F463141

General Info

Members Datasets Scaffolds Average Seq Length
555 326 1110 257

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0002551|Ga0495651_0002551_210_1133
Length 307
Sequence MSRSDSGYSDEVTDSNGEEPPPLGVKCECEKKSKTPHQRGAVQIPNLVKKSNMQKIATWNVNSLKVRLPQVLQWLADNPVDVLALQETKLTDDKFPAAEIEAAGYHVAFSGQKTYNGVAILSRHPITDVVKNNPLYDDLQQRIIAATIDGMRIVCAYIPNGQAPDTEKYQYKLKWLDALHDWLQDECRQHPKLALMGDYNIAPEDRDVHDPAAWVGQNLVSPPERAAFVRLQGLGLTDAFRMFEQPEKLFSWWDYRQMGFRLNRGMRIDHILLSSPLAAQCSACVIDKVPRKWEQPSDHAPVIATLE

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
69 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
203 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
223 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
224 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
249 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
250 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
264 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
265 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
270 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
275 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
279 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
280 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
281 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
282 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
283 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
284 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
285 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
286 2643221645 Massilia sp. Root351 Isolate Unclassified
287 2643221664 Massilia sp. Root418 Isolate Unclassified
288 2738541280 Massilia sp. GV090 Isolate Unclassified
289 2738541300 Massilia sp. GV016 Isolate Unclassified
290 2738543018 Massilia sp. GV045 Isolate Unclassified
291 2738543030 Massilia sp. GV097 Isolate Unclassified
292 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
293 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
294 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
295 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
296 2818991436 Collimonas arenae 515 Isolate Unclassified
297 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
298 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
299 2831426010 Nostoc sp. 106C Isolate Unclassified
300 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
301 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
302 2849660919 Nostoc sp. T09 Isolate Unclassified
303 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
304 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
305 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
306 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
307 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
308 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
309 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
310 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
311 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
312 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
313 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
314 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
315 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
316 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
317 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
318 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
319 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
320 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
321 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
322 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
323 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
324 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
325 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
326 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.81
Metatranscriptomes 0.36
Isolates 8.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.15
Nodule 1.08
Rhizoplane 2.88
Rhizosphere 70.81
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0002551 3300046462 Bacteria 14085
2 JGI25155J39150_1000331 3300002704 Bacteria 15383
3 JGI25155J39150_1000387 3300002704 Bacteria 12533
4 JGI25156J39149_1000848 3300002705 Bacteria 15364
5 JGI25156J39149_1002710 3300002705 Bacteria 6191
6 JGI25162J39368_1000941 3300002737 Bacteria 18693
7 JGI25162J39368_1007041 3300002737 Bacteria 1817
8 JGI25154J39366_1000290 3300002738 Bacteria 30181
9 JGI25154J39366_1000391 3300002738 Bacteria 23872
10 JGI25157J39369_1001917 3300002741 Bacteria 6288
11 JGI25164J39214_1009618 3300002772 Bacteria 947
12 JGI25165J46597_1001005 3300003214 Bacteria 18693
13 rootL2_10039155 3300003322 Bacteria 9743
14 Ga0007416J51690_1099222 3300003577 Bacteria 970
15 Ga0055538_1000030 3300003751 Bacteria 200831
16 Ga0055538_1000368 3300003751 Bacteria 18693
17 Ga0055539_1000040 3300003752 Bacteria 200831
18 Ga0055539_1000374 3300003752 Bacteria 18693
19 Ga0055533_1000050 3300003756 Bacteria 200831
20 Ga0055533_1000368 3300003756 Bacteria 18693
21 Ga0055532_1000016 3300003758 Bacteria 327509
22 Ga0055525_1000060 3300003759 Bacteria 200831
23 Ga0055525_1000516 3300003759 Bacteria 18693
24 Ga0055535_1006588 3300003761 Bacteria 2327
25 Ga0055529_1000342 3300003763 Bacteria 52150
26 Ga0055526_1000010 3300003771 Bacteria 241512
27 Ga0055537_1000592 3300003773 Bacteria 20163
28 Ga0055524_1000025 3300003775 Bacteria 216427
