046542 | Bacteria | 1751 |
| 279 | Ga0495597_0100554 | 3300046542 | Bacteria | 1219 |
| 280 | Ga0495597_0126845 | 3300046542 | Bacteria | 1060 |
| 281 | Ga0495622_0000434 | 3300046557 | Bacteria | 27206 |
| 282 | Ga0495622_0076280 | 3300046557 | Bacteria | 1545 |
| 283 | Ga0495633_0000763 | 3300046558 | Bacteria | 28944 |
| 284 | Ga0495633_0004545 | 3300046558 | Bacteria | 8757 |
| 285 | Ga0495633_0027960 | 3300046558 | Bacteria | 2750 |
| 286 | Ga0495633_0044116 | 3300046558 | Bacteria | 2113 |
| 287 | Ga0495633_0103303 | 3300046558 | Bacteria | 1322 |
| 288 | Ga0495656_0007094 | 3300046615 | Bacteria | 3951 |
| 289 | Ga0495668_0000330 | 3300046616 | Bacteria | 64685 |
| 290 | Ga0495668_0007416 | 3300046616 | Bacteria | 7009 |
| 291 | Ga0495668_0010434 | 3300046616 | Bacteria | 5621 |
| 292 | Ga0495668_0011411 | 3300046616 | Bacteria | 5319 |
| 293 | Ga0495611_0009507 | 3300046648 | Bacteria | 4108 |
| 294 | Ga0495625_0002821 | 3300046660 | Bacteria | 18290 |
| 295 | Ga0495625_0003372 | 3300046660 | Bacteria | 16017 |
| 296 | Ga0495625_0006154 | 3300046660 | Bacteria | 10748 |
| 297 | Ga0495625_0069082 | 3300046660 | Bacteria | 2482 |
| 298 | Ga0495625_0180178 | 3300046660 | Bacteria | 1406 |
| 299 | Ga0495635_0116820 | 3300046663 | Bacteria | 1821 |
| 300 | Ga0495659_0001490 | 3300046664 | Bacteria | 7937 |
| 301 | Ga0495659_0001937 | 3300046664 | Bacteria | 6826 |
| 302 | Ga0495659_0003169 | 3300046664 | Bacteria | 5277 |
| 303 | Ga0495661_0008874 | 3300046665 | Bacteria | 6930 |
| 304 | Ga0495661_0096698 | 3300046665 | Bacteria | 1669 |
| 305 | Ga0495588_0010401 | 3300046674 | Bacteria | 4327 |
| 306 | Ga0495599_0062335 | 3300046678 | Bacteria | 2329 |
| 307 | Ga0495623_0007800 | 3300046679 | Bacteria | 6960 |
| 308 | Ga0495623_0120190 | 3300046679 | Bacteria | 1582 |
| 309 | Ga0495646_0004104 | 3300046680 | Bacteria | 9137 |
| 310 | Ga0495624_0055898 | 3300046690 | Bacteria | 2485 |
| 311 | Ga0495624_0114563 | 3300046690 | Bacteria | 1657 |
| 312 | Ga0495670_0017126 | 3300046691 | Bacteria | 3564 |
| 313 | Ga0495670_0025056 | 3300046691 | Bacteria | 2950 |
| 314 | Ga0495671_0006069 | 3300046692 | Bacteria | 7021 |
| 315 | Ga0495671_0008140 | 3300046692 | Bacteria | 5916 |
| 316 | Ga0495671_0219088 | 3300046692 | Bacteria | 921 |
| 317 | Ga0495649_0010995 | 3300046694 | Bacteria | 5331 |
| 318 | Ga0495589_0105300 | 3300046794 | Bacteria | 1363 |
| 319 | Ga0495600_0057295 | 3300046809 | Bacteria | 2545 |
| 320 | Ga0495660_0002356 | 3300046810 | Bacteria | 12077 |
| 321 | Ga0495660_0013896 | 3300046810 | Bacteria | 4666 |
| 322 | Ga0495660_0047307 | 3300046810 | Bacteria | 2356 |
| 323 | Ga0495581_0108455 | 3300047315 | Bacteria | 1614 |
| 324 | Ga0495604_0052090 | 3300047317 | Bacteria | 3171 |
| 325 | Ga0495636_0000384 | 3300047318 | Bacteria | 16665 |
| 326 | Ga0495636_0002813 | 3300047318 | Bacteria | 6711 |
| 327 | Ga0495636_0161112 | 3300047318 | Bacteria | 1011 |
| 328 | Ga0495672_0000361 | 3300047320 | Bacteria | 58121 |
| 329 | Ga0495672_0004953 | 3300047320 | Bacteria | 10698 |
| 330 | Ga0495672_0005366 | 3300047320 | Bacteria | 10192 |
| 331 | Ga0495672_0039051 | 3300047320 | Bacteria | 2890 |
| 332 | Ga0495676_0020860 | 3300047321 | Bacteria | 5738 |
| 333 | Ga0495683_0000641 | 3300047323 | Bacteria | 26026 |
| 334 | Ga0495683_0010085 | 3300047323 | Bacteria | 5007 |
| 335 | Ga0495683_0032410 | 3300047323 | Bacteria | 2662 |
| 336 | Ga0495687_001058 | 3300047443 | Bacteria | 27224 |
| 337 | Ga0495687_009328 | 3300047443 | Bacteria | 5496 |
| 338 | Ga0495687_024660 | 3300047443 | Bacteria | 2855 |
| 339 | Ga0495687_038245 | 3300047443 | Bacteria | 2130 |
| 340 | Ga0495677_0019898 | 3300047445 | Bacteria | 2433 |
| 341 | Ga0495677_0026531 | 3300047445 | Bacteria | 2101 |
| 342 | Ga0495685_000089 | 3300047447 | Bacteria | 33778 |
| 343 | Ga0495685_001993 | 3300047447 | Bacteria | 6335 |
| 344 | Ga0495685_005818 | 3300047447 | Bacteria | 4029 |
| 345 | Ga0495673_0008437 | 3300047469 | Bacteria | 5804 |
| 346 | Ga0495673_0009582 | 3300047469 | Bacteria | 5352 |
| 347 | Ga0495681_0021465 | 3300047470 | Bacteria | 3478 |
| 348 | Ga0495681_0025836 | 3300047470 | Bacteria | 3068 |
| 349 | Ga0495681_0030780 | 3300047470 | Bacteria | 2727 |
| 350 | Ga0495686_0001924 | 3300047472 | Bacteria | 20689 |
| 351 | Ga0495686_0006191 | 3300047472 | Bacteria | 9232 |
| 352 | Ga0495686_0025502 | 3300047472 | Bacteria | 3874 |
