F463147

General Info

Members Datasets Scaffolds Average Seq Length
555 270 1110 207

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0224639|Ga0495674_0224639_612_1307
Length 231
Sequence MSPADRPFCGIRTVLLWLKVHMPLHESTEQVPAQVDFWFDPICPWAWITSRWILEVQKVRPVNITWHVMSLSVLNEDKDDLPEQYRELLQTGWGPVRVLIAAEQAHGPEVLGPLYTALGTRFHHEKAPRDRETIEAALAEAGLPAHLADAMDSTDYDAALRASHTEGIERVGYDVGTPVITVNGLSVFGPVVSPIPRGEAAARLWDGVLLIAGTEGFFELKRSRTRDPIFD

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
94 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
263 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
264 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
265 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
266 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
267 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
268 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
269 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
270 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 2.52
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 2.88
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0224639 3300047319 Bacteria 1551
2 JGI25407J50210_10026532 3300003373 Bacteria 1503
3 Ga0070658_10001528 3300005327 Bacteria 19605
4 Ga0070683_100167911 3300005329 Bacteria 2082
5 Ga0070683_100295778 3300005329 Bacteria 1540
6 Ga0068869_100531595 3300005334 Bacteria 985
7 Ga0070666_10052573 3300005335 Bacteria 2745
8 Ga0070680_100001058 3300005336 Bacteria 19716
9 Ga0070680_100289755 3300005336 Bacteria 1387
10 Ga0070660_100080911 3300005339 Bacteria 2550
11 Ga0070689_100230671 3300005340 Bacteria 1522
12 Ga0070661_100071147 3300005344 Bacteria 2559
13 Ga0070668_100020039 3300005347 Bacteria 5043
14 Ga0070675_100351684 3300005354 Bacteria 1307
15 Ga0070671_100136093 3300005355 Bacteria 2071
16 Ga0070674_100691619 3300005356 Bacteria 871
17 Ga0070673_100009103 3300005364 Bacteria 6648
18 Ga0070659_100050830 3300005366 Bacteria 3258
19 Ga0070659_100909453 3300005366 Bacteria 769
20 Ga0070667_100035056 3300005367 Bacteria 4202
21 Ga0070709_10026042 3300005434 Bacteria 3461
22 Ga0070709_10086653 3300005434 Bacteria 2056
23 Ga0070709_10323509 3300005434 Bacteria 1132
24 Ga0070714_100000680 3300005435 Bacteria 23985
25 Ga0070714_100026874 3300005435 Bacteria 4760
26 Ga0070714_100032593 3300005435 Bacteria 4351
27 Ga0070714_100036291 3300005435 Bacteria 4133
28 Ga0070714_100081330 3300005435 Bacteria 2820
29 Ga0070714_100114789 3300005435 Bacteria 2389
30 Ga0070714_100139918 3300005435 Bacteria 2171
31 Ga0070714_100251036 3300005435 Bacteria 1636
32 Ga0070714_100372699 3300005435 Bacteria 1344
33 Ga0070714_100482789 3300005435 Bacteria 1180
34 Ga0070713_100653507 3300005436 Bacteria 1001
35 Ga0070713_100819485 3300005436 Bacteria 893
36 Ga0070710_10012246 3300005437 Bacteria 4254
37 Ga0070710_10062119 3300005437 Bacteria 2129
38 Ga0070710_10066666 3300005437 Bacteria 2064
39 Ga0070710_10288758 3300005437 Bacteria 1067
40 Ga0070710_10363940 3300005437 Bacteria 960
41 Ga0070710_10490162 3300005437 Bacteria 840
42 Ga0070701_10079588 3300005438 Bacteria 1771
43 Ga0070711_100039417 3300005439 Bacteria 3182
44 Ga0070711_100051486 3300005439 Bacteria 2828
45 Ga0070711_100446953 3300005439 Bacteria 1057
46 Ga0070711_100448734 3300005439 Bacteria 1055
47 Ga0070700_100461514 3300005441 Bacteria 969
48 Ga0070708_100059206 3300005445 Bacteria 3414
49 Ga0070708_100100957 3300005445 Bacteria 2641
50 Ga0070708_100623903 3300005445 Bacteria 1016
51 Ga0070681_10006754 3300005458 Bacteria 11166
52 Ga0070681_10393932 3300005458 Bacteria 1296
53 Ga0070706_100003775 3300005467 Bacteria 14784
54 Ga0070706_100006621 3300005467 Bacteria 10928
55 Ga0070706_100008872 3300005467 Bacteria 9365
56 Ga0070706_100013498 3300005467 Bacteria 7556
57 Ga0070706_100017317 3300005467 Bacteria 6650
58 Ga0070706_100051472 3300005467 Bacteria 3801
59 Ga0070706_100054929 3300005467 Bacteria 3676
60 Ga0070706_100073303 3300005467 Bacteria 3169
61 Ga0070706_100127734 3300005467 Bacteria 2371
62 Ga0070706_100253261 3300005467 Bacteria 1644
63 Ga0070707_100000099 3300005468 Bacteria 78915
64 Ga0070707_100059424 3300005468 Bacteria 3668
65 Ga0070707_100070467 3300005468 Bacteria 3367
66 Ga0070707_100114435 3300005468 Bacteria 2617
67 Ga0070707_100245641 3300005468 Bacteria 1742
68 Ga0070707_100302217 3300005468 Bacteria 1555
69 Ga0070698_100000057 3300005471 Bacteria 79148
70 Ga0070698_100001403 3300005471 Bacteria 26681
71 Ga0070698_100003947 3300005471 Bacteria 16312
72 Ga0070698_100016931 3300005471 Bacteria 7685
73 Ga0070698_100028229 3300005471 Bacteria 5830
74 Ga0070698_100051939 3300005471 Bacteria 4173
75 Ga0070698_100060560 3300005471 Bacteria 3821
76 Ga0070698_100303289 3300005471 Bacteria 1528
77 Ga0070698_100401080 3300005471 Bacteria 1305
78 Ga0070699_100015608 3300005518 Bacteria 6524
79 Ga0070699_100051463 3300005518 Bacteria 3565
80 Ga0070699_100093494 3300005518 Bacteria 2631
81 Ga0070699_100402984 3300005518 Bacteria 1237
82 Ga0070679_100005432 3300005530 Bacteria 11812
83 Ga0070679_100024438 3300005530 Bacteria 5920
84 Ga0070679_100240106 3300005530 Bacteria 1769
85 Ga0070679_100273502 3300005530 Bacteria 1643
86 Ga0070684_100127264 3300005535 Bacteria 2295