29 Ga0055524_1009482 3300003775 Bacteria 3955
30 Ga0055534_1000428 3300003784 Bacteria 25148
31 Ga0055528_1000298 3300003790 Bacteria 42146
32 Ga0055541_1000027 3300003841 Bacteria 200831
33 Ga0055541_1000258 3300003841 Bacteria 18693
34 Ga0055543_1003841 3300004625 Bacteria 4265
35 Ga0065165_1000438 3300005262 Bacteria 65397
36 Ga0065714_10089834 3300005288 Bacteria 1966
37 Ga0065707_10185809 3300005295 Bacteria 1389
38 Ga0070660_100002479 3300005339 Bacteria 12654
39 Ga0070661_100012765 3300005344 Bacteria 5881
40 Ga0070674_100031732 3300005356 Bacteria 3503
41 Ga0070709_10482045 3300005434 Bacteria 939
42 Ga0070714_100071332 3300005435 Unclassified 3003
43 Ga0070678_100015633 3300005456 Bacteria 4830
44 Ga0070662_100193259 3300005457 Bacteria 1611
45 Ga0068867_100034699 3300005459 Bacteria 3658
46 Ga0070704_100267604 3300005549 Bacteria 1411
47 Ga0068855_100001055 3300005563 Bacteria 34206
48 Ga0070664_100011397 3300005564 Bacteria 7213
49 Ga0068854_100014480 3300005578 Bacteria 5200
50 Ga0068856_100647884 3300005614 Bacteria 1077
51 Ga0068852_100169750 3300005616 Bacteria 2044
52 Ga0068860_100119924 3300005843 Bacteria 2518
53 Ga0075366_10001681 3300006195 Bacteria 11110
54 Ga0075366_10280747 3300006195 Bacteria 1018
55 Ga0097621_100231136 3300006237 Bacteria 1614
56 Ga0068871_100084635 3300006358 Bacteria 2632
57 Ga0075428_100001103 3300006844 Bacteria 28744
58 Ga0075429_100001612 3300006880 Bacteria 18622
59 Ga0079104_1010838 3300006946 Bacteria 2970
60 Ga0099826_10000005 3300006948 Bacteria 465206
61 Ga0099795_10031637 3300007788 Bacteria 1823
62 Ga0105240_10004718 3300009093 Bacteria 20573
63 Ga0105240_10013236 3300009093 Bacteria 11348
64 Ga0105240_10225485 3300009093 Bacteria 2181
65 Ga0111539_10006197 3300009094 Bacteria 15433
66 Ga0105242_10062283 3300009176 Bacteria 3070
67 Ga0105248_10087249 3300009177 Bacteria 3511
68 Ga0105237_10038041 3300009545 Bacteria 4861
69 Ga0105238_10000194 3300009551 Bacteria 67211
70 Ga0105238_10038772 3300009551 Bacteria 4837
71 Ga0105239_10034172 3300010375 Bacteria 5582
72 Ga0157370_10135726 3300013104 Bacteria 2293
73 Ga0157374_10107514 3300013296 Bacteria 2681
74 Ga0157372_10166592 3300013307 Bacteria 2548
75 Ga0157375_10694492 3300013308 Bacteria 1171
76 Ga0182008_10000724 3300014497 Bacteria 23482
77 Ga0182008_10128118 3300014497 Bacteria 1264
78 Ga0182006_1000004 3300015261 Bacteria 622190
79 Ga0182006_1017377 3300015261 Bacteria 3057
80 Ga0182006_1017650 3300015261 Bacteria 3029
81 Ga0182007_10000017 3300015262 Bacteria 199097
82 Ga0182007_10008300 3300015262 Bacteria 4274
83 Ga0182005_1000030 3300015265 Bacteria 213092
84 Ga0182005_1000962 3300015265 Bacteria 12513
85 Ga0163161_10007639 3300017792 Bacteria 7478
86 Ga0163161_10070889 3300017792 Bacteria 2549
87 Ga0163161_10679374 3300017792 Bacteria 856
88 Ga0213872_10000283 3300021361 Bacteria 43308
89 Ga0213872_10000448 3300021361 Bacteria 33688
90 Ga0213872_10008525 3300021361 Bacteria 4958
91 Ga0213872_10022207 3300021361 Bacteria 2922
92 Ga0209435_100016 3300025206 Bacteria 305566
93 Ga0209435_100256 3300025206 Bacteria 13443
94 Ga0209760_101393 3300025207 Bacteria 2582
95 Ga0209784_100005 3300025224 Bacteria 1040422
96 Ga0209784_100020 3300025224 Bacteria 412353
97 Ga0209566_100005 3300025225 Bacteria 1040422
98 Ga0209566_100020 3300025225 Bacteria 412353
99 Ga0209674_100009 3300025226 Bacteria 1040422
100 Ga0209674_100035 3300025226 Bacteria 412353
101 Ga0209147_100023 3300025229 Bacteria 437803
102 Ga0209563_100012 3300025230 Bacteria 1040422
103 Ga0209563_100038 3300025230 Bacteria 412353
104 Ga0207427_100502 3300025231 Bacteria 20805
105 Ga0209437_100066 3300025233 Bacteria 327883
106 Ga0209437_100080 3300025233 Bacteria 275402
107 Ga0209258_100210 3300025242 Bacteria 117131
108 Ga0209646_1000033 3300025246 Bacteria 369507
109 Ga0209646_1000036 3300025246 Bacteria 358864
110 Ga0209646_1000200 3300025246 Bacteria 71297
111 Ga0209026_1000031 3300025250 Bacteria 325747
112 Ga0209026_1008366 3300025250 Bacteria 2169
113 Ga0209677_100006 3300025253 Bacteria 1040422
114 Ga0209677_100031 3300025253 Bacteria 329719
115 Ga0209759_1000045 3300025256 Bacteria 235654
116 Ga0209759_1000384 3300025256 Bacteria 55139
117 Ga0209233_1000060 3300025261 Bacteria 412379
118 Ga0209565_1000068 3300025263 Bacteria 171201
119 Ga0209565_1003187 3300025263 Bacteria 5435
120 Ga0209455_1000047 3300025272 Bacteria 379709
121 Ga0209455_1005495 3300025272 Bacteria 3904
122 Ga0209673_1000119 3300025273 Bacteria 171203
123 Ga0209130_1000057 3300025284 Bacteria 210593
124 Ga0209675_1000068 3300025291 Bacteria 171202
125 Ga0209675_1020404 3300025291 Bacteria 1797
126 Ga0209564_1000060 3300025295 Bacteria 325890
127 Ga0209564_1000141 3300025295 Bacteria 179852
128 Ga0209564_1000149 3300025295 Bacteria 170958
129 Ga0209564_1019340 3300025295 Bacteria 2550
130 Ga0209256_1000040 3300025299 Bacteria 366839
131 Ga0209256_1001036 3300025299 Bacteria 32591
132 Ga0207656_10174922 3300025321 Bacteria 1028
133 Ga0207655_1011084 3300025728 Bacteria 5403
134 Ga0207695_10000851 3300025913 Bacteria 56040
135 Ga0207695_10011378 3300025913 Bacteria 10784
136 Ga0207695_10041692 3300025913 Bacteria 4911
137 Ga0207657_10005609 3300025919 Bacteria 13096
138 Ga0207657_10262481 3300025919 Bacteria 1374
139 Ga0207649_10011361 3300025920 Bacteria 4909
140 Ga0207694_10000615 3300025924 Bacteria 32370
141 Ga0207694_10196847 3300025924 Bacteria 1639
142 Ga0207659_10237884 3300025926 Bacteria 1472