| 353 | Ga0495686_0066030 | 3300047472 | Bacteria | 2236 |
| 354 | Ga0495686_0106367 | 3300047472 | Bacteria | 1687 |
| 355 | Ga0495614_0195858 | 3300048089 | Bacteria | 913 |
| 356 | Ga0495615_0001030 | 3300048090 | Bacteria | 3972 |
| 357 | Ga0495615_0004164 | 3300048090 | Bacteria | 2498 |
| 358 | Ga0495626_0012789 | 3300048091 | Bacteria | 4384 |
| 359 | Ga0495626_0053468 | 3300048091 | Bacteria | 1858 |
| 360 | Ga0496100_0059172 | 3300048903 | Bacteria | 2517 |
| 361 | Ga0496101_0110045 | 3300048904 | Bacteria | 2073 |
| 362 | Ga0496101_0437062 | 3300048904 | Bacteria | 1032 |
| 363 | Ga0496102_0031979 | 3300048905 | Bacteria | 4724 |
| 364 | Ga0496102_0091926 | 3300048905 | Bacteria | 2809 |
| 365 | Ga0496103_0006150 | 3300048906 | Bacteria | 7174 |
| 366 | Ga0496104_0067814 | 3300048907 | Bacteria | 3390 |
| 367 | Ga0496108_0135580 | 3300048911 | Bacteria | 2118 |
| 368 | Ga0496110_0036308 | 3300048913 | Bacteria | 4279 |
| 369 | Ga0496111_0018382 | 3300048914 | Bacteria | 4842 |
| 370 | Ga0496111_0022128 | 3300048914 | Bacteria | 4447 |
| 371 | Ga0496114_0000238 | 3300048917 | Bacteria | 40176 |
| 372 | Ga0496114_0004791 | 3300048917 | Bacteria | 10533 |
| 373 | Ga0496114_0033069 | 3300048917 | Bacteria | 4260 |
| 374 | Ga0496115_0561339 | 3300048918 | Bacteria | 911 |
| 375 | Ga0496116_0011212 | 3300048919 | Bacteria | 7444 |
| 376 | Ga0496116_0016323 | 3300048919 | Bacteria | 5813 |
| 377 | Ga0496116_0029703 | 3300048919 | Bacteria | 3936 |
| 378 | Ga0496117_0000011 | 3300048920 | Bacteria | 610930 |
| 379 | Ga0496118_0000010 | 3300048921 | Bacteria | 610930 |
| 380 | Ga0496118_0009882 | 3300048921 | Bacteria | 9541 |
| 381 | Ga0496121_0008879 | 3300048924 | Bacteria | 11686 |
| 382 | Ga0496122_0001722 | 3300048925 | Bacteria | 33944 |
| 383 | Ga0496122_0002864 | 3300048925 | Bacteria | 23629 |
| 384 | Ga0496123_0000838 | 3300048926 | Bacteria | 49225 |
| 385 | Ga0496124_0104133 | 3300048927 | Bacteria | 2294 |
| 386 | Ga0496125_0001834 | 3300048928 | Bacteria | 29352 |
| 387 | Ga0496125_0002083 | 3300048928 | Bacteria | 26953 |
| 388 | Ga0496125_0016615 | 3300048928 | Bacteria | 7058 |
| 389 | Ga0496125_0037003 | 3300048928 | Bacteria | 4249 |
| 390 | Ga0495678_001731 | 3300049459 | Bacteria | 16268 |
| 391 | Ga0495678_016605 | 3300049459 | Bacteria | 3361 |
| 392 | Ga0495682_0000772 | 3300049460 | Bacteria | 20433 |
| 393 | Ga0495682_0002020 | 3300049460 | Bacteria | 10004 |
| 394 | Ga0501300_001068 | 3300049523 | Bacteria | 4164 |
| 395 | Ga0501032_0000904 | 3300049569 | Bacteria | 24050 |
| 396 | Ga0501032_0003376 | 3300049569 | Bacteria | 12246 |
| 397 | Ga0501033_0001114 | 3300049570 | Bacteria | 24394 |
| 398 | Ga0501033_0054677 | 3300049570 | Bacteria | 2953 |
| 399 | Ga0501033_0224372 | 3300049570 | Bacteria | 1336 |
| 400 | Ga0501034_0030553 | 3300049571 | Bacteria | 5476 |
| 401 | Ga0501036_0006047 | 3300049572 | Bacteria | 9814 |
| 402 | Ga0501036_0008386 | 3300049572 | Bacteria | 8468 |
| 403 | Ga0501036_0012920 | 3300049572 | Bacteria | 6934 |
| 404 | Ga0501036_0018690 | 3300049572 | Bacteria | 5812 |
| 405 | Ga0501036_0020972 | 3300049572 | Bacteria | 5488 |
| 406 | Ga0501036_0026549 | 3300049572 | Bacteria | 4889 |
| 407 | Ga0501037_0002319 | 3300049573 | Bacteria | 13752 |
| 408 | Ga0501037_0033410 | 3300049573 | Bacteria | 3800 |
| 409 | Ga0501038_0002374 | 3300049574 | Bacteria | 17532 |
| 410 | Ga0501038_0004014 | 3300049574 | Bacteria | 13673 |
| 411 | Ga0501038_0009000 | 3300049574 | Bacteria | 9163 |
| 412 | Ga0501038_0014100 | 3300049574 | Bacteria | 7281 |
| 413 | Ga0501038_0050973 | 3300049574 | Bacteria | 3575 |
| 414 | Ga0501038_0323273 | 3300049574 | Bacteria | 1206 |
| 415 | Ga0501039_0002786 | 3300049575 | Bacteria | 13058 |
| 416 | Ga0501039_0035354 | 3300049575 | Bacteria | 3855 |
| 417 | Ga0501039_0055867 | 3300049575 | Bacteria | 3058 |
| 418 | Ga0501039_0252150 | 3300049575 | Bacteria | 1387 |
| 419 | Ga0501040_0005625 | 3300049576 | Bacteria | 8100 |
| 420 | Ga0501040_0062005 | 3300049576 | Bacteria | 2572 |
| 421 | Ga0501041_0004998 | 3300049577 | Bacteria | 7719 |
| 422 | Ga0501041_0031668 | 3300049577 | Bacteria | 3196 |
| 423 | Ga0501042_0018033 | 3300049578 | Bacteria | 4882 |
| 424 | Ga0501042_0043568 | 3300049578 | Bacteria | 3196 |
| 425 | Ga0501043_0011383 | 3300049579 | Bacteria | 6962 |
| 426 | Ga0501043_0026339 | 3300049579 | Bacteria | 4562 |