87 Ga0070684_100148588 3300005535 Bacteria 2122
88 Ga0070684_100222133 3300005535 Bacteria 1723
89 Ga0070684_100345606 3300005535 Bacteria 1368
90 Ga0070697_100175535 3300005536 Bacteria 1815
91 Ga0070697_100507800 3300005536 Bacteria 1055
92 Ga0070697_100709780 3300005536 Bacteria 887
93 Ga0068853_100366198 3300005539 Bacteria 1344
94 Ga0070686_100056200 3300005544 Bacteria 2523
95 Ga0070695_100360551 3300005545 Bacteria 1091
96 Ga0070696_100055182 3300005546 Bacteria 2770
97 Ga0070693_100009277 3300005547 Bacteria 4888
98 Ga0070665_100238015 3300005548 Bacteria 1821
99 Ga0068855_100009145 3300005563 Bacteria 11966
100 Ga0068855_100494964 3300005563 Bacteria 1329
101 Ga0068855_100793321 3300005563 Bacteria 1007
102 Ga0070664_100304669 3300005564 Bacteria 1440
103 Ga0070664_100608682 3300005564 Bacteria 1013
104 Ga0068857_100142186 3300005577 Bacteria 2169
105 Ga0068857_100176265 3300005577 Bacteria 1945
106 Ga0068857_100518665 3300005577 Bacteria 1120
107 Ga0068857_101045423 3300005577 Bacteria 787
108 Ga0068854_100026554 3300005578 Bacteria 3981
109 Ga0068856_100048503 3300005614 Bacteria 4186
110 Ga0068856_100461196 3300005614 Bacteria 1291
111 Ga0068856_100531143 3300005614 Bacteria 1197
112 Ga0068856_100756805 3300005614 Bacteria 991
113 Ga0070702_100025172 3300005615 Bacteria 3185
114 Ga0068852_100461552 3300005616 Bacteria 1259
115 Ga0068859_100148275 3300005617 Bacteria 2421
116 Ga0068859_101155805 3300005617 Bacteria 852
117 Ga0068864_100160392 3300005618 Bacteria 2044
118 Ga0068861_100175120 3300005719 Bacteria 1781
119 Ga0068870_10139598 3300005840 Bacteria 1417
120 Ga0068863_100041127 3300005841 Bacteria 4394
121 Ga0068863_100274159 3300005841 Bacteria 1633
122 Ga0068863_100389488 3300005841 Bacteria 1362
123 Ga0068863_100497111 3300005841 Bacteria 1201
124 Ga0068858_100115674 3300005842 Bacteria 2506
125 Ga0068860_100275370 3300005843 Bacteria 1643
126 Ga0068862_100117793 3300005844 Bacteria 2338
127 Ga0081455_10000298 3300005937 Bacteria 65765
128 Ga0081455_10004995 3300005937 Bacteria 14669
129 Ga0081538_10000172 3300005981 Bacteria 69506
130 Ga0070717_10105387 3300006028 Bacteria 2400
131 Ga0070717_10153398 3300006028 Bacteria 1994
132 Ga0070717_10174006 3300006028 Bacteria 1873
133 Ga0070717_10224206 3300006028 Bacteria 1653
134 Ga0070717_10781022 3300006028 Bacteria 869
135 Ga0070715_10006535 3300006163 Bacteria 3971
136 Ga0070715_10081417 3300006163 Bacteria 1470
137 Ga0070715_10085910 3300006163 Bacteria 1438
138 Ga0070715_10208928 3300006163 Bacteria 996
139 Ga0070716_100013454 3300006173 Bacteria 4170
140 Ga0070716_100061224 3300006173 Bacteria 2177
141 Ga0070716_100075502 3300006173 Bacteria 1995
142 Ga0070712_100066264 3300006175 Bacteria 2566
143 Ga0070712_100099106 3300006175 Bacteria 2150
144 Ga0070712_100252327 3300006175 Bacteria 1410
145 Ga0070712_100421388 3300006175 Bacteria 1106
146 Ga0097621_100253610 3300006237 Bacteria 1541
147 Ga0068871_100390481 3300006358 Bacteria 1238
148 Ga0075430_100066567 3300006846 Bacteria 3025
149 Ga0075431_100001963 3300006847 Bacteria 19621
150 Ga0075431_100021939 3300006847 Bacteria 6528
151 Ga0075434_100103207 3300006871 Bacteria 2859
152 Ga0075434_100290148 3300006871 Bacteria 1656
153 Ga0075429_100011256 3300006880 Bacteria 7742
154 Ga0068865_100077337 3300006881 Bacteria 2378
155 Ga0075436_100138665 3300006914 Bacteria 1708
156 Ga0075436_100273009 3300006914 Bacteria 1208
157 Ga0097620_100148275 3300006931 Bacteria 2421
158 Ga0097620_101156164 3300006931 Bacteria 852
159 Ga0075435_100840634 3300007076 Bacteria 800
160 Ga0099794_10102355 3300007265 Bacteria 1430
161 Ga0105251_10053999 3300009011 Bacteria 1909
162 Ga0105240_10006823 3300009093 Bacteria 16700
163 Ga0105240_10331744 3300009093 Bacteria 1731
164 Ga0111539_10017115 3300009094 Bacteria 8973
165 Ga0105245_10022733 3300009098 Bacteria 5503
166 Ga0105247_10110550 3300009101 Bacteria 1768
167 Ga0114129_10214373 3300009147 Bacteria 2601
168 Ga0105242_10118796 3300009176 Bacteria 2265
169 Ga0105249_10497062 3300009553 Bacteria 1264
170 Ga0099796_10224783 3300010159 Bacteria 770
171 Ga0105239_10642627 3300010375 Bacteria 1212
172 Ga0105246_10023695 3300011119 Bacteria 3975
173 Ga0157370_10030913 3300013104 Bacteria 5245
174 Ga0157370_10361866 3300013104 Bacteria 1337
175 Ga0157370_10478468 3300013104 Bacteria 1144
176 Ga0157370_10707181 3300013104 Bacteria 920
177 Ga0157369_10032231 3300013105 Bacteria 5764
178 Ga0157369_10305829 3300013105 Bacteria 1654
179 Ga0157369_10688078 3300013105 Bacteria 1053
180 Ga0157374_10047464 3300013296 Bacteria 3982
181 Ga0163162_10240209 3300013306 Bacteria 1942
182 Ga0157372_10426469 3300013307 Bacteria 1546
183 Ga0157372_11232780 3300013307 Bacteria 864
184 Ga0157375_10192017 3300013308 Bacteria 2197
185 Ga0157375_10362289 3300013308 Bacteria 1616
186 Ga0157375_11051676 3300013308 Bacteria 952
187 Ga0163163_10097356 3300014325 Bacteria 2962
188 Ga0163163_10222750 3300014325 Bacteria 1935
189 Ga0163163_10326385 3300014325 Bacteria 1589
190 Ga0157379_10003574 3300014968 Bacteria 13173
191 Ga0157376_10030150 3300014969 Bacteria 4327
192 Ga0206356_10079390 3300020070 Bacteria 703
193 Ga0206356_10858152 3300020070 Bacteria 1965
194 Ga0206355_1707556 3300020076 Bacteria 1064