143 Ga0207690_10001939 3300025932 Bacteria 12686
144 Ga0207690_10180556 3300025932 Bacteria 1589
145 Ga0207686_10077140 3300025934 Bacteria 2163
146 Ga0207709_10034294 3300025935 Bacteria 2990
147 Ga0207704_10460712 3300025938 Bacteria 1017
148 Ga0207679_10008944 3300025945 Bacteria 6396
149 Ga0207667_10000073 3300025949 Bacteria 174391
150 Ga0207667_10000076 3300025949 Bacteria 166704
151 Ga0207667_10015829 3300025949 Bacteria 8548
152 Ga0207667_10100844 3300025949 Bacteria 2978
153 Ga0207658_10347751 3300025986 Bacteria 1290
154 Ga0207702_10190639 3300026078 Bacteria 1894
155 Ga0207675_100303332 3300026118 Bacteria 1556
156 Ga0207683_10002101 3300026121 Bacteria 17552
157 Ga0207698_10723071 3300026142 Bacteria 992
158 Ga0209282_1000003 3300027666 Bacteria 856377
159 Ga0209588_1025807 3300027671 Bacteria 1862
160 Ga0207428_10002526 3300027907 Bacteria 18263
161 Ga0207428_10032970 3300027907 Bacteria 4258
162 Ga0268264_10058489 3300028381 Bacteria 3228
163 Ga0307515_10005473 3300028794 Bacteria 25705
164 Ga0265324_10000018 3300029957 Bacteria 184238
165 Ga0265325_10000363 3300031241 Bacteria 31799
166 Ga0307509_10000050 3300031507 Bacteria 165692
167 Ga0307408_100000740 3300031548 Bacteria 26386
168 Ga0265314_10014128 3300031711 Bacteria 6409
169 Ga0265314_10027818 3300031711 Bacteria 4226
170 Ga0307516_10406761 3300031730 Bacteria 1020
171 Ga0307518_10025524 3300031838 Bacteria 4261
172 Ga0373923_0052377 3300035111 Bacteria 1714
173 Ga0373937_0095554 3300036401 Bacteria 2755
174 Ga0395899_0004633 3300037312 Bacteria 10721
175 Ga0395899_0027570 3300037312 Bacteria 4281
176 Ga0395899_0035781 3300037312 Bacteria 3726
177 Ga0395900_0003354 3300037418 Bacteria 17306
178 Ga0395900_0157336 3300037418 Bacteria 2320
179 Ga0395900_0203968 3300037418 Bacteria 1999
180 Ga0395900_0653567 3300037418 Bacteria 988
181 Ga0395898_0020581 3300037466 Bacteria 6701
182 Ga0395905_0002331 3300037471 Bacteria 21198
183 Ga0395905_0011968 3300037471 Bacteria 8365
184 Ga0395905_0033008 3300037471 Bacteria 4866
185 Ga0395901_0201605 3300038443 Bacteria 2085
186 Ga0395901_0206228 3300038443 Bacteria 2059
187 Ga0395901_0749060 3300038443 Bacteria 970
188 Ga0436361_0114843 3300039447 Bacteria 5669
189 Ga0436361_0280623 3300039447 Bacteria 20224
190 Ga0436361_0615250 3300039447 Bacteria 17905
191 Ga0436361_1026213 3300039447 Bacteria 1832
192 Ga0439461_0000887 3300041410 Bacteria 4439
193 Ga0439446_0001108 3300042156 Bacteria 5964
194 Ga0439434_0001969 3300042435 Bacteria 5949
195 Ga0451577_0000409 3300042876 Bacteria 77928
196 Ga0451577_0120782 3300042876 Bacteria 2347
197 Ga0451577_0376954 3300042876 Bacteria 1287
198 Ga0466972_0042347 3300044658 Bacteria 2214
199 Ga0466972_0060036 3300044658 Bacteria 1825
200 Ga0453683_0011565 3300044673 Bacteria 5814
201 Ga0453683_0082009 3300044673 Bacteria 2021
202 Ga0466965_0001702 3300044683 Bacteria 9028
203 Ga0466965_0022133 3300044683 Bacteria 3064
204 Ga0466965_0033198 3300044683 Bacteria 2522
205 Ga0466966_0045365 3300044684 Bacteria 2810
206 Ga0466964_0013674 3300044706 Bacteria 3080
207 Ga0453684_0000005 3300044712 Bacteria 1431632
208 Ga0453684_0624808 3300044712 Bacteria 1178
209 Ga0466971_0048903 3300044719 Bacteria 1902
210 Ga0466968_0000467 3300044735 Bacteria 13601
211 Ga0466968_0001884 3300044735 Bacteria 7586
212 Ga0466970_0042537 3300044765 Bacteria 2416
213 Ga0451576_0000335 3300045051 Bacteria 113806
214 Ga0451576_0012915 3300045051 Bacteria 9361
215 Ga0451576_0057728 3300045051 Bacteria 4057
216 Ga0451576_0065459 3300045051 Bacteria 3784
217 Ga0451576_0079479 3300045051 Bacteria 3412
218 Ga0495617_034349 3300046452 Bacteria 1702
219 Ga0495617_039497 3300046452 Bacteria 1578
220 Ga0495590_0058105 3300046457 Bacteria 1352
221 Ga0495638_0007066 3300046460 Bacteria 8099
222 Ga0495651_0119465 3300046462 Bacteria 1938
223 Ga0495650_0001069 3300046471 Bacteria 30311
224 Ga0495605_0004560 3300046474 Bacteria 8113
225 Ga0495584_0000544 3300046491 Bacteria 25572
226 Ga0495584_0011324 3300046491 Bacteria 4567
227 Ga0495584_0013518 3300046491 Bacteria 4167
228 Ga0495584_0120379 3300046491 Bacteria 1329
229 Ga0495585_0007028 3300046492 Bacteria 6928
230 Ga0495585_0014777 3300046492 Bacteria 4541
231 Ga0495596_0001359 3300046500 Bacteria 14095
232 Ga0495607_0012096 3300046501 Bacteria 5709
233 Ga0495607_0015886 3300046501 Bacteria 4869
234 Ga0495607_0046718 3300046501 Bacteria 2540
235 Ga0495607_0110712 3300046501 Bacteria 1456
236 Ga0495583_0000228 3300046506 Bacteria 93924
237 Ga0495583_0003802 3300046506 Bacteria 11208
238 Ga0495583_0021620 3300046506 Bacteria 3304
239 Ga0495583_0042789 3300046506 Bacteria 2112
240 Ga0495606_0000622 3300046507 Bacteria 55871
241 Ga0495606_0003966 3300046507 Bacteria 15179
242 Ga0495606_0005790 3300046507 Bacteria 11670
243 Ga0495606_0018737 3300046507 Bacteria 5179
244 Ga0495606_0032141 3300046507 Bacteria 3639
245 Ga0495606_0073162 3300046507 Bacteria 2151
246 Ga0495616_0001055 3300046513 Bacteria 19703
247 Ga0495616_0012451 3300046513 Bacteria 4829
248 Ga0495616_0018674 3300046513 Bacteria 3800
249 Ga0495628_0000767 3300046516 Bacteria 29619
250 Ga0495628_0011286 3300046516 Bacteria 7556
251 Ga0495631_0017335 3300046518 Bacteria 3409
252 Ga0495632_0003177 3300046519 Bacteria 11844
253 Ga0495643_0003417 3300046522 Bacteria 11654
254 Ga0495643_0155878 3300046522 Bacteria 1127
255 Ga0495644_0003542 3300046523 Bacteria 6173
256 Ga0495644_0005059 3300046523 Bacteria 5156
257 Ga0495644_0043730 3300046523 Bacteria 1685