| 427 | Ga0501043_0058092 | 3300049579 | Bacteria | 3037 |
| 428 | Ga0501043_0127590 | 3300049579 | Bacteria | 1994 |
| 429 | Ga0501046_0006115 | 3300049580 | Bacteria | 10699 |
| 430 | Ga0501046_0036321 | 3300049580 | Bacteria | 3966 |
| 431 | Ga0501046_0198269 | 3300049580 | Bacteria | 1494 |
| 432 | Ga0501046_0199058 | 3300049580 | Bacteria | 1491 |
| 433 | Ga0501047_0334699 | 3300049581 | Bacteria | 1352 |
| 434 | Ga0501048_0004201 | 3300049582 | Bacteria | 10977 |
| 435 | Ga0501048_0117980 | 3300049582 | Bacteria | 1875 |
| 436 | Ga0501048_0467805 | 3300049582 | Bacteria | 903 |
| 437 | Ga0501068_0001378 | 3300049584 | Bacteria | 12927 |
| 438 | Ga0501068_0008927 | 3300049584 | Bacteria | 5594 |
| 439 | Ga0501068_0130868 | 3300049584 | Bacteria | 1569 |
| 440 | Ga0501070_0059545 | 3300049586 | Bacteria | 3166 |
| 441 | Ga0501071_0009574 | 3300049587 | Bacteria | 6461 |
| 442 | Ga0501071_0017399 | 3300049587 | Bacteria | 4957 |
| 443 | Ga0501071_0284048 | 3300049587 | Bacteria | 1252 |
| 444 | Ga0501072_0018949 | 3300049588 | Bacteria | 5312 |
| 445 | Ga0501073_0001512 | 3300049589 | Bacteria | 17219 |
| 446 | Ga0501074_0048924 | 3300049590 | Bacteria | 3053 |
| 447 | Ga0501075_0002265 | 3300049591 | Bacteria | 12748 |
| 448 | Ga0501075_0004683 | 3300049591 | Bacteria | 9286 |
| 449 | Ga0501075_0462303 | 3300049591 | Bacteria | 968 |
| 450 | Ga0501076_0001952 | 3300049592 | Bacteria | 14070 |
| 451 | Ga0501076_0002356 | 3300049592 | Bacteria | 12930 |
| 452 | Ga0501076_0687801 | 3300049592 | Bacteria | 844 |
| 453 | Ga0501077_0010613 | 3300049593 | Bacteria | 5737 |
| 454 | Ga0501077_0096721 | 3300049593 | Bacteria | 1871 |
| 455 | Ga0501230_009847 | 3300049667 | Bacteria | 1479 |
| 456 | Ga0501238_006673 | 3300049671 | Bacteria | 1490 |
| 457 | Ga0501257_028703 | 3300049686 | Bacteria | 1335 |
| 458 | Ga0501079_0007874 | 3300049741 | Bacteria | 8071 |
| 459 | Ga0501079_0074061 | 3300049741 | Bacteria | 2632 |
| 460 | Ga0501079_0106940 | 3300049741 | Bacteria | 2171 |
| 461 | Ga0501079_0484368 | 3300049741 | Bacteria | 972 |
| 462 | Ga0501080_0001039 | 3300049742 | Bacteria | 22819 |
| 463 | Ga0501080_0030390 | 3300049742 | Bacteria | 5033 |
| 464 | Ga0501080_0069027 | 3300049742 | Bacteria | 3287 |
| 465 | Ga0501081_0000122 | 3300049743 | Bacteria | 34042 |
| 466 | Ga0501081_0004170 | 3300049743 | Bacteria | 9271 |
| 467 | Ga0501081_0109687 | 3300049743 | Bacteria | 1958 |
| 468 | Ga0501083_0015861 | 3300049744 | Bacteria | 5274 |
| 469 | Ga0501083_0106797 | 3300049744 | Bacteria | 1843 |
| 470 | Ga0501280_000528 | 3300049776 | Bacteria | 8971 |
| 471 | Ga0501035_0000743 | 3300049822 | Bacteria | 35105 |
| 472 | Ga0501035_0015347 | 3300049822 | Bacteria | 7071 |
| 473 | Ga0501044_0000068 | 3300049823 | Bacteria | 126642 |
| 474 | Ga0501044_0017513 | 3300049823 | Bacteria | 7688 |
| 475 | Ga0501044_0044286 | 3300049823 | Bacteria | 4618 |
| 476 | Ga0501044_0291054 | 3300049823 | Bacteria | 1564 |
| 477 | Ga0501045_0000986 | 3300049824 | Bacteria | 18652 |
| 478 | Ga0501045_0001250 | 3300049824 | Bacteria | 16894 |
| 479 | nmdc:mga0k408_191749_c1 | 3300050493 | Bacteria | 1219 |
| 480 | nmdc:mga0k408_1922_c1 | 3300050493 | Bacteria | 11126 |
| 481 | nmdc:mga09592_7683_c1 | 3300050508 | Bacteria | 8765 |
| 482 | nmdc:mga08y16_58969_c1 | 3300050511 | Bacteria | 4011 |
| 483 | nmdc:mga08y16_60045_c1 | 3300050511 | Bacteria | 3971 |
| 484 | Ga0495601_0006631 | 3300053077 | Bacteria | 6774 |
| 485 | Ga0500583_0023964 | 3300053092 | Bacteria | 2581 |
| 486 | Ga0500562_026268 | 3300053108 | Bacteria | 1526 |
| 487 | Ga0500569_023019 | 3300053109 | Bacteria | 1668 |
| 488 | Ga0500595_003784 | 3300053119 | Bacteria | 6962 |
| 489 | Ga0500607_127431 | 3300053121 | Bacteria | 1220 |
| 490 | Ga0500618_001706 | 3300053125 | Bacteria | 9369 |
| 491 | Ga0500618_001856 | 3300053125 | Bacteria | 8835 |
| 492 | Ga0500574_011403 | 3300053141 | Bacteria | 2005 |
| 493 | Ga0500619_001048 | 3300053154 | Bacteria | 4789 |
| 494 | Ga0500622_0000029 | 3300053156 | Bacteria | 213762 |
| 495 | Ga0500622_0005625 | 3300053156 | Bacteria | 7467 |
| 496 | Ga0500636_0000417 | 3300053177 | Bacteria | 23409 |
| 497 | Ga0501084_0016674 | 3300054114 | Bacteria | 6102 |
| 498 | Ga0501084_0036338 | 3300054114 | Bacteria | 4115 |
| 499 | Ga0501084_0202174 | 3300054114 | Bacteria | 1676 |
| 500 | Ga0500661_017398 | 3300055283 | Bacteria | 1284 |
| 501 | Ga0587080_022548 | 3300059503 | Bacteria | 1044 |