195 Ga0206351_10334080 3300020077 Bacteria 1461
196 Ga0206354_11234884 3300020081 Bacteria 680
197 Ga0206353_10353071 3300020082 Bacteria 34977
198 Ga0206353_11049559 3300020082 Bacteria 1518
199 Ga0213875_10002903 3300021388 Bacteria 10011
200 Ga0213875_10003162 3300021388 Bacteria 9468
201 Ga0213875_10005542 3300021388 Bacteria 6759
202 Ga0213875_10011884 3300021388 Bacteria 4316
203 Ga0224712_10013011 3300022467 Bacteria 2637
204 Ga0224712_10075106 3300022467 Bacteria 1382
205 Ga0224712_10084406 3300022467 Bacteria 1318
206 Ga0224712_10203796 3300022467 Bacteria 900
207 Ga0224712_10209247 3300022467 Bacteria 889
208 Ga0224712_10214792 3300022467 Bacteria 878
209 Ga0228600_1007971 3300024123 Bacteria 801
210 Ga0207653_10002021 3300025885 Bacteria 6477
211 Ga0207692_10002193 3300025898 Bacteria 7467
212 Ga0207692_10184580 3300025898 Bacteria 1217
213 Ga0207692_10265066 3300025898 Bacteria 1034
214 Ga0207692_10289022 3300025898 Bacteria 994
215 Ga0207692_10373979 3300025898 Bacteria 883
216 Ga0207688_10005447 3300025901 Bacteria 6918
217 Ga0207685_10022730 3300025905 Bacteria 2124
218 Ga0207685_10199739 3300025905 Bacteria 938
219 Ga0207685_10272829 3300025905 Bacteria 827
220 Ga0207699_10004150 3300025906 Bacteria 6936
221 Ga0207699_10005417 3300025906 Bacteria 6110
222 Ga0207699_10053042 3300025906 Bacteria 2403
223 Ga0207699_10069542 3300025906 Bacteria 2147
224 Ga0207643_10030552 3300025908 Bacteria 2999
225 Ga0207705_10002552 3300025909 Bacteria 13998
226 Ga0207684_10007038 3300025910 Bacteria 10174
227 Ga0207684_10028508 3300025910 Bacteria 4757
228 Ga0207684_10030012 3300025910 Bacteria 4629
229 Ga0207684_10081557 3300025910 Bacteria 2753
230 Ga0207684_10081851 3300025910 Bacteria 2748
231 Ga0207684_10092287 3300025910 Bacteria 2580
232 Ga0207684_10206361 3300025910 Bacteria 1695
233 Ga0207684_10234507 3300025910 Bacteria 1583
234 Ga0207684_10291055 3300025910 Bacteria 1408
235 Ga0207654_10305857 3300025911 Bacteria 1083
236 Ga0207707_10001870 3300025912 Bacteria 19239
237 Ga0207671_10108928 3300025914 Bacteria 2106
238 Ga0207693_10001994 3300025915 Bacteria 17915
239 Ga0207693_10040554 3300025915 Bacteria 3667
240 Ga0207693_10131639 3300025915 Bacteria 1966
241 Ga0207693_10137599 3300025915 Bacteria 1920
242 Ga0207693_10189644 3300025915 Bacteria 1618
243 Ga0207663_10019696 3300025916 Bacteria 3807
244 Ga0207663_10181583 3300025916 Bacteria 1503
245 Ga0207663_10197403 3300025916 Bacteria 1449
246 Ga0207663_10294477 3300025916 Bacteria 1210
247 Ga0207663_10368759 3300025916 Bacteria 1091
248 Ga0207660_10000283 3300025917 Bacteria 33496
249 Ga0207660_10191350 3300025917 Bacteria 1593
250 Ga0207662_10004275 3300025918 Bacteria 7499
251 Ga0207657_10022638 3300025919 Bacteria 5874
252 Ga0207657_10115550 3300025919 Bacteria 2212
253 Ga0207652_10000792 3300025921 Bacteria 30180
254 Ga0207652_10119326 3300025921 Bacteria 2345
255 Ga0207652_10292138 3300025921 Bacteria 1471
256 Ga0207646_10020733 3300025922 Bacteria 6086
257 Ga0207646_10023758 3300025922 Bacteria 5625
258 Ga0207646_10050956 3300025922 Bacteria 3704
259 Ga0207646_10158336 3300025922 Bacteria 2043
260 Ga0207646_10186433 3300025922 Bacteria 1874
261 Ga0207646_10192941 3300025922 Bacteria 1840
262 Ga0207646_10245408 3300025922 Bacteria 1618
263 Ga0207646_10509897 3300025922 Bacteria 1083
264 Ga0207646_10594701 3300025922 Bacteria 993
265 Ga0207687_10144697 3300025927 Bacteria 1807
266 Ga0207700_10094684 3300025928 Bacteria 2367
267 Ga0207700_10135247 3300025928 Bacteria 2018
268 Ga0207700_10148282 3300025928 Bacteria 1936
269 Ga0207700_10523692 3300025928 Bacteria 1051
270 Ga0207700_10874514 3300025928 Bacteria 804
271 Ga0207664_10001098 3300025929 Bacteria 18046
272 Ga0207664_10029688 3300025929 Bacteria 4167
273 Ga0207664_10075730 3300025929 Bacteria 2721
274 Ga0207664_10083611 3300025929 Bacteria 2602
275 Ga0207664_10098290 3300025929 Bacteria 2413
276 Ga0207664_10113486 3300025929 Bacteria 2256
277 Ga0207664_10297951 3300025929 Bacteria 1418
278 Ga0207664_10403634 3300025929 Bacteria 1216
279 Ga0207690_10631629 3300025932 Bacteria 876
280 Ga0207686_10460751 3300025934 Bacteria 980
281 Ga0207709_10509246 3300025935 Bacteria 941
282 Ga0207670_10077628 3300025936 Bacteria 2314
283 Ga0207665_10000894 3300025939 Bacteria 20058
284 Ga0207665_10018309 3300025939 Bacteria 4601
285 Ga0207665_10075528 3300025939 Bacteria 2309
286 Ga0207711_10229371 3300025941 Bacteria 1700
287 Ga0207711_10660625 3300025941 Bacteria 975
288 Ga0207689_10020014 3300025942 Bacteria 5637
289 Ga0207661_10161083 3300025944 Bacteria 1947
290 Ga0207679_10052015 3300025945 Bacteria 3002
291 Ga0207667_10043494 3300025949 Bacteria 4766
292 Ga0207667_10180384 3300025949 Bacteria 2169
293 Ga0207667_11053728 3300025949 Bacteria 798
294 Ga0207651_10406057 3300025960 Bacteria 1160
295 Ga0207712_10158109 3300025961 Bacteria 1758
296 Ga0207640_11027071 3300025981 Bacteria 726
297 Ga0207658_10079161 3300025986 Bacteria 2513
298 Ga0207703_10078473 3300026035 Bacteria 2743
299 Ga0207639_10120047 3300026041 Bacteria 2158
300 Ga0207678_10016063 3300026067 Bacteria 6573
301 Ga0207702_10020452 3300026078 Bacteria 5483
302 Ga0207702_10088410 3300026078 Bacteria 2706
303 Ga0207702_10090053 3300026078 Bacteria 2684