258 Ga0495644_0053362 3300046523 Bacteria 1518
259 Ga0495648_0002442 3300046524 Bacteria 17173
260 Ga0495663_0014412 3300046525 Bacteria 2215
261 Ga0495663_0020978 3300046525 Bacteria 1878
262 Ga0495642_0015478 3300046528 Bacteria 2965
263 Ga0495642_0024499 3300046528 Bacteria 2387
264 Ga0495642_0042583 3300046528 Bacteria 1850
265 Ga0495652_0029454 3300046529 Bacteria 4823
266 Ga0495652_0042994 3300046529 Bacteria 3894
267 Ga0495652_0079292 3300046529 Bacteria 2715
268 Ga0495652_0123596 3300046529 Bacteria 2059
269 Ga0495654_0019800 3300046530 Bacteria 3514
270 Ga0495665_0100875 3300046531 Bacteria 1515
271 Ga0495586_0043564 3300046535 Bacteria 2417
272 Ga0495609_0000094 3300046538 Bacteria 105073
273 Ga0495609_0001186 3300046538 Bacteria 17979
274 Ga0495609_0014204 3300046538 Bacteria 3747
275 Ga0495609_0087657 3300046538 Bacteria 1355
276 Ga0495621_0153406 3300046539 Bacteria 907
277 Ga0495597_0036123 3300046542 Bacteria 2226
278 Ga0495597_0054761 3300046542 Bacteria 1751
279 Ga0495597_0100554 3300046542 Bacteria 1219
280 Ga0495597_0126845 3300046542 Bacteria 1060
281 Ga0495622_0000434 3300046557 Bacteria 27206
282 Ga0495622_0076280 3300046557 Bacteria 1545
283 Ga0495633_0000763 3300046558 Bacteria 28944
284 Ga0495633_0004545 3300046558 Bacteria 8757
285 Ga0495633_0027960 3300046558 Bacteria 2750
286 Ga0495633_0044116 3300046558 Bacteria 2113
287 Ga0495633_0103303 3300046558 Bacteria 1322
288 Ga0495656_0007094 3300046615 Bacteria 3951
289 Ga0495668_0000330 3300046616 Bacteria 64685
290 Ga0495668_0007416 3300046616 Bacteria 7009
291 Ga0495668_0010434 3300046616 Bacteria 5621
292 Ga0495668_0011411 3300046616 Bacteria 5319
293 Ga0495611_0009507 3300046648 Bacteria 4108
294 Ga0495625_0002821 3300046660 Bacteria 18290
295 Ga0495625_0003372 3300046660 Bacteria 16017
296 Ga0495625_0006154 3300046660 Bacteria 10748
297 Ga0495625_0069082 3300046660 Bacteria 2482
298 Ga0495625_0180178 3300046660 Bacteria 1406
299 Ga0495635_0116820 3300046663 Bacteria 1821
300 Ga0495659_0001490 3300046664 Bacteria 7937
301 Ga0495659_0001937 3300046664 Bacteria 6826
302 Ga0495659_0003169 3300046664 Bacteria 5277
303 Ga0495661_0008874 3300046665 Bacteria 6930
304 Ga0495661_0096698 3300046665 Bacteria 1669
305 Ga0495588_0010401 3300046674 Bacteria 4327
306 Ga0495599_0062335 3300046678 Bacteria 2329
307 Ga0495623_0007800 3300046679 Bacteria 6960
308 Ga0495623_0120190 3300046679 Bacteria 1582
309 Ga0495646_0004104 3300046680 Bacteria 9137
310 Ga0495624_0055898 3300046690 Bacteria 2485
311 Ga0495624_0114563 3300046690 Bacteria 1657
312 Ga0495670_0017126 3300046691 Bacteria 3564
313 Ga0495670_0025056 3300046691 Bacteria 2950
314 Ga0495671_0006069 3300046692 Bacteria 7021
315 Ga0495671_0008140 3300046692 Bacteria 5916
316 Ga0495671_0219088 3300046692 Bacteria 921
317 Ga0495649_0010995 3300046694 Bacteria 5331
318 Ga0495589_0105300 3300046794 Bacteria 1363
319 Ga0495600_0057295 3300046809 Bacteria 2545
320 Ga0495660_0002356 3300046810 Bacteria 12077
321 Ga0495660_0013896 3300046810 Bacteria 4666
322 Ga0495660_0047307 3300046810 Bacteria 2356
323 Ga0495581_0108455 3300047315 Bacteria 1614
324 Ga0495604_0052090 3300047317 Bacteria 3171
325 Ga0495636_0000384 3300047318 Bacteria 16665
326 Ga0495636_0002813 3300047318 Bacteria 6711
327 Ga0495636_0161112 3300047318 Bacteria 1011
328 Ga0495672_0000361 3300047320 Bacteria 58121
329 Ga0495672_0004953 3300047320 Bacteria 10698
330 Ga0495672_0005366 3300047320 Bacteria 10192
331 Ga0495672_0039051 3300047320 Bacteria 2890
332 Ga0495676_0020860 3300047321 Bacteria 5738
333 Ga0495683_0000641 3300047323 Bacteria 26026
334 Ga0495683_0010085 3300047323 Bacteria 5007
335 Ga0495683_0032410 3300047323 Bacteria 2662
336 Ga0495687_001058 3300047443 Bacteria 27224
337 Ga0495687_009328 3300047443 Bacteria 5496
338 Ga0495687_024660 3300047443 Bacteria 2855
339 Ga0495687_038245 3300047443 Bacteria 2130
340 Ga0495677_0019898 3300047445 Bacteria 2433
341 Ga0495677_0026531 3300047445 Bacteria 2101
342 Ga0495685_000089 3300047447 Bacteria 33778
343 Ga0495685_001993 3300047447 Bacteria 6335
344 Ga0495685_005818 3300047447 Bacteria 4029
345 Ga0495673_0008437 3300047469 Bacteria 5804
346 Ga0495673_0009582 3300047469 Bacteria 5352
347 Ga0495681_0021465 3300047470 Bacteria 3478
348 Ga0495681_0025836 3300047470 Bacteria 3068
349 Ga0495681_0030780 3300047470 Bacteria 2727
350 Ga0495686_0001924 3300047472 Bacteria 20689
351 Ga0495686_0006191 3300047472 Bacteria 9232
352 Ga0495686_0025502 3300047472 Bacteria 3874
353 Ga0495686_0066030 3300047472 Bacteria 2236
354 Ga0495686_0106367 3300047472 Bacteria 1687
355 Ga0495614_0195858 3300048089 Bacteria 913
356 Ga0495615_0001030 3300048090 Bacteria 3972
357 Ga0495615_0004164 3300048090 Bacteria 2498
358 Ga0495626_0012789 3300048091 Bacteria 4384
359 Ga0495626_0053468 3300048091 Bacteria 1858
360 Ga0496100_0059172 3300048903 Bacteria 2517
361 Ga0496101_0110045 3300048904 Bacteria 2073
362 Ga0496101_0437062 3300048904 Bacteria 1032
363 Ga0496102_0031979 3300048905 Bacteria 4724
364 Ga0496102_0091926 3300048905 Bacteria 2809
365 Ga0496103_0006150 3300048906 Bacteria 7174
366 Ga0496104_0067814 3300048907 Bacteria 3390
367 Ga0496108_0135580 3300048911 Bacteria 2118
368 Ga0496110_0036308 3300048913 Bacteria 4279
369 Ga0496111_0018382 3300048914 Bacteria 4842
370 Ga0496111_0022128 3300048914 Bacteria 4447
371 Ga0496114_0000238 3300048917 Bacteria 40176
372 Ga0496114_0004791 3300048917 Bacteria 10533