| 502 | Ga0501082_0001249 | 3300060353 | Bacteria | 22335 |
| 503 | Ga0501082_0031086 | 3300060353 | Bacteria | 4602 |
| 504 | Ga0501082_0167686 | 3300060353 | Bacteria | 1908 |
| 505 | Ga0530510_0010206 | 3300061734 | Bacteria | 6581 |
| 506 | Ga0530510_0109219 | 3300061734 | Bacteria | 2025 |
| 507 | 2511251671 | 2511231003 | Bacteria | 5606035 |
| 508 | 2511385467 | 2511231026 | Bacteria | 5225445 |
| 509 | 2521559006 | 2521172590 | Bacteria | 5047645 |
| 510 | 2550694421 | 2548876994 | Bacteria | 4904866 |
| 511 | 2553003807 | 2551306416 | Bacteria | 6152985 |
| 512 | 2601669683 | 2600255292 | Bacteria | 6300551 |
| 513 | 2617919081 | 2617270889 | Bacteria | 9064343 |
| 514 | 2644027708 | 2643221603 | Bacteria | 6147767 |
| 515 | 2644255173 | 2643221645 | Bacteria | 7207331 |
| 516 | 2644359739 | 2643221664 | Bacteria | 7272945 |
| 517 | 2738742800 | 2738541280 | Bacteria | 6630198 |
| 518 | 2738847054 | 2738541300 | Bacteria | 6675882 |
| 519 | 2739277824 | 2738543018 | Bacteria | 6718814 |
| 520 | 2739346867 | 2738543030 | Bacteria | 6719714 |
| 521 | 2765568747 | 2765235838 | Bacteria | 5445269 |
| 522 | 2808981492 | 2808606386 | Bacteria | 4471946 |
| 523 | 2809129074 | 2808606415 | Bacteria | 4576710 |
| 524 | 2809148694 | 2808606419 | Bacteria | 4576925 |
| 525 | 2819542950 | 2818991436 | Bacteria | 5376622 |
| 526 | 2819591303 | 2818991445 | Bacteria | 4955017 |
| 527 | 2819615524 | 2818991449 | Bacteria | 5518009 |
| 528 | 2831428880 | 2831426010 | Bacteria | 8662725 |
| 529 | 2839096370 | 2839094727 | Bacteria | 5534556 |
| 530 | 2848696537 | 2848694841 | Bacteria | 9205737 |
| 531 | 2849664148 | 2849660919 | Bacteria | 8251853 |
| 532 | 2852621231 | 2852618963 | Bacteria | 4577824 |
| 533 | 2857549806 | 2857547612 | Bacteria | 6179999 |
| 534 | 2884816070 | 2884811622 | Bacteria | 5552861 |
| 535 | 2884837092 | 2884836552 | Bacteria | 5219991 |
| 536 | 2884853384 | 2884852848 | Bacteria | 5221161 |
| 537 | 2885080287 | 2885080285 | Bacteria | 6355622 |
| 538 | 2886633965 | 2886627955 | Bacteria | 7618130 |
| 539 | 2891634253 | 2891633521 | Bacteria | 4602265 |
| 540 | 2896155499 | 2896154374 | Bacteria | 5221518 |
| 541 | 2904444923 | 2904439833 | Bacteria | 5931679 |
| 542 | 2904532265 | 2904530477 | Bacteria | 5876334 |
| 543 | 2904584707 | 2904584206 | Bacteria | 6028872 |
| 544 | 2904591175 | 2904589729 | Bacteria | 6113573 |
| 545 | 2904605232 | 2904601388 | Bacteria | 5884906 |
| 546 | 2913852226 | 2913844669 | Bacteria | 8381711 |
| 547 | 2913915991 | 2913912277 | Bacteria | 9037797 |
| 548 | 2913944283 | 2913939268 | Bacteria | 8559644 |
| 549 | 2919048399 | 2919046199 | Bacteria | 5567169 |
| 550 | 2919081078 | 2919079590 | Bacteria | 5946433 |
| 551 | 2923512663 | 2923510766 | Bacteria | 5926163 |
| 552 | 2928132685 | 2928130867 | Bacteria | 5467269 |
| 553 | 2932415885 | 2932410948 | Bacteria | 6312192 |
| 554 | 2932421875 | 2932416698 | Bacteria | 6315112 |
| 555 | 642601802 | 642555144 | Bacteria | 9059191 |
| 556 | Ga0495651_0002551 | |||
| 557 | JGI25155J39150_1000331 | |||
| 558 | JGI25155J39150_1000387 | |||
| 559 | JGI25156J39149_1000848 | |||
| 560 | JGI25156J39149_1002710 | |||
| 561 | JGI25162J39368_1000941 | |||
| 562 | JGI25162J39368_1007041 | |||
| 563 | JGI25154J39366_1000290 | |||
| 564 | JGI25154J39366_1000391 | |||
| 565 | JGI25157J39369_1001917 | |||
| 566 | JGI25164J39214_1009618 | |||
| 567 | JGI25165J46597_1001005 | |||
| 568 | rootL2_10039155 | |||
| 569 | Ga0007416J51690_1099222 | |||
| 570 | Ga0055538_1000030 | |||
| 571 | Ga0055538_1000368 | |||
| 572 | Ga0055539_1000040 | |||
| 573 | Ga0055539_1000374 | |||
| 574 | Ga0055533_1000050 | |||
| 575 | Ga0055533_1000368 | |||
| 576 | Ga0055532_1000016 | |||
| 577 | Ga0055525_1000060 | |||
| 578 | Ga0055525_1000516 | |||
| 579 | Ga0055535_1006588 | |||
| 580 | Ga0055529_1000342 | |||
| 581 | Ga0055526_1000010 | |||
| 582 | Ga0055537_1000592 | |||
| 583 | Ga0055524_1000025 | |||
| 584 | Ga0055524_1009482 | |||
| 585 | Ga0055534_1000428 | |||
| 586 | Ga0055528_1000298 | |||
| 587 | Ga0055541_1000027 | |||
| 588 | Ga0055541_1000258 | |||
| 589 | Ga0055543_1003841 | |||
| 590 | Ga0065165_1000438 | |||
| 591 | Ga0065714_10089834 | |||
| 592 | Ga0065707_10185809 | |||
| 593 | Ga0070660_100002479 | |||
| 594 | Ga0070661_100012765 | |||
| 595 | Ga0070674_100031732 | |||
| 596 | Ga0070709_10482045 | |||