304 Ga0207641_10093352 3300026088 Bacteria 2638
305 Ga0207641_10132503 3300026088 Bacteria 2239
306 Ga0207641_10594386 3300026088 Bacteria 1083
307 Ga0207641_10620317 3300026088 Bacteria 1060
308 Ga0207676_10168489 3300026095 Bacteria 1906
309 Ga0207674_10128353 3300026116 Bacteria 2500
310 Ga0207674_10203370 3300026116 Bacteria 1930
311 Ga0207674_10228003 3300026116 Bacteria 1811
312 Ga0207674_10260062 3300026116 Bacteria 1683
313 Ga0207683_10069998 3300026121 Bacteria 3099
314 Ga0207683_11280610 3300026121 Bacteria 679
315 Ga0207698_10345267 3300026142 Bacteria 1404
316 Ga0207428_10025216 3300027907 Bacteria 4978
317 Ga0265336_10048541 3300028666 Bacteria 1287
318 Ga0307515_10090850 3300028794 Bacteria 3824
319 Ga0265338_10001490 3300028800 Bacteria 37899
320 Ga0265762_1022676 3300030760 Bacteria 1162
321 Ga0307516_10419673 3300031730 Bacteria 996
322 Ga0307405_10002762 3300031731 Bacteria 7868
323 Ga0307410_10064338 3300031852 Bacteria 2520
324 Ga0307407_10508096 3300031903 Bacteria 884
325 Ga0307412_10172458 3300031911 Bacteria 1619
326 Ga0307409_100000452 3300031995 Bacteria 17397
327 Ga0307416_100000505 3300032002 Bacteria 19894
328 Ga0307416_100133157 3300032002 Bacteria 2243
329 Ga0307415_100001254 3300032126 Bacteria 11927
330 Ga0307415_101237993 3300032126 Bacteria 705
331 Ga0307507_10029089 3300033179 Bacteria 5868
332 Ga0307507_10068751 3300033179 Bacteria 3229
333 Ga0307510_10094315 3300033180 Bacteria 2819
334 Ga0316214_1007944 3300033545 Bacteria 1422
335 Ga0373959_0013236 3300034820 Bacteria 1485
336 Ga0373926_0020750 3300035083 Bacteria 2271
337 Ga0373926_0032604 3300035083 Bacteria 1838
338 Ga0373926_0179210 3300035083 Bacteria 812
339 Ga0373934_0000053 3300035086 Bacteria 39071
340 Ga0373934_0021412 3300035086 Bacteria 2489
341 Ga0373923_0027194 3300035111 Bacteria 2281
342 Ga0373923_0063243 3300035111 Bacteria 1576
343 Ga0373923_0143704 3300035111 Bacteria 1080
344 Ga0373936_0028386 3300035113 Bacteria 2199
345 Ga0373936_0206417 3300035113 Bacteria 868
346 Ga0373945_0022793 3300035116 Bacteria 2159
347 Ga0373953_0090239 3300035117 Bacteria 1281
348 Ga0373954_0000809 3300035118 Bacteria 12111
349 Ga0373956_0000325 3300035119 Bacteria 19198
350 Ga0373957_0000015 3300035120 Bacteria 43575
351 Ga0373957_0010422 3300035120 Bacteria 3073
352 Ga0373943_0004435 3300035170 Bacteria 6350
353 Ga0373943_0172891 3300035170 Bacteria 1183
354 Ga0373943_0385357 3300035170 Bacteria 807
355 Ga0373946_0069927 3300035171 Bacteria 1513
356 Ga0373946_0249354 3300035171 Bacteria 865
357 Ga0373955_0000027 3300035172 Bacteria 58251
358 Ga0373955_0012415 3300035172 Bacteria 4094
359 Ga0373955_0033336 3300035172 Bacteria 2712
360 Ga0373955_0093467 3300035172 Bacteria 1717
361 Ga0373924_0000084 3300035410 Bacteria 25342
362 Ga0373935_0154721 3300035692 Bacteria 1559
363 Ga0373935_0347073 3300035692 Bacteria 1057
364 Ga0373927_0014646 3300035695 Bacteria 5186
365 Ga0373933_0000025 3300035724 Bacteria 90735
366 Ga0373933_0009754 3300035724 Bacteria 5255
367 Ga0373947_0194610 3300035725 Bacteria 1324
368 Ga0373937_0000034 3300036401 Bacteria 116552
369 Ga0373937_0053710 3300036401 Bacteria 3695
370 Ga0373937_0199772 3300036401 Bacteria 1879
371 Ga0373925_0000946 3300037068 Bacteria 26389
372 Ga0373925_0022657 3300037068 Bacteria 4582
373 Ga0373925_0317317 3300037068 Bacteria 1260
374 Ga0373925_0351149 3300037068 Bacteria 1197
375 Ga0395899_0148635 3300037312 Bacteria 1662
376 Ga0395900_0034368 3300037418 Bacteria 5220
377 Ga0395898_0033446 3300037466 Bacteria 5131
378 Ga0436364_0360509 3300037853 Bacteria 7787
379 Ga0436364_0378794 3300037853 Bacteria 13052
380 Ga0436364_1336918 3300037853 Bacteria 10058
381 Ga0436364_1463345 3300037853 Bacteria 72937
382 Ga0395901_0162840 3300038443 Bacteria 2342
383 Ga0436360_0331769 3300039438 Bacteria 930
384 Ga0436361_1013087 3300039447 Bacteria 758
385 Ga0436362_0272762 3300039453 Bacteria 987
386 Ga0466963_0248206 3300044694 Bacteria 1249
387 Ga0466968_0048688 3300044735 Bacteria 1804
388 Ga0466970_0080697 3300044765 Bacteria 1758
389 Ga0466957_0675841 3300044842 Bacteria 727
390 Ga0466960_0206185 3300044901 Bacteria 1076
391 Ga0466959_0055634 3300045049 Bacteria 2888
392 Ga0466967_0094661 3300045976 Bacteria 2720
393 Ga0466967_0585395 3300045976 Bacteria 1100
394 Ga0466967_0667345 3300045976 Bacteria 1029
395 Ga0495592_0000016 3300046454 Bacteria 144922
396 Ga0495592_0005572 3300046454 Bacteria 9313
397 Ga0495629_0205153 3300046459 Bacteria 1362
398 Ga0495641_0007334 3300046461 Bacteria 6906
399 Ga0495641_0104898 3300046461 Bacteria 1261
400 Ga0495641_0108118 3300046461 Bacteria 1241
401 Ga0495651_0000005 3300046462 Bacteria 173396
402 Ga0495651_0013770 3300046462 Bacteria 6253
403 Ga0495651_0021813 3300046462 Bacteria 4979
404 Ga0495651_0109327 3300046462 Bacteria 2046
405 Ga0495653_0001819 3300046463 Bacteria 16822
406 Ga0495653_0049406 3300046463 Bacteria 3240
407 Ga0495653_0057203 3300046463 Bacteria 2969
408 Ga0495582_0263024 3300046473 Bacteria 990
409 Ga0495662_0017665 3300046476 Bacteria 3453
410 Ga0495662_0018322 3300046476 Bacteria 3388
411 Ga0495662_0185400 3300046476 Bacteria 1026
412 Ga0495662_0196322 3300046476 Bacteria 995
413 Ga0495664_0001359 3300046477 Bacteria 12905
414 Ga0495664_0010940 3300046477 Bacteria 5104
415 Ga0495664_0056179 3300046477 Bacteria 2341
416 Ga0495594_0036192 3300046499 Bacteria 2691
417 Ga0495608_0000057 3300046511 Bacteria 90735
418 Ga0495608_0084400 3300046511 Bacteria 2060
419 Ga0495608_0218037 3300046511 Bacteria 1198
420 Ga0495618_0148422 3300046514 Bacteria 1498
421 Ga0495618_0148457 3300046514 Bacteria 1498
422 Ga0495628_0000073 3300046516 Bacteria 79628
423 Ga0495628_0040416 3300046516 Bacteria 3727
424 Ga0495628_0068378 3300046516 Bacteria 2772
425 Ga0495628_0138762 3300046516 Bacteria 1856
426 Ga0495628_0162640 3300046516 Bacteria 1696
427 Ga0495630_0062897 3300046517 Bacteria 2788
428 Ga0495630_0088256 3300046517 Bacteria 2342
429 Ga0495630_0392619 3300046517 Bacteria 1063
430 Ga0495630_0529788 3300046517 Bacteria 903
431 Ga0495652_0000054 3300046529 Bacteria 116611
432 Ga0495652_0010609 3300046529 Bacteria 8347
433 Ga0495652_0018557 3300046529 Bacteria 6200
434 Ga0495652_0037757 3300046529 Bacteria 4188
435 Ga0495652_0139361 3300046529 Bacteria 1909
436 Ga0495652_0175212 3300046529 Bacteria 1652
437 Ga0495652_0195597 3300046529 Bacteria 1539
438 Ga0495665_0045996 3300046531 Bacteria 2318
439 Ga0495640_0008894 3300046533 Bacteria 7843
440 Ga0495587_0000030 3300046536 Bacteria 135844
441 Ga0495587_0031277 3300046536 Bacteria 3223
442 Ga0495587_0053159 3300046536 Bacteria 2388
443 Ga0495587_0132134 3300046536 Bacteria 1426
444 Ga0495645_0028521 3300046543 Bacteria 4057
445 Ga0495645_0128725 3300046543 Bacteria 1777
446 Ga0495667_0000025 3300046559 Bacteria 155090
447 Ga0495667_0034199 3300046559 Bacteria 3398
448 Ga0495667_0125747 3300046559 Bacteria 1654
449 Ga0495667_0152604 3300046559 Bacteria 1487
450 Ga0495667_0169178 3300046559 Bacteria 1404
451 Ga0495667_0210965 3300046559 Bacteria 1241
452 Ga0495667_0214430 3300046559 Bacteria 1230
453 Ga0495634_0173659 3300046642 Bacteria 1353
454 Ga0495635_0035584 3300046663 Bacteria 3453
455 Ga0495635_0125886 3300046663 Bacteria 1747
456 Ga0495588_0091753 3300046674 Bacteria 1592
457 Ga0495657_0000018 3300046675 Bacteria 173397
458 Ga0495657_0023842 3300046675 Bacteria 4366
459 Ga0495657_0029368 3300046675 Bacteria 3857
460 Ga0495657_0037984 3300046675 Bacteria 3315
461 Ga0495657_0063434 3300046675 Bacteria 2437
462 Ga0495599_0000054 3300046678 Bacteria 79938
463 Ga0495599_0001992 3300046678 Bacteria 11813
464 Ga0495599_0056818 3300046678 Bacteria 2449
465 Ga0495599_0069194 3300046678 Bacteria 2203
466 Ga0495599_0125415 3300046678 Bacteria 1596
467 Ga0495599_0185014 3300046678 Bacteria 1283
468 Ga0495623_0000582 3300046679 Bacteria 24382
469 Ga0495646_0013644 3300046680 Bacteria 5166
470 Ga0495646_0061139 3300046680 Bacteria 2244
471 Ga0495624_0007142 3300046690 Bacteria 7860
472 Ga0495600_0022171 3300046809 Bacteria 4075
473 Ga0495600_0090349 3300046809 Bacteria 1997
474 Ga0495600_0119277 3300046809 Bacteria 1716
475 Ga0495600_0336879 3300046809 Bacteria 946
476 Ga0495604_0000066 3300047317 Bacteria 90720
477 Ga0495604_0014421 3300047317 Bacteria 6304
478 Ga0495604_0075260 3300047317 Bacteria 2543
479 Ga0495674_0058742 3300047319 Bacteria 3361
480 Ga0495674_0077903 3300047319 Bacteria 2849
481 Ga0495674_0218662 3300047319 Bacteria 1575
482 Ga0495674_0341224 3300047319 Bacteria 1217
483 Ga0495676_0145894 3300047321 Bacteria 1690
484 Ga0495680_0000032 3300047322 Bacteria 108460
485 Ga0495680_0019660 3300047322 Bacteria 5698
486 Ga0495680_0083599 3300047322 Bacteria 2406
487 Ga0495680_0090283 3300047322 Bacteria 2298
488 Ga0495680_0270407 3300047322 Bacteria 1200
489 Ga0495675_0002070 3300047444 Bacteria 11973
490 Ga0495675_0044645 3300047444 Bacteria 2823
491 Ga0495675_0078204 3300047444 Bacteria 2083
492 Ga0495684_0006951 3300047471 Bacteria 8787
493 Ga0495684_0016877 3300047471 Bacteria 5625
494 Ga0495684_0029249 3300047471 Bacteria 4229
495 Ga0495684_0294190 3300047471 Bacteria 1168
496 Ga0495602_0000123 3300048088 Bacteria 72994
497 Ga0495602_0046260 3300048088 Bacteria 3932
498 Ga0495602_0101420 3300048088 Bacteria 2361
499 Ga0496102_0056828 3300048905 Bacteria 3571
500 Ga0496104_0000379 3300048907 Bacteria 39343
501 Ga0496104_0033643 3300048907 Bacteria 4777
502 Ga0496104_0244494 3300048907 Bacteria 1707
503 Ga0496104_0975568 3300048907 Bacteria 752
504 Ga0496105_0003646 3300048908 Bacteria 11445
505 Ga0496105_0042563 3300048908 Bacteria 3744
506 Ga0496105_0318676 3300048908 Bacteria 1247
507 Ga0496106_0109881 3300048909 Bacteria 2146
508 Ga0496106_0256095 3300048909 Bacteria 1400
509 Ga0496108_0010156 3300048911 Bacteria 7641
510 Ga0496108_0037134 3300048911 Bacteria 4056
511 Ga0496109_0026333 3300048912 Bacteria 5186
512 Ga0496109_0048764 3300048912 Bacteria 3853
513 Ga0496112_0224441 3300048915 Bacteria 1834
514 Ga0496115_0240645 3300048918 Bacteria 1491
515 Ga0496119_0244684 3300048922 Bacteria 907
516 Ga0501034_0029357 3300049571 Bacteria 5588
517 Ga0501036_0000627 3300049572 Bacteria 25739
518 Ga0501037_0006911 3300049573 Bacteria 8285
519 Ga0501038_0017684 3300049574 Bacteria 6444
520 Ga0501038_0081933 3300049574 Bacteria 2718
521 Ga0501039_0022612 3300049575 Bacteria 4826
522 Ga0501042_0003012 3300049578 Bacteria 10481
523 Ga0501043_0002045 3300049579 Bacteria 17217
524 Ga0501047_0009755 3300049581 Bacteria 9071
525 Ga0501048_0003714 3300049582 Bacteria 11633
526 Ga0501070_0037175 3300049586 Bacteria 4065
527 Ga0501073_0057055 3300049589 Bacteria 2730
528 Ga0501074_0000296 3300049590 Bacteria 28700
529 Ga0501074_0319180 3300049590 Bacteria 1103
530 Ga0501077_0132912 3300049593 Bacteria 1578
531 Ga0501044_0030529 3300049823 Bacteria 5679
532 nmdc:mga05p37_152_c1 3300050507 Bacteria 65549
533 nmdc:mga09592_63_c1 3300050508 Bacteria 60777
534 nmdc:mga0qj67_39354_c1 3300050509 Bacteria 3712
535 nmdc:mga06r32_1726_c1 3300050510 Bacteria 19669
536 nmdc:mga06r32_9202_c1 3300050510 Bacteria 8905
537 nmdc:mga0rr50_719069_c1 3300050513 Bacteria 852
538 nmdc:mga08x19_213444_c1 3300050514 Bacteria 1325
539 nmdc:mga0a205_165978_c1 3300050515 Bacteria 2104
540 Ga0495612_0027311 3300053078 Bacteria 2295
541 Ga0495612_0059072 3300053078 Bacteria 1585
542 Ga0495612_0087596 3300053078 Bacteria 1314
543 Ga0495595_0032546 3300053084 Bacteria 2349
544 Ga0495595_0218364 3300053084 Bacteria 951
545 Ga0495619_0281806 3300053085 Bacteria 1152
546 Ga0495619_0504505 3300053085 Bacteria 832
547 Ga0500594_0056576 3300053118 Bacteria 1119
548 Ga0500588_0005290 3300053146 Bacteria 2858
549 2515855636 2515154155 Bacteria 7985436
550 2676475660 2675903058 Bacteria 6822861
551 2827631388 2827628540 Bacteria 6858585
552 2891396429 2891395885 Bacteria 9251614
553 2891557894 2891554331 Bacteria 8812224
554 2995471561 2995463766 Bacteria 8577691
555 8053950021 8053945823 Bacteria 8962862
556 Ga0495674_0224639
557 JGI25407J50210_10026532
558 Ga0070658_10001528
559 Ga0070683_100167911
560 Ga0070683_100295778
561 Ga0068869_100531595
562 Ga0070666_10052573
563 Ga0070680_100001058
564 Ga0070680_100289755
565 Ga0070660_100080911
566 Ga0070689_100230671
567 Ga0070661_100071147
568 Ga0070668_100020039
569 Ga0070675_100351684
570 Ga0070671_100136093
571 Ga0070674_100691619
572 Ga0070673_100009103
573 Ga0070659_100050830
574 Ga0070659_100909453
575 Ga0070667_100035056
576 Ga0070709_10026042
577 Ga0070709_10086653
578 Ga0070709_10323509
579 Ga0070714_100000680
580 Ga0070714_100026874
581 Ga0070714_100032593
582 Ga0070714_100036291
583 Ga0070714_100081330
584 Ga0070714_100114789
585 Ga0070714_100139918
586 Ga0070714_100251036
587 Ga0070714_100372699
588 Ga0070714_100482789
589 Ga0070713_100653507
590 Ga0070713_100819485
591 Ga0070710_10012246
592 Ga0070710_10062119
593 Ga0070710_10066666
594 Ga0070710_10288758
595 Ga0070710_10363940
596 Ga0070710_10490162
597 Ga0070701_10079588
598 Ga0070711_100039417
599 Ga0070711_100051486
600 Ga0070711_100446953
601 Ga0070711_100448734
602 Ga0070700_100461514
603 Ga0070708_100059206
604 Ga0070708_100100957
605 Ga0070708_100623903
606 Ga0070681_10006754
607 Ga0070681_10393932
608 Ga0070706_100003775
609 Ga0070706_100006621
610 Ga0070706_100008872
611 Ga0070706_100013498
612 Ga0070706_100017317
613 Ga0070706_100051472
614 Ga0070706_100054929
615 Ga0070706_100073303
616 Ga0070706_100127734
617 Ga0070706_100253261
618 Ga0070707_100000099
619 Ga0070707_100059424
620 Ga0070707_100070467
621 Ga0070707_100114435
622 Ga0070707_100245641
623 Ga0070707_100302217
624 Ga0070698_100000057
625 Ga0070698_100001403
626 Ga0070698_100003947
627 Ga0070698_100016931
628 Ga0070698_100028229
629 Ga0070698_100051939
630 Ga0070698_100060560
631 Ga0070698_100303289
632 Ga0070698_100401080
633 Ga0070699_100015608
634 Ga0070699_100051463
635 Ga0070699_100093494
636 Ga0070699_100402984
637 Ga0070679_100005432
638 Ga0070679_100024438
639 Ga0070679_100240106
640 Ga0070679_100273502
641 Ga0070684_100127264
642 Ga0070684_100148588
643 Ga0070684_100222133
644 Ga0070684_100345606
645 Ga0070697_100175535
646 Ga0070697_100507800
647 Ga0070697_100709780
648 Ga0068853_100366198
649 Ga0070686_100056200
650 Ga0070695_100360551
651 Ga0070696_100055182
652 Ga0070693_100009277
653 Ga0070665_100238015
654 Ga0068855_100009145
655 Ga0068855_100494964
656 Ga0068855_100793321
657 Ga0070664_100304669
658 Ga0070664_100608682
659 Ga0068857_100142186
660 Ga0068857_100176265
661 Ga0068857_100518665
662 Ga0068857_101045423
663 Ga0068854_100026554
664 Ga0068856_100048503
665 Ga0068856_100461196
666 Ga0068856_100531143
667 Ga0068856_100756805
668 Ga0070702_100025172
669 Ga0068852_100461552
670 Ga0068859_100148275
671 Ga0068859_101155805
672 Ga0068864_100160392
673 Ga0068861_100175120
674 Ga0068870_10139598
675 Ga0068863_100041127
676 Ga0068863_100274159
677 Ga0068863_100389488
678 Ga0068863_100497111
679 Ga0068858_100115674
680 Ga0068860_100275370
681 Ga0068862_100117793
682 Ga0081455_10000298
683 Ga0081455_10004995
684 Ga0081538_10000172
685 Ga0070717_10105387
686 Ga0070717_10153398
687 Ga0070717_10174006
688 Ga0070717_10224206
689 Ga0070717_10781022
690 Ga0070715_10006535
691 Ga0070715_10081417
692 Ga0070715_10085910
693 Ga0070715_10208928
694 Ga0070716_100013454
695 Ga0070716_100061224
696 Ga0070716_100075502
697 Ga0070712_100066264
698 Ga0070712_100099106
699 Ga0070712_100252327
700 Ga0070712_100421388
701 Ga0097621_100253610
702 Ga0068871_100390481
703 Ga0075430_100066567
704 Ga0075431_100001963
705 Ga0075431_100021939
706 Ga0075434_100103207
707 Ga0075434_100290148
708 Ga0075429_100011256
709 Ga0068865_100077337
710 Ga0075436_100138665
711 Ga0075436_100273009
712 Ga0097620_100148275
713 Ga0097620_101156164
714 Ga0075435_100840634
715 Ga0099794_10102355
716 Ga0105251_10053999
717 Ga0105240_10006823
718 Ga0105240_10331744
719 Ga0111539_10017115
720 Ga0105245_10022733
721 Ga0105247_10110550
722 Ga0114129_10214373
723 Ga0105242_10118796
724 Ga0105249_10497062
725 Ga0099796_10224783
726 Ga0105239_10642627
727 Ga0105246_10023695
728 Ga0157370_10030913
729 Ga0157370_10361866
730 Ga0157370_10478468
731 Ga0157370_10707181
732 Ga0157369_10032231
733 Ga0157369_10305829
734 Ga0157369_10688078
735 Ga0157374_10047464
736 Ga0163162_10240209
737 Ga0157372_10426469
738 Ga0157372_11232780
739 Ga0157375_10192017
740 Ga0157375_10362289
741 Ga0157375_11051676
742 Ga0163163_10097356
743 Ga0163163_10222750
744 Ga0163163_10326385
745 Ga0157379_10003574
746 Ga0157376_10030150
747 Ga0206356_10079390
748 Ga0206356_10858152
749 Ga0206355_1707556
750 Ga0206351_10334080
751 Ga0206354_11234884
752 Ga0206353_10353071
753 Ga0206353_11049559
754 Ga0213875_10002903
755 Ga0213875_10003162
756 Ga0213875_10005542
757 Ga0213875_10011884
758 Ga0224712_10013011
759 Ga0224712_10075106
760 Ga0224712_10084406
761 Ga0224712_10203796
762 Ga0224712_10209247
763 Ga0224712_10214792
764 Ga0228600_1007971
765 Ga0207653_10002021
766 Ga0207692_10002193
767 Ga0207692_10184580
768 Ga0207692_10265066
769 Ga0207692_10289022
770 Ga0207692_10373979
771 Ga0207688_10005447
772 Ga0207685_10022730
773 Ga0207685_10199739
774 Ga0207685_10272829
775 Ga0207699_10004150
776 Ga0207699_10005417
777 Ga0207699_10053042
778 Ga0207699_10069542
779 Ga0207643_10030552
780 Ga0207705_10002552
781 Ga0207684_10007038
782 Ga0207684_10028508
783 Ga0207684_10030012
784 Ga0207684_10081557
785 Ga0207684_10081851
786 Ga0207684_10092287
787 Ga0207684_10206361
788 Ga0207684_10234507
789 Ga0207684_10291055
790 Ga0207654_10305857
791 Ga0207707_10001870
792 Ga0207671_10108928
793 Ga0207693_10001994
794 Ga0207693_10040554
795 Ga0207693_10131639
796 Ga0207693_10137599
797 Ga0207693_10189644
798 Ga0207663_10019696
799 Ga0207663_10181583
800 Ga0207663_10197403
801 Ga0207663_10294477
802 Ga0207663_10368759
803 Ga0207660_10000283
804 Ga0207660_10191350
805 Ga0207662_10004275
806 Ga0207657_10022638
807 Ga0207657_10115550
808 Ga0207652_10000792
809 Ga0207652_10119326
810 Ga0207652_10292138
811 Ga0207646_10020733
812 Ga0207646_10023758
813 Ga0207646_10050956
814 Ga0207646_10158336
815 Ga0207646_10186433
816 Ga0207646_10192941
817 Ga0207646_10245408
818 Ga0207646_10509897
819 Ga0207646_10594701
820 Ga0207687_10144697
821 Ga0207700_10094684
822 Ga0207700_10135247
823 Ga0207700_10148282
824 Ga0207700_10523692
825 Ga0207700_10874514
826 Ga0207664_10001098
827 Ga0207664_10029688
828 Ga0207664_10075730
829 Ga0207664_10083611
830 Ga0207664_10098290
831 Ga0207664_10113486
832 Ga0207664_10297951
833 Ga0207664_10403634
834 Ga0207690_10631629
835 Ga0207686_10460751
836 Ga0207709_10509246
837 Ga0207670_10077628
838 Ga0207665_10000894
839 Ga0207665_10018309
840 Ga0207665_10075528
841 Ga0207711_10229371
842 Ga0207711_10660625
843 Ga0207689_10020014
844 Ga0207661_10161083
845 Ga0207679_10052015
846 Ga0207667_10043494
847 Ga0207667_10180384
848 Ga0207667_11053728
849 Ga0207651_10406057
850 Ga0207712_10158109
851 Ga0207640_11027071
852 Ga0207658_10079161
853 Ga0207703_10078473
854 Ga0207639_10120047
855 Ga0207678_10016063
856 Ga0207702_10020452
857 Ga0207702_10088410
858 Ga0207702_10090053
859 Ga0207641_10093352
860 Ga0207641_10132503
861 Ga0207641_10594386
862 Ga0207641_10620317
863 Ga0207676_10168489
864 Ga0207674_10128353
865 Ga0207674_10203370
866 Ga0207674_10228003
867 Ga0207674_10260062
868 Ga0207683_10069998
869 Ga0207683_11280610
870 Ga0207698_10345267
871 Ga0207428_10025216
872 Ga0265336_10048541
873 Ga0307515_10090850
874 Ga0265338_10001490
875 Ga0265762_1022676
876 Ga0307516_10419673
877 Ga0307405_10002762
878 Ga0307410_10064338
879 Ga0307407_10508096
880 Ga0307412_10172458
881 Ga0307409_100000452
882 Ga0307416_100000505
883 Ga0307416_100133157
884 Ga0307415_100001254
885 Ga0307415_101237993
886 Ga0307507_10029089
887 Ga0307507_10068751
888 Ga0307510_10094315
889 Ga0316214_1007944
890 Ga0373959_0013236
891 Ga0373926_0020750
892 Ga0373926_0032604
893 Ga0373926_0179210
894 Ga0373934_0000053
895 Ga0373934_0021412
896 Ga0373923_0027194
897 Ga0373923_0063243
898 Ga0373923_0143704
899 Ga0373936_0028386
900 Ga0373936_0206417
901 Ga0373945_0022793
902 Ga0373953_0090239
903 Ga0373954_0000809
904 Ga0373956_0000325
905 Ga0373957_0000015
906 Ga0373957_0010422
907 Ga0373943_0004435
908 Ga0373943_0172891
909 Ga0373943_0385357
910 Ga0373946_0069927
911 Ga0373946_0249354
912 Ga0373955_0000027
913 Ga0373955_0012415
914 Ga0373955_0033336
915 Ga0373955_0093467
916 Ga0373924_0000084
917 Ga0373935_0154721
918 Ga0373935_0347073
919 Ga0373927_0014646
920 Ga0373933_0000025
921 Ga0373933_0009754
922 Ga0373947_0194610
923 Ga0373937_0000034
924 Ga0373937_0053710
925 Ga0373937_0199772
926 Ga0373925_0000946
927 Ga0373925_0022657
928 Ga0373925_0317317
929 Ga0373925_0351149
930 Ga0395899_0148635
931 Ga0395900_0034368
932 Ga0395898_0033446
933 Ga0436364_0360509
934 Ga0436364_0378794
935 Ga0436364_1336918
936 Ga0436364_1463345
937 Ga0395901_0162840
938 Ga0436360_0331769
939 Ga0436361_1013087
940 Ga0436362_0272762
941 Ga0466963_0248206
942 Ga0466968_0048688
943 Ga0466970_0080697
944 Ga0466957_0675841
945 Ga0466960_0206185
946 Ga0466959_0055634
947 Ga0466967_0094661
948 Ga0466967_0585395
949 Ga0466967_0667345
950 Ga0495592_0000016
951 Ga0495592_0005572
952 Ga0495629_0205153
953 Ga0495641_0007334
954 Ga0495641_0104898
955 Ga0495641_0108118
956 Ga0495651_0000005
957 Ga0495651_0013770
958 Ga0495651_0021813
959 Ga0495651_0109327
960 Ga0495653_0001819
961 Ga0495653_0049406
962 Ga0495653_0057203
963 Ga0495582_0263024
964 Ga0495662_0017665
965 Ga0495662_0018322
966 Ga0495662_0185400
967 Ga0495662_0196322
968 Ga0495664_0001359
969 Ga0495664_0010940
970 Ga0495664_0056179
971 Ga0495594_0036192
972 Ga0495608_0000057
973 Ga0495608_0084400
974 Ga0495608_0218037
975 Ga0495618_0148422
976 Ga0495618_0148457
977 Ga0495628_0000073
978 Ga0495628_0040416
979 Ga0495628_0068378
980 Ga0495628_0138762
981 Ga0495628_0162640
982 Ga0495630_0062897
983 Ga0495630_0088256
984 Ga0495630_0392619
985 Ga0495630_0529788
986 Ga0495652_0000054
987 Ga0495652_0010609
988 Ga0495652_0018557
989 Ga0495652_0037757
990 Ga0495652_0139361
991 Ga0495652_0175212
992 Ga0495652_0195597
993 Ga0495665_0045996
994 Ga0495640_0008894
995 Ga0495587_0000030
996 Ga0495587_0031277
997 Ga0495587_0053159
998 Ga0495587_0132134
999 Ga0495645_0028521
1000 Ga0495645_0128725
1001 Ga0495667_0000025
1002 Ga0495667_0034199
1003 Ga0495667_0125747
1004 Ga0495667_0152604
1005 Ga0495667_0169178
1006 Ga0495667_0210965
1007 Ga0495667_0214430
1008 Ga0495634_0173659
1009 Ga0495635_0035584
1010 Ga0495635_0125886
1011 Ga0495588_0091753
1012 Ga0495657_0000018
1013 Ga0495657_0023842
1014 Ga0495657_0029368
1015 Ga0495657_0037984
1016 Ga0495657_0063434
1017 Ga0495599_0000054
1018 Ga0495599_0001992
1019 Ga0495599_0056818
1020 Ga0495599_0069194
1021 Ga0495599_0125415
1022 Ga0495599_0185014
1023 Ga0495623_0000582
1024 Ga0495646_0013644
1025 Ga0495646_0061139
1026 Ga0495624_0007142
1027 Ga0495600_0022171
1028 Ga0495600_0090349
1029 Ga0495600_0119277
1030 Ga0495600_0336879
1031 Ga0495604_0000066
1032 Ga0495604_0014421
1033 Ga0495604_0075260
1034 Ga0495674_0058742
1035 Ga0495674_0077903
1036 Ga0495674_0218662
1037 Ga0495674_0341224
1038 Ga0495676_0145894
1039 Ga0495680_0000032
1040 Ga0495680_0019660
1041 Ga0495680_0083599
1042 Ga0495680_0090283
1043 Ga0495680_0270407
1044 Ga0495675_0002070
1045 Ga0495675_0044645
1046 Ga0495675_0078204
1047 Ga0495684_0006951
1048 Ga0495684_0016877
1049 Ga0495684_0029249
1050 Ga0495684_0294190
1051 Ga0495602_0000123
1052 Ga0495602_0046260
1053 Ga0495602_0101420
1054 Ga0496102_0056828
1055 Ga0496104_0000379
1056 Ga0496104_0033643
1057 Ga0496104_0244494
1058 Ga0496104_0975568
1059 Ga0496105_0003646
1060 Ga0496105_0042563
1061 Ga0496105_0318676
1062 Ga0496106_0109881
1063 Ga0496106_0256095
1064 Ga0496108_0010156
1065 Ga0496108_0037134
1066 Ga0496109_0026333
1067 Ga0496109_0048764
1068 Ga0496112_0224441
1069 Ga0496115_0240645
1070 Ga0496119_0244684
1071 Ga0501034_0029357
1072 Ga0501036_0000627
1073 Ga0501037_0006911
1074 Ga0501038_0017684
1075 Ga0501038_0081933
1076 Ga0501039_0022612
1077 Ga0501042_0003012
1078 Ga0501043_0002045
1079 Ga0501047_0009755
1080 Ga0501048_0003714
1081 Ga0501070_0037175
1082 Ga0501073_0057055
1083 Ga0501074_0000296
1084 Ga0501074_0319180
1085 Ga0501077_0132912
1086 Ga0501044_0030529
1087 nmdc:mga05p37_152_c1
1088 nmdc:mga09592_63_c1
1089 nmdc:mga0qj67_39354_c1
1090 nmdc:mga06r32_1726_c1
1091 nmdc:mga06r32_9202_c1
1092 nmdc:mga0rr50_719069_c1
1093 nmdc:mga08x19_213444_c1
1094 nmdc:mga0a205_165978_c1
1095 Ga0495612_0027311
1096 Ga0495612_0059072
1097 Ga0495612_0087596
1098 Ga0495595_0032546
1099 Ga0495595_0218364
1100 Ga0495619_0281806
1101 Ga0495619_0504505
1102 Ga0500594_0056576
1103 Ga0500588_0005290
1104 2515855636
1105 2676475660
1106 2827631388
1107 2891396429
1108 2891557894
1109 2995471561
1110 8053950021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22234

Rv2466c-like

Mycothiol-dependent nitroreductase Rv2466c

42

222

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9807 20 214
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.96 20 214
4wkw-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9501 18 214
4zil-assembly1.cif.gz_B crystal structure of rv2466c and oxidoreductase from mycobacterium tuberculosis in its reduced state 0.9438 19 216
4nxi-assembly1.cif.gz_B rv2466c mediates the activation of tp053 to kill replicating and non-replicating mycobacterium tuberculosis 0.9325 19 214
ID Description Score Start End Superfamily
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9807 20 214 3.40.30.10
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.96 20 214 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8323 21 210 3.40.30.10
3touA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8102 21 56 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8087 21 210 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V3N138-F1-model_v4 Disulfide bond formation protein DsbA 0.9907 20 149
AF-A0A372JL95-F1-model_v4 Disulfide bond formation protein DsbA 0.9866 18 216
AF-A0A1C6MN74-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.986 18 216
AF-A0A6N7GI81-F1-model_v4 Disulfide bond formation protein DsbA 0.9854 18 216
AF-A0A4Q1L040-F1-model_v4 Disulfide bond formation protein DsbA 0.9811 19 216

Map