373 Ga0496114_0033069 3300048917 Bacteria 4260
374 Ga0496115_0561339 3300048918 Bacteria 911
375 Ga0496116_0011212 3300048919 Bacteria 7444
376 Ga0496116_0016323 3300048919 Bacteria 5813
377 Ga0496116_0029703 3300048919 Bacteria 3936
378 Ga0496117_0000011 3300048920 Bacteria 610930
379 Ga0496118_0000010 3300048921 Bacteria 610930
380 Ga0496118_0009882 3300048921 Bacteria 9541
381 Ga0496121_0008879 3300048924 Bacteria 11686
382 Ga0496122_0001722 3300048925 Bacteria 33944
383 Ga0496122_0002864 3300048925 Bacteria 23629
384 Ga0496123_0000838 3300048926 Bacteria 49225
385 Ga0496124_0104133 3300048927 Bacteria 2294
386 Ga0496125_0001834 3300048928 Bacteria 29352
387 Ga0496125_0002083 3300048928 Bacteria 26953
388 Ga0496125_0016615 3300048928 Bacteria 7058
389 Ga0496125_0037003 3300048928 Bacteria 4249
390 Ga0495678_001731 3300049459 Bacteria 16268
391 Ga0495678_016605 3300049459 Bacteria 3361
392 Ga0495682_0000772 3300049460 Bacteria 20433
393 Ga0495682_0002020 3300049460 Bacteria 10004
394 Ga0501300_001068 3300049523 Bacteria 4164
395 Ga0501032_0000904 3300049569 Bacteria 24050
396 Ga0501032_0003376 3300049569 Bacteria 12246
397 Ga0501033_0001114 3300049570 Bacteria 24394
398 Ga0501033_0054677 3300049570 Bacteria 2953
399 Ga0501033_0224372 3300049570 Bacteria 1336
400 Ga0501034_0030553 3300049571 Bacteria 5476
401 Ga0501036_0006047 3300049572 Bacteria 9814
402 Ga0501036_0008386 3300049572 Bacteria 8468
403 Ga0501036_0012920 3300049572 Bacteria 6934
404 Ga0501036_0018690 3300049572 Bacteria 5812
405 Ga0501036_0020972 3300049572 Bacteria 5488
406 Ga0501036_0026549 3300049572 Bacteria 4889
407 Ga0501037_0002319 3300049573 Bacteria 13752
408 Ga0501037_0033410 3300049573 Bacteria 3800
409 Ga0501038_0002374 3300049574 Bacteria 17532
410 Ga0501038_0004014 3300049574 Bacteria 13673
411 Ga0501038_0009000 3300049574 Bacteria 9163
412 Ga0501038_0014100 3300049574 Bacteria 7281
413 Ga0501038_0050973 3300049574 Bacteria 3575
414 Ga0501038_0323273 3300049574 Bacteria 1206
415 Ga0501039_0002786 3300049575 Bacteria 13058
416 Ga0501039_0035354 3300049575 Bacteria 3855
417 Ga0501039_0055867 3300049575 Bacteria 3058
418 Ga0501039_0252150 3300049575 Bacteria 1387
419 Ga0501040_0005625 3300049576 Bacteria 8100
420 Ga0501040_0062005 3300049576 Bacteria 2572
421 Ga0501041_0004998 3300049577 Bacteria 7719
422 Ga0501041_0031668 3300049577 Bacteria 3196
423 Ga0501042_0018033 3300049578 Bacteria 4882
424 Ga0501042_0043568 3300049578 Bacteria 3196
425 Ga0501043_0011383 3300049579 Bacteria 6962
426 Ga0501043_0026339 3300049579 Bacteria 4562
427 Ga0501043_0058092 3300049579 Bacteria 3037
428 Ga0501043_0127590 3300049579 Bacteria 1994
429 Ga0501046_0006115 3300049580 Bacteria 10699
430 Ga0501046_0036321 3300049580 Bacteria 3966
431 Ga0501046_0198269 3300049580 Bacteria 1494
432 Ga0501046_0199058 3300049580 Bacteria 1491
433 Ga0501047_0334699 3300049581 Bacteria 1352
434 Ga0501048_0004201 3300049582 Bacteria 10977
435 Ga0501048_0117980 3300049582 Bacteria 1875
436 Ga0501048_0467805 3300049582 Bacteria 903
437 Ga0501068_0001378 3300049584 Bacteria 12927
438 Ga0501068_0008927 3300049584 Bacteria 5594
439 Ga0501068_0130868 3300049584 Bacteria 1569
440 Ga0501070_0059545 3300049586 Bacteria 3166
441 Ga0501071_0009574 3300049587 Bacteria 6461
442 Ga0501071_0017399 3300049587 Bacteria 4957
443 Ga0501071_0284048 3300049587 Bacteria 1252
444 Ga0501072_0018949 3300049588 Bacteria 5312
445 Ga0501073_0001512 3300049589 Bacteria 17219
446 Ga0501074_0048924 3300049590 Bacteria 3053
447 Ga0501075_0002265 3300049591 Bacteria 12748
448 Ga0501075_0004683 3300049591 Bacteria 9286
449 Ga0501075_0462303 3300049591 Bacteria 968
450 Ga0501076_0001952 3300049592 Bacteria 14070
451 Ga0501076_0002356 3300049592 Bacteria 12930
452 Ga0501076_0687801 3300049592 Bacteria 844
453 Ga0501077_0010613 3300049593 Bacteria 5737
454 Ga0501077_0096721 3300049593 Bacteria 1871
455 Ga0501230_009847 3300049667 Bacteria 1479
456 Ga0501238_006673 3300049671 Bacteria 1490
457 Ga0501257_028703 3300049686 Bacteria 1335
458 Ga0501079_0007874 3300049741 Bacteria 8071
459 Ga0501079_0074061 3300049741 Bacteria 2632
460 Ga0501079_0106940 3300049741 Bacteria 2171
461 Ga0501079_0484368 3300049741 Bacteria 972
462 Ga0501080_0001039 3300049742 Bacteria 22819
463 Ga0501080_0030390 3300049742 Bacteria 5033
464 Ga0501080_0069027 3300049742 Bacteria 3287
465 Ga0501081_0000122 3300049743 Bacteria 34042
466 Ga0501081_0004170 3300049743 Bacteria 9271
467 Ga0501081_0109687 3300049743 Bacteria 1958
468 Ga0501083_0015861 3300049744 Bacteria 5274
469 Ga0501083_0106797 3300049744 Bacteria 1843
470 Ga0501280_000528 3300049776 Bacteria 8971
471 Ga0501035_0000743 3300049822 Bacteria 35105
472 Ga0501035_0015347 3300049822 Bacteria 7071
473 Ga0501044_0000068 3300049823 Bacteria 126642
474 Ga0501044_0017513 3300049823 Bacteria 7688
475 Ga0501044_0044286 3300049823 Bacteria 4618
476 Ga0501044_0291054 3300049823 Bacteria 1564
477 Ga0501045_0000986 3300049824 Bacteria 18652
478 Ga0501045_0001250 3300049824 Bacteria 16894
479 nmdc:mga0k408_191749_c1 3300050493 Bacteria 1219
480 nmdc:mga0k408_1922_c1 3300050493 Bacteria 11126
481 nmdc:mga09592_7683_c1 3300050508 Bacteria 8765
482 nmdc:mga08y16_58969_c1 3300050511 Bacteria 4011
483 nmdc:mga08y16_60045_c1 3300050511 Bacteria 3971
484 Ga0495601_0006631 3300053077 Bacteria 6774
485 Ga0500583_0023964 3300053092 Bacteria 2581
486 Ga0500562_026268 3300053108 Bacteria 1526
487 Ga0500569_023019 3300053109 Bacteria 1668