| 597 | Ga0070714_100071332 | |||
| 598 | Ga0070678_100015633 | |||
| 599 | Ga0070662_100193259 | |||
| 600 | Ga0068867_100034699 | |||
| 601 | Ga0070704_100267604 | |||
| 602 | Ga0068855_100001055 | |||
| 603 | Ga0070664_100011397 | |||
| 604 | Ga0068854_100014480 | |||
| 605 | Ga0068856_100647884 | |||
| 606 | Ga0068852_100169750 | |||
| 607 | Ga0068860_100119924 | |||
| 608 | Ga0075366_10001681 | |||
| 609 | Ga0075366_10280747 | |||
| 610 | Ga0097621_100231136 | |||
| 611 | Ga0068871_100084635 | |||
| 612 | Ga0075428_100001103 | |||
| 613 | Ga0075429_100001612 | |||
| 614 | Ga0079104_1010838 | |||
| 615 | Ga0099826_10000005 | |||
| 616 | Ga0099795_10031637 | |||
| 617 | Ga0105240_10004718 | |||
| 618 | Ga0105240_10013236 | |||
| 619 | Ga0105240_10225485 | |||
| 620 | Ga0111539_10006197 | |||
| 621 | Ga0105242_10062283 | |||
| 622 | Ga0105248_10087249 | |||
| 623 | Ga0105237_10038041 | |||
| 624 | Ga0105238_10000194 | |||
| 625 | Ga0105238_10038772 | |||
| 626 | Ga0105239_10034172 | |||
| 627 | Ga0157370_10135726 | |||
| 628 | Ga0157374_10107514 | |||
| 629 | Ga0157372_10166592 | |||
| 630 | Ga0157375_10694492 | |||
| 631 | Ga0182008_10000724 | |||
| 632 | Ga0182008_10128118 | |||
| 633 | Ga0182006_1000004 | |||
| 634 | Ga0182006_1017377 | |||
| 635 | Ga0182006_1017650 | |||
| 636 | Ga0182007_10000017 | |||
| 637 | Ga0182007_10008300 | |||
| 638 | Ga0182005_1000030 | |||
| 639 | Ga0182005_1000962 | |||
| 640 | Ga0163161_10007639 | |||
| 641 | Ga0163161_10070889 | |||
| 642 | Ga0163161_10679374 | |||
| 643 | Ga0213872_10000283 | |||
| 644 | Ga0213872_10000448 | |||
| 645 | Ga0213872_10008525 | |||
| 646 | Ga0213872_10022207 | |||
| 647 | Ga0209435_100016 | |||
| 648 | Ga0209435_100256 | |||
| 649 | Ga0209760_101393 | |||
| 650 | Ga0209784_100005 | |||
| 651 | Ga0209784_100020 | |||
| 652 | Ga0209566_100005 | |||
| 653 | Ga0209566_100020 | |||
| 654 | Ga0209674_100009 | |||
| 655 | Ga0209674_100035 | |||
| 656 | Ga0209147_100023 | |||
| 657 | Ga0209563_100012 | |||
| 658 | Ga0209563_100038 | |||
| 659 | Ga0207427_100502 | |||
| 660 | Ga0209437_100066 | |||
| 661 | Ga0209437_100080 | |||
| 662 | Ga0209258_100210 | |||
| 663 | Ga0209646_1000033 | |||
| 664 | Ga0209646_1000036 | |||
| 665 | Ga0209646_1000200 | |||
| 666 | Ga0209026_1000031 | |||
| 667 | Ga0209026_1008366 | |||
| 668 | Ga0209677_100006 | |||
| 669 | Ga0209677_100031 | |||
| 670 | Ga0209759_1000045 | |||
| 671 | Ga0209759_1000384 | |||
| 672 | Ga0209233_1000060 | |||
| 673 | Ga0209565_1000068 | |||
| 674 | Ga0209565_1003187 | |||
| 675 | Ga0209455_1000047 | |||
| 676 | Ga0209455_1005495 | |||
| 677 | Ga0209673_1000119 | |||
| 678 | Ga0209130_1000057 | |||
| 679 | Ga0209675_1000068 | |||
| 680 | Ga0209675_1020404 | |||
| 681 | Ga0209564_1000060 | |||
| 682 | Ga0209564_1000141 | |||
| 683 | Ga0209564_1000149 | |||
| 684 | Ga0209564_1019340 | |||
| 685 | Ga0209256_1000040 | |||
| 686 | Ga0209256_1001036 | |||
| 687 | Ga0207656_10174922 | |||
| 688 | Ga0207655_1011084 | |||
| 689 | Ga0207695_10000851 | |||
| 690 | Ga0207695_10011378 | |||
| 691 | Ga0207695_10041692 | |||
| 692 | Ga0207657_10005609 | |||
| 693 | Ga0207657_10262481 | |||
| 694 | Ga0207649_10011361 | |||
| 695 | Ga0207694_10000615 | |||
| 696 | Ga0207694_10196847 | |||
| 697 | Ga0207659_10237884 | |||
| 698 | Ga0207690_10001939 | |||
| 699 | Ga0207690_10180556 | |||
| 700 | Ga0207686_10077140 | |||
| 701 | Ga0207709_10034294 | |||
| 702 | Ga0207704_10460712 | |||
| 703 | Ga0207679_10008944 | |||
| 704 | Ga0207667_10000073 | |||
| 705 | Ga0207667_10000076 | |||
| 706 | Ga0207667_10015829 | |||
| 707 | Ga0207667_10100844 | |||
| 708 | Ga0207658_10347751 | |||
| 709 | Ga0207702_10190639 | |||
| 710 | Ga0207675_100303332 | |||
| 711 | Ga0207683_10002101 | |||
| 712 | Ga0207698_10723071 | |||
| 713 | Ga0209282_1000003 | |||
| 714 | Ga0209588_1025807 | |||
| 715 | Ga0207428_10002526 | |||
| 716 | Ga0207428_10032970 | |||
| 717 | Ga0268264_10058489 | |||
| 718 | Ga0307515_10005473 | |||
| 719 | Ga0265324_10000018 | |||
| 720 | Ga0265325_10000363 | |||
| 721 | Ga0307509_10000050 | |||
| 722 | Ga0307408_100000740 | |||
| 723 | Ga0265314_10014128 | |||
| 724 | Ga0265314_10027818 | |||
| 725 | Ga0307516_10406761 | |||
| 726 | Ga0307518_10025524 | |||
| 727 | Ga0373923_0052377 | |||
| 728 | Ga0373937_0095554 | |||
| 729 | Ga0395899_0004633 | |||
| 730 | Ga0395899_0027570 | |||
| 731 | Ga0395899_0035781 | |||
| 732 | Ga0395900_0003354 | |||
| 733 | Ga0395900_0157336 | |||
| 734 | Ga0395900_0203968 | |||
| 735 | Ga0395900_0653567 | |||
| 736 | Ga0395898_0020581 | |||
| 737 | Ga0395905_0002331 | |||
| 738 | Ga0395905_0011968 | |||
| 739 | Ga0395905_0033008 | |||
| 740 | Ga0395901_0201605 | |||
| 741 | Ga0395901_0206228 | |||
| 742 | Ga0395901_0749060 | |||
| 743 | Ga0436361_0114843 | |||
| 744 | Ga0436361_0280623 | |||
| 745 | Ga0436361_0615250 | |||
| 746 | Ga0436361_1026213 | |||
| 747 | Ga0439461_0000887 | |||
| 748 | Ga0439446_0001108 | |||
| 749 | Ga0439434_0001969 | |||
| 750 | Ga0451577_0000409 | |||
| 751 | Ga0451577_0120782 | |||
| 752 | Ga0451577_0376954 | |||
| 753 | Ga0466972_0042347 | |||
| 754 | Ga0466972_0060036 | |||
| 755 | Ga0453683_0011565 | |||
| 756 | Ga0453683_0082009 | |||
| 757 | Ga0466965_0001702 | |||
| 758 | Ga0466965_0022133 | |||
| 759 | Ga0466965_0033198 | |||
| 760 | Ga0466966_0045365 | |||
| 761 | Ga0466964_0013674 | |||
| 762 | Ga0453684_0000005 | |||
| 763 | Ga0453684_0624808 | |||
| 764 | Ga0466971_0048903 | |||
| 765 | Ga0466968_0000467 | |||
| 766 | Ga0466968_0001884 | |||
| 767 | Ga0466970_0042537 | |||
| 768 | Ga0451576_0000335 | |||
| 769 | Ga0451576_0012915 | |||
| 770 | Ga0451576_0057728 | |||
| 771 | Ga0451576_0065459 | |||
| 772 | Ga0451576_0079479 | |||
| 773 | Ga0495617_034349 | |||
| 774 | Ga0495617_039497 | |||
| 775 | Ga0495590_0058105 | |||
| 776 | Ga0495638_0007066 | |||
| 777 | Ga0495651_0119465 | |||
| 778 | Ga0495650_0001069 | |||
| 779 | Ga0495605_0004560 | |||
| 780 | Ga0495584_0000544 | |||
| 781 | Ga0495584_0011324 | |||
| 782 | Ga0495584_0013518 | |||
| 783 | Ga0495584_0120379 | |||
| 784 | Ga0495585_0007028 | |||
| 785 | Ga0495585_0014777 | |||
| 786 | Ga0495596_0001359 | |||
| 787 | Ga0495607_0012096 | |||
| 788 | Ga0495607_0015886 | |||
| 789 | Ga0495607_0046718 | |||
| 790 | Ga0495607_0110712 | |||
| 791 | Ga0495583_0000228 | |||
| 792 | Ga0495583_0003802 | |||
| 793 | Ga0495583_0021620 | |||
| 794 | Ga0495583_0042789 | |||
| 795 | Ga0495606_0000622 | |||
| 796 | Ga0495606_0003966 | |||
| 797 | Ga0495606_0005790 | |||
| 798 | Ga0495606_0018737 | |||
| 799 | Ga0495606_0032141 | |||
| 800 | Ga0495606_0073162 | |||
| 801 | Ga0495616_0001055 | |||
| 802 | Ga0495616_0012451 | |||
| 803 | Ga0495616_0018674 | |||
| 804 | Ga0495628_0000767 | |||
| 805 | Ga0495628_0011286 | |||
| 806 | Ga0495631_0017335 | |||
| 807 | Ga0495632_0003177 | |||
| 808 | Ga0495643_0003417 | |||
| 809 | Ga0495643_0155878 | |||
| 810 | Ga0495644_0003542 | |||
| 811 | Ga0495644_0005059 | |||
| 812 | Ga0495644_0043730 | |||
| 813 | Ga0495644_0053362 | |||
| 814 | Ga0495648_0002442 | |||
| 815 | Ga0495663_0014412 | |||
| 816 | Ga0495663_0020978 | |||
| 817 | Ga0495642_0015478 | |||
| 818 | Ga0495642_0024499 | |||
| 819 | Ga0495642_0042583 | |||
| 820 | Ga0495652_0029454 | |||
| 821 | Ga0495652_0042994 | |||
| 822 | Ga0495652_0079292 | |||
| 823 | Ga0495652_0123596 | |||
| 824 | Ga0495654_0019800 | |||
| 825 | Ga0495665_0100875 | |||
| 826 | Ga0495586_0043564 | |||
| 827 | Ga0495609_0000094 | |||
| 828 | Ga0495609_0001186 | |||
| 829 | Ga0495609_0014204 | |||
| 830 | Ga0495609_0087657 | |||
| 831 | Ga0495621_0153406 | |||
| 832 | Ga0495597_0036123 | |||
| 833 | Ga0495597_0054761 | |||
| 834 | Ga0495597_0100554 | |||
| 835 | Ga0495597_0126845 | |||
| 836 | Ga0495622_0000434 | |||
| 837 | Ga0495622_0076280 | |||
| 838 | Ga0495633_0000763 | |||
| 839 | Ga0495633_0004545 | |||
| 840 | Ga0495633_0027960 | |||
| 841 | Ga0495633_0044116 | |||
| 842 | Ga0495633_0103303 | |||
| 843 | Ga0495656_0007094 | |||
| 844 | Ga0495668_0000330 | |||
| 845 | Ga0495668_0007416 | |||
| 846 | Ga0495668_0010434 | |||
| 847 | Ga0495668_0011411 | |||
| 848 | Ga0495611_0009507 | |||
| 849 | Ga0495625_0002821 | |||
| 850 | Ga0495625_0003372 | |||
| 851 | Ga0495625_0006154 | |||
| 852 | Ga0495625_0069082 | |||
| 853 | Ga0495625_0180178 | |||
| 854 | Ga0495635_0116820 | |||
| 855 | Ga0495659_0001490 | |||
| 856 | Ga0495659_0001937 | |||
| 857 | Ga0495659_0003169 | |||
| 858 | Ga0495661_0008874 | |||
| 859 | Ga0495661_0096698 | |||
| 860 | Ga0495588_0010401 | |||
| 861 | Ga0495599_0062335 | |||
| 862 | Ga0495623_0007800 | |||
| 863 | Ga0495623_0120190 | |||
| 864 | Ga0495646_0004104 | |||
| 865 | Ga0495624_0055898 | |||
| 866 | Ga0495624_0114563 | |||
| 867 | Ga0495670_0017126 | |||
| 868 | Ga0495670_0025056 | |||
| 869 | Ga0495671_0006069 | |||