488 Ga0500595_003784 3300053119 Bacteria 6962
489 Ga0500607_127431 3300053121 Bacteria 1220
490 Ga0500618_001706 3300053125 Bacteria 9369
491 Ga0500618_001856 3300053125 Bacteria 8835
492 Ga0500574_011403 3300053141 Bacteria 2005
493 Ga0500619_001048 3300053154 Bacteria 4789
494 Ga0500622_0000029 3300053156 Bacteria 213762
495 Ga0500622_0005625 3300053156 Bacteria 7467
496 Ga0500636_0000417 3300053177 Bacteria 23409
497 Ga0501084_0016674 3300054114 Bacteria 6102
498 Ga0501084_0036338 3300054114 Bacteria 4115
499 Ga0501084_0202174 3300054114 Bacteria 1676
500 Ga0500661_017398 3300055283 Bacteria 1284
501 Ga0587080_022548 3300059503 Bacteria 1044
502 Ga0501082_0001249 3300060353 Bacteria 22335
503 Ga0501082_0031086 3300060353 Bacteria 4602
504 Ga0501082_0167686 3300060353 Bacteria 1908
505 Ga0530510_0010206 3300061734 Bacteria 6581
506 Ga0530510_0109219 3300061734 Bacteria 2025
507 2511251671 2511231003 Bacteria 5606035
508 2511385467 2511231026 Bacteria 5225445
509 2521559006 2521172590 Bacteria 5047645
510 2550694421 2548876994 Bacteria 4904866
511 2553003807 2551306416 Bacteria 6152985
512 2601669683 2600255292 Bacteria 6300551
513 2617919081 2617270889 Bacteria 9064343
514 2644027708 2643221603 Bacteria 6147767
515 2644255173 2643221645 Bacteria 7207331
516 2644359739 2643221664 Bacteria 7272945
517 2738742800 2738541280 Bacteria 6630198
518 2738847054 2738541300 Bacteria 6675882
519 2739277824 2738543018 Bacteria 6718814
520 2739346867 2738543030 Bacteria 6719714
521 2765568747 2765235838 Bacteria 5445269
522 2808981492 2808606386 Bacteria 4471946
523 2809129074 2808606415 Bacteria 4576710
524 2809148694 2808606419 Bacteria 4576925
525 2819542950 2818991436 Bacteria 5376622
526 2819591303 2818991445 Bacteria 4955017
527 2819615524 2818991449 Bacteria 5518009
528 2831428880 2831426010 Bacteria 8662725
529 2839096370 2839094727 Bacteria 5534556
530 2848696537 2848694841 Bacteria 9205737
531 2849664148 2849660919 Bacteria 8251853
532 2852621231 2852618963 Bacteria 4577824
533 2857549806 2857547612 Bacteria 6179999
534 2884816070 2884811622 Bacteria 5552861
535 2884837092 2884836552 Bacteria 5219991
536 2884853384 2884852848 Bacteria 5221161
537 2885080287 2885080285 Bacteria 6355622
538 2886633965 2886627955 Bacteria 7618130
539 2891634253 2891633521 Bacteria 4602265
540 2896155499 2896154374 Bacteria 5221518
541 2904444923 2904439833 Bacteria 5931679
542 2904532265 2904530477 Bacteria 5876334
543 2904584707 2904584206 Bacteria 6028872
544 2904591175 2904589729 Bacteria 6113573
545 2904605232 2904601388 Bacteria 5884906
546 2913852226 2913844669 Bacteria 8381711
547 2913915991 2913912277 Bacteria 9037797
548 2913944283 2913939268 Bacteria 8559644
549 2919048399 2919046199 Bacteria 5567169
550 2919081078 2919079590 Bacteria 5946433
551 2923512663 2923510766 Bacteria 5926163
552 2928132685 2928130867 Bacteria 5467269
553 2932415885 2932410948 Bacteria 6312192
554 2932421875 2932416698 Bacteria 6315112
555 642601802 642555144 Bacteria 9059191
556 Ga0495651_0002551
557 JGI25155J39150_1000331
558 JGI25155J39150_1000387
559 JGI25156J39149_1000848
560 JGI25156J39149_1002710
561 JGI25162J39368_1000941
562 JGI25162J39368_1007041
563 JGI25154J39366_1000290
564 JGI25154J39366_1000391
565 JGI25157J39369_1001917
566 JGI25164J39214_1009618
567 JGI25165J46597_1001005
568 rootL2_10039155
569 Ga0007416J51690_1099222
570 Ga0055538_1000030
571 Ga0055538_1000368
572 Ga0055539_1000040
573 Ga0055539_1000374
574 Ga0055533_1000050
575 Ga0055533_1000368
576 Ga0055532_1000016
577 Ga0055525_1000060
578 Ga0055525_1000516
579 Ga0055535_1006588
580 Ga0055529_1000342
581 Ga0055526_1000010
582 Ga0055537_1000592
583 Ga0055524_1000025
584 Ga0055524_1009482
585 Ga0055534_1000428
586 Ga0055528_1000298
587 Ga0055541_1000027
588 Ga0055541_1000258
589 Ga0055543_1003841
590 Ga0065165_1000438
591 Ga0065714_10089834
592 Ga0065707_10185809
593 Ga0070660_100002479
594 Ga0070661_100012765
595 Ga0070674_100031732
596 Ga0070709_10482045
597 Ga0070714_100071332
598 Ga0070678_100015633
599 Ga0070662_100193259
600 Ga0068867_100034699
601 Ga0070704_100267604
602 Ga0068855_100001055
603 Ga0070664_100011397
604 Ga0068854_100014480
605 Ga0068856_100647884
606 Ga0068852_100169750
607 Ga0068860_100119924
608 Ga0075366_10001681
609 Ga0075366_10280747
610 Ga0097621_100231136
611 Ga0068871_100084635
612 Ga0075428_100001103
613 Ga0075429_100001612
614 Ga0079104_1010838
615 Ga0099826_10000005
616 Ga0099795_10031637
617 Ga0105240_10004718
618 Ga0105240_10013236
619 Ga0105240_10225485
620 Ga0111539_10006197
621 Ga0105242_10062283
622 Ga0105248_10087249
623 Ga0105237_10038041
624 Ga0105238_10000194
625 Ga0105238_10038772
626 Ga0105239_10034172
627 Ga0157370_10135726
628 Ga0157374_10107514
629 Ga0157372_10166592
630 Ga0157375_10694492
631 Ga0182008_10000724
632 Ga0182008_10128118
633 Ga0182006_1000004
634 Ga0182006_1017377
635 Ga0182006_1017650
636 Ga0182007_10000017
637 Ga0182007_10008300
638 Ga0182005_1000030
639 Ga0182005_1000962
640 Ga0163161_10007639
641 Ga0163161_10070889
642 Ga0163161_10679374
643 Ga0213872_10000283
644 Ga0213872_10000448
645 Ga0213872_10008525
646 Ga0213872_10022207
647 Ga0209435_100016
648 Ga0209435_100256
649 Ga0209760_101393
650 Ga0209784_100005
651 Ga0209784_100020
652 Ga0209566_100005
653 Ga0209566_100020
654 Ga0209674_100009
655 Ga0209674_100035
656 Ga0209147_100023
657 Ga0209563_100012
658 Ga0209563_100038
659 Ga0207427_100502
660 Ga0209437_100066
661 Ga0209437_100080
662 Ga0209258_100210
663 Ga0209646_1000033
664 Ga0209646_1000036
665 Ga0209646_1000200
666 Ga0209026_1000031
667 Ga0209026_1008366
668 Ga0209677_100006
669 Ga0209677_100031
670 Ga0209759_1000045
671 Ga0209759_1000384
672 Ga0209233_1000060
673 Ga0209565_1000068
674 Ga0209565_1003187
675 Ga0209455_1000047
676 Ga0209455_1005495
677 Ga0209673_1000119
678 Ga0209130_1000057
679 Ga0209675_1000068
680 Ga0209675_1020404
681 Ga0209564_1000060
682 Ga0209564_1000141
683 Ga0209564_1000149
684 Ga0209564_1019340
685 Ga0209256_1000040
686 Ga0209256_1001036
687 Ga0207656_10174922
688 Ga0207655_1011084
689 Ga0207695_10000851
690 Ga0207695_10011378
691 Ga0207695_10041692
692 Ga0207657_10005609
693 Ga0207657_10262481
694 Ga0207649_10011361
695 Ga0207694_10000615
696 Ga0207694_10196847
697 Ga0207659_10237884
698 Ga0207690_10001939
699 Ga0207690_10180556
700 Ga0207686_10077140
701 Ga0207709_10034294
702 Ga0207704_10460712
703 Ga0207679_10008944
704 Ga0207667_10000073
705 Ga0207667_10000076
706 Ga0207667_10015829
707 Ga0207667_10100844
708 Ga0207658_10347751
709 Ga0207702_10190639
710 Ga0207675_100303332
711 Ga0207683_10002101
712 Ga0207698_10723071
713 Ga0209282_1000003
714 Ga0209588_1025807
715 Ga0207428_10002526
716 Ga0207428_10032970
717 Ga0268264_10058489
718 Ga0307515_10005473
719 Ga0265324_10000018
720 Ga0265325_10000363
721 Ga0307509_10000050
722 Ga0307408_100000740
723 Ga0265314_10014128
724 Ga0265314_10027818
725 Ga0307516_10406761
726 Ga0307518_10025524
727 Ga0373923_0052377
728 Ga0373937_0095554
729 Ga0395899_0004633
730 Ga0395899_0027570
731 Ga0395899_0035781
732 Ga0395900_0003354
733 Ga0395900_0157336
734 Ga0395900_0203968
735 Ga0395900_0653567
736 Ga0395898_0020581
737 Ga0395905_0002331
738 Ga0395905_0011968
739 Ga0395905_0033008
740 Ga0395901_0201605
741 Ga0395901_0206228
742 Ga0395901_0749060
743 Ga0436361_0114843
744 Ga0436361_0280623
745 Ga0436361_0615250
746 Ga0436361_1026213
747 Ga0439461_0000887
748 Ga0439446_0001108
749 Ga0439434_0001969
750 Ga0451577_0000409
751 Ga0451577_0120782
752 Ga0451577_0376954
753 Ga0466972_0042347
754 Ga0466972_0060036
755 Ga0453683_0011565
756 Ga0453683_0082009
757 Ga0466965_0001702
758 Ga0466965_0022133
759 Ga0466965_0033198
760 Ga0466966_0045365
761 Ga0466964_0013674
762 Ga0453684_0000005
763 Ga0453684_0624808
764 Ga0466971_0048903
765 Ga0466968_0000467
766 Ga0466968_0001884
767 Ga0466970_0042537
768 Ga0451576_0000335
769 Ga0451576_0012915
770 Ga0451576_0057728
771 Ga0451576_0065459
772 Ga0451576_0079479
773 Ga0495617_034349
774 Ga0495617_039497
775 Ga0495590_0058105
776 Ga0495638_0007066
777 Ga0495651_0119465
778 Ga0495650_0001069
779 Ga0495605_0004560
780 Ga0495584_0000544
781 Ga0495584_0011324
782 Ga0495584_0013518
783 Ga0495584_0120379
784 Ga0495585_0007028
785 Ga0495585_0014777
786 Ga0495596_0001359
787 Ga0495607_0012096
788 Ga0495607_0015886
789 Ga0495607_0046718
790 Ga0495607_0110712
791 Ga0495583_0000228
792 Ga0495583_0003802
793 Ga0495583_0021620
794 Ga0495583_0042789
795 Ga0495606_0000622
796 Ga0495606_0003966
797 Ga0495606_0005790
798 Ga0495606_0018737
799 Ga0495606_0032141
800 Ga0495606_0073162
801 Ga0495616_0001055
802 Ga0495616_0012451
803 Ga0495616_0018674
804 Ga0495628_0000767
805 Ga0495628_0011286
806 Ga0495631_0017335
807 Ga0495632_0003177
808 Ga0495643_0003417
809 Ga0495643_0155878
810 Ga0495644_0003542
811 Ga0495644_0005059
812 Ga0495644_0043730
813 Ga0495644_0053362
814 Ga0495648_0002442
815 Ga0495663_0014412
816 Ga0495663_0020978
817 Ga0495642_0015478
818 Ga0495642_0024499
819 Ga0495642_0042583
820 Ga0495652_0029454
821 Ga0495652_0042994
822 Ga0495652_0079292
823 Ga0495652_0123596
824 Ga0495654_0019800
825 Ga0495665_0100875
826 Ga0495586_0043564
827 Ga0495609_0000094
828 Ga0495609_0001186
829 Ga0495609_0014204
830 Ga0495609_0087657
831 Ga0495621_0153406
832 Ga0495597_0036123
833 Ga0495597_0054761
834 Ga0495597_0100554
835 Ga0495597_0126845
836 Ga0495622_0000434
837 Ga0495622_0076280
838 Ga0495633_0000763
839 Ga0495633_0004545
840 Ga0495633_0027960
841 Ga0495633_0044116
842 Ga0495633_0103303
843 Ga0495656_0007094
844 Ga0495668_0000330
845 Ga0495668_0007416
846 Ga0495668_0010434
847 Ga0495668_0011411
848 Ga0495611_0009507
849 Ga0495625_0002821
850 Ga0495625_0003372
851 Ga0495625_0006154
852 Ga0495625_0069082
853 Ga0495625_0180178
854 Ga0495635_0116820
855 Ga0495659_0001490
856 Ga0495659_0001937
857 Ga0495659_0003169
858 Ga0495661_0008874
859 Ga0495661_0096698
860 Ga0495588_0010401
861 Ga0495599_0062335
862 Ga0495623_0007800
863 Ga0495623_0120190
864 Ga0495646_0004104
865 Ga0495624_0055898
866 Ga0495624_0114563
867 Ga0495670_0017126
868 Ga0495670_0025056
869 Ga0495671_0006069
870 Ga0495671_0008140
871 Ga0495671_0219088
872 Ga0495649_0010995
873 Ga0495589_0105300
874 Ga0495600_0057295
875 Ga0495660_0002356
876 Ga0495660_0013896
877 Ga0495660_0047307
878 Ga0495581_0108455
879 Ga0495604_0052090
880 Ga0495636_0000384
881 Ga0495636_0002813
882 Ga0495636_0161112
883 Ga0495672_0000361
884 Ga0495672_0004953
885 Ga0495672_0005366
886 Ga0495672_0039051
887 Ga0495676_0020860
888 Ga0495683_0000641
889 Ga0495683_0010085
890 Ga0495683_0032410
891 Ga0495687_001058
892 Ga0495687_009328
893 Ga0495687_024660
894 Ga0495687_038245
895 Ga0495677_0019898
896 Ga0495677_0026531
897 Ga0495685_000089
898 Ga0495685_001993
899 Ga0495685_005818
900 Ga0495673_0008437
901 Ga0495673_0009582
902 Ga0495681_0021465
903 Ga0495681_0025836
904 Ga0495681_0030780
905 Ga0495686_0001924
906 Ga0495686_0006191
907 Ga0495686_0025502
908 Ga0495686_0066030
909 Ga0495686_0106367