| 870 | Ga0495671_0008140 | |||
| 871 | Ga0495671_0219088 | |||
| 872 | Ga0495649_0010995 | |||
| 873 | Ga0495589_0105300 | |||
| 874 | Ga0495600_0057295 | |||
| 875 | Ga0495660_0002356 | |||
| 876 | Ga0495660_0013896 | |||
| 877 | Ga0495660_0047307 | |||
| 878 | Ga0495581_0108455 | |||
| 879 | Ga0495604_0052090 | |||
| 880 | Ga0495636_0000384 | |||
| 881 | Ga0495636_0002813 | |||
| 882 | Ga0495636_0161112 | |||
| 883 | Ga0495672_0000361 | |||
| 884 | Ga0495672_0004953 | |||
| 885 | Ga0495672_0005366 | |||
| 886 | Ga0495672_0039051 | |||
| 887 | Ga0495676_0020860 | |||
| 888 | Ga0495683_0000641 | |||
| 889 | Ga0495683_0010085 | |||
| 890 | Ga0495683_0032410 | |||
| 891 | Ga0495687_001058 | |||
| 892 | Ga0495687_009328 | |||
| 893 | Ga0495687_024660 | |||
| 894 | Ga0495687_038245 | |||
| 895 | Ga0495677_0019898 | |||
| 896 | Ga0495677_0026531 | |||
| 897 | Ga0495685_000089 | |||
| 898 | Ga0495685_001993 | |||
| 899 | Ga0495685_005818 | |||
| 900 | Ga0495673_0008437 | |||
| 901 | Ga0495673_0009582 | |||
| 902 | Ga0495681_0021465 | |||
| 903 | Ga0495681_0025836 | |||
| 904 | Ga0495681_0030780 | |||
| 905 | Ga0495686_0001924 | |||
| 906 | Ga0495686_0006191 | |||
| 907 | Ga0495686_0025502 | |||
| 908 | Ga0495686_0066030 | |||
| 909 | Ga0495686_0106367 | |||
| 910 | Ga0495614_0195858 | |||
| 911 | Ga0495615_0001030 | |||
| 912 | Ga0495615_0004164 | |||
| 913 | Ga0495626_0012789 | |||
| 914 | Ga0495626_0053468 | |||
| 915 | Ga0496100_0059172 | |||
| 916 | Ga0496101_0110045 | |||
| 917 | Ga0496101_0437062 | |||
| 918 | Ga0496102_0031979 | |||
| 919 | Ga0496102_0091926 | |||
| 920 | Ga0496103_0006150 | |||
| 921 | Ga0496104_0067814 | |||
| 922 | Ga0496108_0135580 | |||
| 923 | Ga0496110_0036308 | |||
| 924 | Ga0496111_0018382 | |||
| 925 | Ga0496111_0022128 | |||
| 926 | Ga0496114_0000238 | |||
| 927 | Ga0496114_0004791 | |||
| 928 | Ga0496114_0033069 | |||
| 929 | Ga0496115_0561339 | |||
| 930 | Ga0496116_0011212 | |||
| 931 | Ga0496116_0016323 | |||
| 932 | Ga0496116_0029703 | |||
| 933 | Ga0496117_0000011 | |||
| 934 | Ga0496118_0000010 | |||
| 935 | Ga0496118_0009882 | |||
| 936 | Ga0496121_0008879 | |||
| 937 | Ga0496122_0001722 | |||
| 938 | Ga0496122_0002864 | |||
| 939 | Ga0496123_0000838 | |||
| 940 | Ga0496124_0104133 | |||
| 941 | Ga0496125_0001834 | |||
| 942 | Ga0496125_0002083 | |||
| 943 | Ga0496125_0016615 | |||
| 944 | Ga0496125_0037003 | |||
| 945 | Ga0495678_001731 | |||
| 946 | Ga0495678_016605 | |||
| 947 | Ga0495682_0000772 | |||
| 948 | Ga0495682_0002020 | |||
| 949 | Ga0501300_001068 | |||
| 950 | Ga0501032_0000904 | |||
| 951 | Ga0501032_0003376 | |||
| 952 | Ga0501033_0001114 | |||
| 953 | Ga0501033_0054677 | |||
| 954 | Ga0501033_0224372 | |||
| 955 | Ga0501034_0030553 | |||
| 956 | Ga0501036_0006047 | |||
| 957 | Ga0501036_0008386 | |||
| 958 | Ga0501036_0012920 | |||
| 959 | Ga0501036_0018690 | |||
| 960 | Ga0501036_0020972 | |||
| 961 | Ga0501036_0026549 | |||
| 962 | Ga0501037_0002319 | |||
| 963 | Ga0501037_0033410 | |||
| 964 | Ga0501038_0002374 | |||
| 965 | Ga0501038_0004014 | |||
| 966 | Ga0501038_0009000 | |||
| 967 | Ga0501038_0014100 | |||
| 968 | Ga0501038_0050973 | |||
| 969 | Ga0501038_0323273 | |||
| 970 | Ga0501039_0002786 | |||
| 971 | Ga0501039_0035354 | |||
| 972 | Ga0501039_0055867 | |||
| 973 | Ga0501039_0252150 | |||
| 974 | Ga0501040_0005625 | |||
| 975 | Ga0501040_0062005 | |||
| 976 | Ga0501041_0004998 | |||
| 977 | Ga0501041_0031668 | |||
| 978 | Ga0501042_0018033 | |||
| 979 | Ga0501042_0043568 | |||
| 980 | Ga0501043_0011383 | |||
| 981 | Ga0501043_0026339 | |||
| 982 | Ga0501043_0058092 | |||
| 983 | Ga0501043_0127590 | |||
| 984 | Ga0501046_0006115 | |||
| 985 | Ga0501046_0036321 | |||
| 986 | Ga0501046_0198269 | |||
| 987 | Ga0501046_0199058 | |||
| 988 | Ga0501047_0334699 | |||
| 989 | Ga0501048_0004201 | |||
| 990 | Ga0501048_0117980 | |||
| 991 | Ga0501048_0467805 | |||
| 992 | Ga0501068_0001378 | |||
| 993 | Ga0501068_0008927 | |||
| 994 | Ga0501068_0130868 | |||
| 995 | Ga0501070_0059545 | |||
| 996 | Ga0501071_0009574 | |||
| 997 | Ga0501071_0017399 | |||
| 998 | Ga0501071_0284048 | |||
| 999 | Ga0501072_0018949 | |||
| 1000 | Ga0501073_0001512 | |||
| 1001 | Ga0501074_0048924 | |||
| 1002 | Ga0501075_0002265 | |||
| 1003 | Ga0501075_0004683 | |||
| 1004 | Ga0501075_0462303 | |||
| 1005 | Ga0501076_0001952 | |||
| 1006 | Ga0501076_0002356 | |||
| 1007 | Ga0501076_0687801 | |||