910 Ga0495614_0195858
911 Ga0495615_0001030
912 Ga0495615_0004164
913 Ga0495626_0012789
914 Ga0495626_0053468
915 Ga0496100_0059172
916 Ga0496101_0110045
917 Ga0496101_0437062
918 Ga0496102_0031979
919 Ga0496102_0091926
920 Ga0496103_0006150
921 Ga0496104_0067814
922 Ga0496108_0135580
923 Ga0496110_0036308
924 Ga0496111_0018382
925 Ga0496111_0022128
926 Ga0496114_0000238
927 Ga0496114_0004791
928 Ga0496114_0033069
929 Ga0496115_0561339
930 Ga0496116_0011212
931 Ga0496116_0016323
932 Ga0496116_0029703
933 Ga0496117_0000011
934 Ga0496118_0000010
935 Ga0496118_0009882
936 Ga0496121_0008879
937 Ga0496122_0001722
938 Ga0496122_0002864
939 Ga0496123_0000838
940 Ga0496124_0104133
941 Ga0496125_0001834
942 Ga0496125_0002083
943 Ga0496125_0016615
944 Ga0496125_0037003
945 Ga0495678_001731
946 Ga0495678_016605
947 Ga0495682_0000772
948 Ga0495682_0002020
949 Ga0501300_001068
950 Ga0501032_0000904
951 Ga0501032_0003376
952 Ga0501033_0001114
953 Ga0501033_0054677
954 Ga0501033_0224372
955 Ga0501034_0030553
956 Ga0501036_0006047
957 Ga0501036_0008386
958 Ga0501036_0012920
959 Ga0501036_0018690
960 Ga0501036_0020972
961 Ga0501036_0026549
962 Ga0501037_0002319
963 Ga0501037_0033410
964 Ga0501038_0002374
965 Ga0501038_0004014
966 Ga0501038_0009000
967 Ga0501038_0014100
968 Ga0501038_0050973
969 Ga0501038_0323273
970 Ga0501039_0002786
971 Ga0501039_0035354
972 Ga0501039_0055867
973 Ga0501039_0252150
974 Ga0501040_0005625
975 Ga0501040_0062005
976 Ga0501041_0004998
977 Ga0501041_0031668
978 Ga0501042_0018033
979 Ga0501042_0043568
980 Ga0501043_0011383
981 Ga0501043_0026339
982 Ga0501043_0058092
983 Ga0501043_0127590
984 Ga0501046_0006115
985 Ga0501046_0036321
986 Ga0501046_0198269
987 Ga0501046_0199058
988 Ga0501047_0334699
989 Ga0501048_0004201
990 Ga0501048_0117980
991 Ga0501048_0467805
992 Ga0501068_0001378
993 Ga0501068_0008927
994 Ga0501068_0130868
995 Ga0501070_0059545
996 Ga0501071_0009574
997 Ga0501071_0017399
998 Ga0501071_0284048
999 Ga0501072_0018949
1000 Ga0501073_0001512
1001 Ga0501074_0048924
1002 Ga0501075_0002265
1003 Ga0501075_0004683
1004 Ga0501075_0462303
1005 Ga0501076_0001952
1006 Ga0501076_0002356
1007 Ga0501076_0687801
1008 Ga0501077_0010613
1009 Ga0501077_0096721
1010 Ga0501230_009847
1011 Ga0501238_006673
1012 Ga0501257_028703
1013 Ga0501079_0007874
1014 Ga0501079_0074061
1015 Ga0501079_0106940
1016 Ga0501079_0484368
1017 Ga0501080_0001039
1018 Ga0501080_0030390
1019 Ga0501080_0069027
1020 Ga0501081_0000122
1021 Ga0501081_0004170
1022 Ga0501081_0109687
1023 Ga0501083_0015861
1024 Ga0501083_0106797
1025 Ga0501280_000528
1026 Ga0501035_0000743
1027 Ga0501035_0015347
1028 Ga0501044_0000068
1029 Ga0501044_0017513
1030 Ga0501044_0044286
1031 Ga0501044_0291054
1032 Ga0501045_0000986
1033 Ga0501045_0001250
1034 nmdc:mga0k408_191749_c1
1035 nmdc:mga0k408_1922_c1
1036 nmdc:mga09592_7683_c1
1037 nmdc:mga08y16_58969_c1
1038 nmdc:mga08y16_60045_c1
1039 Ga0495601_0006631
1040 Ga0500583_0023964
1041 Ga0500562_026268
1042 Ga0500569_023019
1043 Ga0500595_003784
1044 Ga0500607_127431
1045 Ga0500618_001706
1046 Ga0500618_001856
1047 Ga0500574_011403
1048 Ga0500619_001048
1049 Ga0500622_0000029
1050 Ga0500622_0005625
1051 Ga0500636_0000417
1052 Ga0501084_0016674
1053 Ga0501084_0036338
1054 Ga0501084_0202174
1055 Ga0500661_017398
1056 Ga0587080_022548
1057 Ga0501082_0001249
1058 Ga0501082_0031086
1059 Ga0501082_0167686
1060 Ga0530510_0010206
1061 Ga0530510_0109219
1062 2511251671
1063 2511385467
1064 2521559006
1065 2550694421
1066 2553003807
1067 2601669683
1068 2617919081
1069 2644027708
1070 2644255173
1071 2644359739
1072 2738742800
1073 2738847054
1074 2739277824
1075 2739346867
1076 2765568747
1077 2808981492
1078 2809129074
1079 2809148694
1080 2819542950
1081 2819591303
1082 2819615524
1083 2831428880
1084 2839096370
1085 2848696537
1086 2849664148
1087 2852621231
1088 2857549806
1089 2884816070
1090 2884837092
1091 2884853384
1092 2885080287
1093 2886633965
1094 2891634253
1095 2896155499
1096 2904444923
1097 2904532265
1098 2904584707
1099 2904591175
1100 2904605232
1101 2913852226
1102 2913915991
1103 2913944283
1104 2919048399
1105 2919081078
1106 2923512663
1107 2928132685
1108 2932415885
1109 2932421875
1110 642601802

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

57

299

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.98 1 255
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9785 3 255
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9762 1 255
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9672 3 255
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9656 1 255
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9816 1 255 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9778 1 255 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9601 1 255 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9564 1 255 3.60.10.10
af_P96273_24_289_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9547 3 255 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3IVF8-F1-model_v4 deleted 0.9938 3 179
AF-A0A658BMW6-F1-model_v4 Exodeoxyribonuclease III 0.9926 3 176 GO:0006281
GO:0008311
GO:0046872
AF-A0A0E2YYA8-F1-model_v4 Exodeoxyribonuclease III 0.9925 93 193 GO:0006281
GO:0008311
AF-A0A522A026-F1-model_v4 Exodeoxyribonuclease III 0.9924 104 255 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A1I2KBF9-F1-model_v4 Exodeoxyribonuclease III 0.9923 2 255 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872

Map