| 1008 | Ga0501077_0010613 | |||
| 1009 | Ga0501077_0096721 | |||
| 1010 | Ga0501230_009847 | |||
| 1011 | Ga0501238_006673 | |||
| 1012 | Ga0501257_028703 | |||
| 1013 | Ga0501079_0007874 | |||
| 1014 | Ga0501079_0074061 | |||
| 1015 | Ga0501079_0106940 | |||
| 1016 | Ga0501079_0484368 | |||
| 1017 | Ga0501080_0001039 | |||
| 1018 | Ga0501080_0030390 | |||
| 1019 | Ga0501080_0069027 | |||
| 1020 | Ga0501081_0000122 | |||
| 1021 | Ga0501081_0004170 | |||
| 1022 | Ga0501081_0109687 | |||
| 1023 | Ga0501083_0015861 | |||
| 1024 | Ga0501083_0106797 | |||
| 1025 | Ga0501280_000528 | |||
| 1026 | Ga0501035_0000743 | |||
| 1027 | Ga0501035_0015347 | |||
| 1028 | Ga0501044_0000068 | |||
| 1029 | Ga0501044_0017513 | |||
| 1030 | Ga0501044_0044286 | |||
| 1031 | Ga0501044_0291054 | |||
| 1032 | Ga0501045_0000986 | |||
| 1033 | Ga0501045_0001250 | |||
| 1034 | nmdc:mga0k408_191749_c1 | |||
| 1035 | nmdc:mga0k408_1922_c1 | |||
| 1036 | nmdc:mga09592_7683_c1 | |||
| 1037 | nmdc:mga08y16_58969_c1 | |||
| 1038 | nmdc:mga08y16_60045_c1 | |||
| 1039 | Ga0495601_0006631 | |||
| 1040 | Ga0500583_0023964 | |||
| 1041 | Ga0500562_026268 | |||
| 1042 | Ga0500569_023019 | |||
| 1043 | Ga0500595_003784 | |||
| 1044 | Ga0500607_127431 | |||
| 1045 | Ga0500618_001706 | |||
| 1046 | Ga0500618_001856 | |||
| 1047 | Ga0500574_011403 | |||
| 1048 | Ga0500619_001048 | |||
| 1049 | Ga0500622_0000029 | |||
| 1050 | Ga0500622_0005625 | |||
| 1051 | Ga0500636_0000417 | |||
| 1052 | Ga0501084_0016674 | |||
| 1053 | Ga0501084_0036338 | |||
| 1054 | Ga0501084_0202174 | |||
| 1055 | Ga0500661_017398 | |||
| 1056 | Ga0587080_022548 | |||
| 1057 | Ga0501082_0001249 | |||
| 1058 | Ga0501082_0031086 | |||
| 1059 | Ga0501082_0167686 | |||
| 1060 | Ga0530510_0010206 | |||
| 1061 | Ga0530510_0109219 | |||
| 1062 | 2511251671 | |||
| 1063 | 2511385467 | |||
| 1064 | 2521559006 | |||
| 1065 | 2550694421 | |||
| 1066 | 2553003807 | |||
| 1067 | 2601669683 | |||
| 1068 | 2617919081 | |||
| 1069 | 2644027708 | |||
| 1070 | 2644255173 | |||
| 1071 | 2644359739 | |||
| 1072 | 2738742800 | |||
| 1073 | 2738847054 | |||
| 1074 | 2739277824 | |||
| 1075 | 2739346867 | |||
| 1076 | 2765568747 | |||
| 1077 | 2808981492 | |||
| 1078 | 2809129074 | |||
| 1079 | 2809148694 | |||
| 1080 | 2819542950 | |||
| 1081 | 2819591303 | |||
| 1082 | 2819615524 | |||
| 1083 | 2831428880 | |||
| 1084 | 2839096370 | |||
| 1085 | 2848696537 | |||
| 1086 | 2849664148 | |||
| 1087 | 2852621231 | |||
| 1088 | 2857549806 | |||
| 1089 | 2884816070 | |||
| 1090 | 2884837092 | |||
| 1091 | 2884853384 | |||
| 1092 | 2885080287 | |||
| 1093 | 2886633965 | |||
| 1094 | 2891634253 | |||
| 1095 | 2896155499 | |||
| 1096 | 2904444923 | |||
| 1097 | 2904532265 | |||
| 1098 | 2904584707 | |||
| 1099 | 2904591175 | |||
| 1100 | 2904605232 | |||
| 1101 | 2913852226 | |||
| 1102 | 2913915991 | |||
| 1103 | 2913944283 | |||
| 1104 | 2919048399 | |||
| 1105 | 2919081078 | |||
| 1106 | 2923512663 | |||
| 1107 | 2928132685 | |||
| 1108 | 2932415885 | |||
| 1109 | 2932421875 | |||
| 1110 | 642601802 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.98 | 1 | 255 |
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9785 | 3 | 255 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.9762 | 1 | 255 |
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9672 | 3 | 255 |
| 2voa-assembly1.cif.gz_B | structure of an ap endonuclease from archaeoglobus fulgidus | 0.9656 | 1 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9816 | 1 | 255 | 3.60.10.10 |
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9778 | 1 | 255 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9601 | 1 | 255 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9564 | 1 | 255 | 3.60.10.10 |
| af_P96273_24_289_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9547 | 3 | 255 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3IVF8-F1-model_v4 | deleted | 0.9938 | 3 | 179 |
|
| AF-A0A658BMW6-F1-model_v4 | Exodeoxyribonuclease III | 0.9926 | 3 | 176 |
GO:0006281
GO:0008311 GO:0046872 |
| AF-A0A0E2YYA8-F1-model_v4 | Exodeoxyribonuclease III | 0.9925 | 93 | 193 |
GO:0006281
GO:0008311 |
| AF-A0A522A026-F1-model_v4 | Exodeoxyribonuclease III | 0.9924 | 104 | 255 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
| AF-A0A1I2KBF9-F1-model_v4 | Exodeoxyribonuclease III | 0.9923 | 2 | 255 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |