F463151

General Info

Members Datasets Scaffolds Average Seq Length
555 266 1110 206

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0048841|Ga0501031_0048841_771_1511
Length 246
Sequence MEQRIRFCTTPDGVRLAYATSGKGPPLVRASVARRHPAAKAVTFRAMKPAYHDGMRRLQDRFDSRALADXXXERLSRREFTAEDRAFIESRRLFFLASADAEGQPDCSYKGGDPGFVRVTAADELAFPSYDGNGMFRSLGNVLVNPAVALLFIDFEQPRRLRVNGRASIADDDPLLAAFTGAQVMVRVRAERIFPNCPRYIPRMSIAEVSQYVPRAGCTPPVPKWKTNEAFNEVLPRGDPAKTKKP

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 1.26
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 3.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0048841 3300049568 Bacteria 2757
2 Ga0065715_10003987 3300005293 Bacteria 6653
3 Ga0065707_10102385 3300005295 Bacteria 2809
4 Ga0070658_10804171 3300005327 Bacteria 817
5 Ga0070690_100087630 3300005330 Bacteria 2045
6 Ga0070690_100130640 3300005330 Bacteria 1696
7 Ga0070670_100116738 3300005331 Bacteria 2301
8 Ga0070677_10353802 3300005333 Bacteria 762
9 Ga0068869_100005372 3300005334 Bacteria 8049
10 Ga0068869_100744620 3300005334 Bacteria 839
11 Ga0070666_10005295 3300005335 Bacteria 7904
12 Ga0070666_10265066 3300005335 Bacteria 1219
13 Ga0070680_100047216 3300005336 Bacteria 3505
14 Ga0070680_100156120 3300005336 Bacteria 1917
15 Ga0068868_100005931 3300005338 Bacteria 8619
16 Ga0068868_100027304 3300005338 Bacteria 4355
17 Ga0070689_100804621 3300005340 Bacteria 827
18 Ga0070689_101190369 3300005340 Bacteria 684
19 Ga0070687_100073931 3300005343 Bacteria 1839
20 Ga0070661_100052696 3300005344 Bacteria 2978
21 Ga0070692_10026184 3300005345 Bacteria 2880
22 Ga0070692_10046708 3300005345 Bacteria 2239
23 Ga0070668_100000332 3300005347 Bacteria 31100
24 Ga0070669_100000950 3300005353 Bacteria 21138
25 Ga0070669_100028821 3300005353 Bacteria 3999
26 Ga0070669_100476026 3300005353 Bacteria 1033
27 Ga0070675_100003748 3300005354 Bacteria 11546
28 Ga0070675_100021734 3300005354 Bacteria 5126
29 Ga0070671_100012508 3300005355 Bacteria 6835
30 Ga0070671_100015021 3300005355 Bacteria 6253
31 Ga0070671_100367410 3300005355 Unclassified 1229
32 Ga0070674_100002766 3300005356 Bacteria 9697
33 Ga0070674_100117056 3300005356 Unclassified 1967
34 Ga0070673_100006099 3300005364 Bacteria 7810
35 Ga0070673_100126353 3300005364 Bacteria 2140
36 Ga0070688_100147183 3300005365 Bacteria 1606
37 Ga0070659_100254311 3300005366 Bacteria 1456
38 Ga0070667_100004997 3300005367 Bacteria 11107
39 Ga0070667_100283900 3300005367 Unclassified 1487
40 Ga0070667_100845792 3300005367 Bacteria 851
41 Ga0070703_10002969 3300005406 Bacteria 4848
42 Ga0070709_10755978 3300005434 Bacteria 760
43 Ga0070714_100008968 3300005435 Bacteria 7831
44 Ga0070714_100561293 3300005435 Bacteria 1094
45 Ga0070701_10016655 3300005438 Bacteria 3422
46 Ga0070705_100056657 3300005440 Bacteria 2309
47 Ga0070705_100161743 3300005440 Bacteria 1497
48 Ga0070705_100254304 3300005440 Bacteria 1235
49 Ga0070705_100317857 3300005440 Bacteria 1123
50 Ga0070705_100509810 3300005440 Bacteria 915
51 Ga0070700_100004257 3300005441 Bacteria 7471
52 Ga0070700_100100323 3300005441 Bacteria 1906
53 Ga0070694_100038005 3300005444 Bacteria 3196
54 Ga0070694_100162342 3300005444 Bacteria 1640
55 Ga0070694_100516275 3300005444 Bacteria 953
56 Ga0070708_100046870 3300005445 Bacteria 3816
57 Ga0070708_100687731 3300005445 Bacteria 963
58 Ga0070663_100026998 3300005455 Bacteria 3894
59 Ga0070663_100217322 3300005455 Unclassified 1499
60 Ga0070678_100057728 3300005456 Bacteria 2845
61 Ga0070678_100102152 3300005456 Bacteria 2224
62 Ga0070678_100223481 3300005456 Bacteria 1566
63 Ga0070662_100001231 3300005457 Bacteria 15727
64 Ga0070662_100070608 3300005457 Bacteria 2573
65 Ga0070662_100563012 3300005457 Bacteria 956
66 Ga0070681_10025566 3300005458 Bacteria 5940
67 Ga0070681_10039177 3300005458 Bacteria 4751
68 Ga0070681_10098815 3300005458 Bacteria 2865
69 Ga0068867_100005647 3300005459 Bacteria 8867
70 Ga0068867_100094045 3300005459 Bacteria 2279
71 Ga0068867_100170513 3300005459 Bacteria 1723
72 Ga0068867_100434576 3300005459 Bacteria 1115
73 Ga0068867_100593770 3300005459 Bacteria 965
74 Ga0070685_10324796 3300005466 Bacteria 1044
75 Ga0070706_100543298 3300005467 Bacteria 1081
76 Ga0070707_100254889 3300005468 Bacteria 1707
77 Ga0070707_100453719 3300005468 Bacteria 1243
78 Ga0070698_100005029 3300005471 Bacteria 14484
79 Ga0070698_100365492 3300005471 Bacteria 1375
80 Ga0070698_100849800 3300005471 Bacteria 857
81 Ga0070699_100018485 3300005518 Bacteria 5986
82 Ga0070699_100558360 3300005518 Bacteria 1042
83 Ga0070679_100140166 3300005530 Bacteria 2398
84 Ga0070679_100175238 3300005530 Bacteria 2117
85 Ga0070679_100751922 3300005530 Bacteria 918
86 Ga0070697_100247936 3300005536 Bacteria 1522
87 Ga0068853_100038903 3300005539 Bacteria 4054
88 Ga0068853_100064855 3300005539 Bacteria 3168
89 Ga0068853_100409884 3300005539 Bacteria 1270
90 Ga0068853_100766476 3300005539 Bacteria 923
91 Ga0068853_100888899 3300005539 Unclassified 855
92 Ga0070672_100001876 3300005543 Bacteria 13148
93 Ga0070672_100014880 3300005543 Bacteria 5524
94 Ga0070672_100038870 3300005543 Bacteria 3640
95 Ga0070672_100051107 3300005543 Bacteria 3222
96 Ga0070672_100078033 3300005543 Bacteria 2649
97 Ga0070672_100078980 3300005543 Bacteria 2633
98 Ga0070672_100152168 3300005543 Bacteria 1914
99 Ga0070672_100205319 3300005543 Bacteria 1649
100 Ga0070672_100206118 3300005543 Bacteria 1645
101 Ga0070695_100002311 3300005545 Bacteria 10931
102 Ga0070695_100033929 3300005545 Bacteria 3195
103 Ga0070695_100164841 3300005545 Bacteria 1559
104 Ga0070695_101069200 3300005545 Bacteria 659
105 Ga0070696_100254971 3300005546 Bacteria 1328
106 Ga0070696_100406806 3300005546 Bacteria 1066
107 Ga0070693_100369884 3300005547 Bacteria 986
108 Ga0070693_100435490 3300005547 Bacteria 917
109 Ga0070665_100347379 3300005548 Bacteria 1488
110 Ga0070665_101325077 3300005548 Bacteria 730
111 Ga0070704_100000613 3300005549 Bacteria 17180
112 Ga0070704_100026341 3300005549 Bacteria 3840
113 Ga0070704_100167527 3300005549 Bacteria 1744
114 Ga0068855_100075269 3300005563 Bacteria 3921
115 Ga0068855_100104224 3300005563 Bacteria 3263
116 Ga0070664_100017520 3300005564 Bacteria 5885
117 Ga0070664_100340199 3300005564 Bacteria 1363
118 Ga0070664_100757459 3300005564 Bacteria 907
119 Ga0068857_100002520 3300005577 Bacteria 14995
120 Ga0068857_100045138 3300005577 Bacteria 3909
121 Ga0068857_100065261 3300005577 Bacteria 3236
122 Ga0068857_100088417 3300005577 Bacteria 2772
123 Ga0068857_100154375 3300005577 Bacteria 2081
124 Ga0068854_100314158 3300005578 Bacteria 1271
125 Ga0068856_100011081 3300005614 Bacteria 8756
126 Ga0068852_100031495 3300005616 Bacteria 4377
127 Ga0068852_100200383 3300005616 Bacteria 1889
128 Ga0068859_100026239 3300005617 Bacteria 5842
129 Ga0068859_100026644 3300005617 Bacteria 5797
130 Ga0068859_100033758 3300005617 Bacteria 5137
131 Ga0068859_100182735 3300005617 Bacteria 2180
132 Ga0068859_101337531 3300005617 Bacteria 790
133 Ga0068864_100001428 3300005618 Bacteria 19722
134 Ga0068864_100024342 3300005618 Bacteria 5093
135 Ga0068866_10001483 3300005718 Bacteria 9995
136 Ga0068861_100000426 3300005719 Bacteria 24509
137 Ga0068861_100317967 3300005719 Bacteria 1355
138 Ga0068851_10004147 3300005834 Bacteria 6523
139 Ga0068851_10063663 3300005834 Bacteria 1894
140 Ga0068851_10282498 3300005834 Bacteria 950
141 Ga0068870_10114659 3300005840 Bacteria 1544
142 Ga0068870_10173438 3300005840 Bacteria 1289
143 Ga0068863_100001953 3300005841 Bacteria 20472
144 Ga0068863_100162558 3300005841 Bacteria 2140
145 Ga0068863_100211152 3300005841 Bacteria 1869
146 Ga0068863_100359631 3300005841 Bacteria 1419
147 Ga0068863_100523878 3300005841 Bacteria 1169
148 Ga0068858_100001000 3300005842 Bacteria 29221
149 Ga0068858_100789672 3300005842 Unclassified 926
150 Ga0068860_100001048 3300005843 Bacteria 30480
151 Ga0068860_100062489 3300005843 Bacteria 3538
152 Ga0068860_100074490 3300005843 Bacteria 3228
153 Ga0068860_100153687 3300005843 Bacteria 2217
154 Ga0068860_100217624 3300005843 Bacteria 1854
155 Ga0068860_101716961 3300005843 Bacteria 650
156 Ga0068862_100005035 3300005844 Bacteria 11122
157 Ga0068862_100098828 3300005844 Bacteria 2550
158 Ga0068862_100105584 3300005844 Bacteria 2468
159 Ga0068862_100382222 3300005844 Bacteria 1313
160 Ga0068862_100482282 3300005844 Bacteria 1174
161 Ga0075432_10037521 3300006058 Bacteria 1687
162 Ga0075366_10027341 3300006195 Bacteria 3346
163 Ga0075366_10225245 3300006195 Bacteria 1142
164 Ga0097621_100026552 3300006237 Bacteria 4544
165 Ga0097621_100130435 3300006237 Bacteria 2139
166 Ga0068871_100352182 3300006358 Bacteria 1303
167 Ga0068871_100604616 3300006358 Bacteria 997
168 Ga0075428_100000828 3300006844 Bacteria 32366
169 Ga0075428_100018021 3300006844 Bacteria 7803
170 Ga0075428_100025930 3300006844 Bacteria 6491
171 Ga0075428_100034331 3300006844 Bacteria 5596
172 Ga0075430_100000127 3300006846 Bacteria 48027
173 Ga0075431_100006196 3300006847 Bacteria 11874
174 Ga0075431_100040114 3300006847 Bacteria 4824
175 Ga0075431_100047352 3300006847 Bacteria 4432
176 Ga0075431_100105217 3300006847 Bacteria 2912
177 Ga0075431_100240629 3300006847 Bacteria 1841
178 Ga0075433_10530058 3300006852 Bacteria 1036
179 Ga0075429_100000075 3300006880 Bacteria 49848
180 Ga0075429_100000762 3300006880 Bacteria 25370
181 Ga0075429_100019307 3300006880 Bacteria 5903
182 Ga0075429_100057422 3300006880 Bacteria 3389
183 Ga0068865_100002225 3300006881 Bacteria 11426
184 Ga0068865_100313460 3300006881 Bacteria 1259
185 Ga0097620_100026240 3300006931 Bacteria 5842
186 Ga0097620_100026645 3300006931 Bacteria 5797
187 Ga0097620_100033755 3300006931 Bacteria 5137
188 Ga0097620_100182723 3300006931 Bacteria 2180
189 Ga0097620_101337223 3300006931 Bacteria 790
190 Ga0099794_10002719 3300007265 Bacteria 6591
191 Ga0105240_10323099 3300009093 Bacteria 1758
192 Ga0105240_10590580 3300009093 Bacteria 1224
193 Ga0111539_10000275 3300009094 Bacteria 61397
194 Ga0111539_10066518 3300009094 Bacteria 4257
195 Ga0111539_10366001 3300009094 Bacteria 1678
196 Ga0111539_11030207 3300009094 Unclassified 957
197 Ga0114129_10002034 3300009147 Bacteria 27730
198 Ga0114129_10003702 3300009147 Bacteria 21531
199 Ga0114129_10020604 3300009147 Bacteria 9376
200 Ga0114129_10264738 3300009147 Bacteria 2302
201 Ga0114129_10795816 3300009147 Bacteria 1207
202 Ga0105243_10179075 3300009148 Bacteria 1842
203 Ga0105243_10218957 3300009148 Bacteria 1681
204 Ga0105243_10221556 3300009148 Bacteria 1673
205 Ga0105243_10606175 3300009148 Bacteria 1055
206 Ga0105241_10158053 3300009174 Bacteria 1861
207 Ga0105242_10063926 3300009176 Bacteria 3031
208 Ga0105242_11308421 3300009176 Bacteria 749
209 Ga0105237_10076521 3300009545 Bacteria 3337
210 Ga0105249_10006010 3300009553 Bacteria 10519
211 Ga0105249_10113090 3300009553 Bacteria 2568
212 Ga0105249_10126985 3300009553 Bacteria 2430
213 Ga0105249_10390457 3300009553 Bacteria 1420
214 Ga0105239_10054807 3300010375 Unclassified 4374
215 Ga0105239_10076828 3300010375 Bacteria 3673
216 Ga0105239_10417656 3300010375 Bacteria 1519
217 Ga0105246_10275379 3300011119 Bacteria 1347
218 Ga0157373_10156416 3300013100 Bacteria 1603
219 Ga0157369_10000125 3300013105 Bacteria 110481
220 Ga0157369_10035338 3300013105 Bacteria 5480
221 Ga0157374_10132805 3300013296 Bacteria 2410
222 Ga0157374_10167080 3300013296 Bacteria 2145
223 Ga0157378_10030746 3300013297 Bacteria 4741
224 Ga0157378_10231683 3300013297 Bacteria 1760
225 Ga0157378_11615747 3300013297 Unclassified 694
226 Ga0163162_10063807 3300013306 Bacteria 3728
227 Ga0163162_10105025 3300013306 Bacteria 2919
228 Ga0163162_10583511 3300013306 Bacteria 1245
229 Ga0163162_11196484 3300013306 Bacteria 862
230 Ga0157372_10249913 3300013307 Bacteria 2058
231 Ga0157375_10002055 3300013308 Bacteria 17375
232 Ga0157375_10002541 3300013308 Bacteria 15830
233 Ga0157375_10016354 3300013308 Bacteria 6660
234 Ga0157375_10048095 3300013308 Bacteria 4170
235 Ga0157375_10150354 3300013308 Bacteria 2463
236 Ga0157375_10169790 3300013308 Bacteria 2328
237 Ga0163163_10028522 3300014325 Bacteria 5361
238 Ga0157380_10001799 3300014326 Bacteria 14150
239 Ga0157380_10292158 3300014326 Bacteria 1497
240 Ga0157380_10324419 3300014326 Bacteria 1429
241 Ga0157377_10333822 3300014745 Bacteria 1012
242 Ga0157379_10003578 3300014968 Bacteria 13166
243 Ga0157379_10051980 3300014968 Bacteria 3658
244 Ga0157379_10101656 3300014968 Bacteria 2580
245 Ga0157379_10260300 3300014968 Bacteria 1576
246 Ga0157376_10011472 3300014969 Bacteria 6533
247 Ga0157376_10414817 3300014969 Bacteria 1305
248 Ga0163161_10020557 3300017792 Bacteria 4634
249 Ga0163161_10050183 3300017792 Bacteria 3019
250 Ga0207697_10032724 3300025315 Bacteria 2128
251 Ga0207656_10051403 3300025321 Bacteria 1782
252 Ga0207656_10157806 3300025321 Bacteria 1078
253 Ga0207653_10009738 3300025885 Bacteria 2995
254 Ga0207682_10030239 3300025893 Bacteria 2168
255 Ga0207682_10057582 3300025893 Bacteria 1621
256 Ga0207642_10001183 3300025899 Bacteria 8047
257 Ga0207642_10037267 3300025899 Bacteria 2094
258 Ga0207710_10035686 3300025900 Bacteria 2188
259 Ga0207680_10002952 3300025903 Bacteria 7976
260 Ga0207680_10097218 3300025903 Bacteria 1885
261 Ga0207645_10002094 3300025907 Bacteria 15962
262 Ga0207645_10074227 3300025907 Bacteria 2177
263 Ga0207705_10960190 3300025909 Bacteria 661
264 Ga0207684_10003422 3300025910 Bacteria 15497
265 Ga0207684_10292962 3300025910 Bacteria 1403
266 Ga0207684_11099752 3300025910 Bacteria 662
267 Ga0207654_10084565 3300025911 Bacteria 1918
268 Ga0207654_10112945 3300025911 Bacteria 1693
269 Ga0207707_10044769 3300025912 Bacteria 3857
270 Ga0207707_10058244 3300025912 Bacteria 3362
271 Ga0207707_10145849 3300025912 Bacteria 2069
272 Ga0207695_10071380 3300025913 Bacteria 3547
273 Ga0207695_10336237 3300025913 Bacteria 1398
274 Ga0207671_10002001 3300025914 Bacteria 22453
275 Ga0207660_10029109 3300025917 Bacteria 3785
276 Ga0207660_10148486 3300025917 Bacteria 1799
277 Ga0207662_10011160 3300025918 Bacteria 4974
278 Ga0207662_10132734 3300025918 Bacteria 1571
279 Ga0207657_10384418 3300025919 Bacteria 1105
280 Ga0207649_10084164 3300025920 Bacteria 2067
281 Ga0207652_10028509 3300025921 Bacteria 4659
282 Ga0207652_10300546 3300025921 Bacteria 1449
283 Ga0207646_10079823 3300025922 Bacteria 2925
284 Ga0207681_10000308 3300025923 Bacteria 35918
285 Ga0207681_10140066 3300025923 Bacteria 1800
286 Ga0207681_10147949 3300025923 Bacteria 1757
287 Ga0207681_10352707 3300025923 Bacteria 1178
288 Ga0207681_10508941 3300025923 Bacteria 987
289 Ga0207694_10039863 3300025924 Bacteria 3615
290 Ga0207694_10179720 3300025924 Bacteria 1715
291 Ga0207650_10001008 3300025925 Bacteria 21196
292 Ga0207650_10002178 3300025925 Bacteria 13682
293 Ga0207650_10101075 3300025925 Bacteria 2219
294 Ga0207659_10012776 3300025926 Bacteria 5360
295 Ga0207687_10255921 3300025927 Bacteria 1394
296 Ga0207664_10589841 3300025929 Bacteria 998
297 Ga0207644_10000233 3300025931 Bacteria 38178
298 Ga0207644_10025887 3300025931 Bacteria 4037
299 Ga0207644_10053943 3300025931 Bacteria 2894
300 Ga0207644_10173294 3300025931 Unclassified 1686
301 Ga0207644_10241897 3300025931 Bacteria 1437
302 Ga0207690_10351389 3300025932 Bacteria 1166
303 Ga0207706_10004526 3300025933 Bacteria 13057
304 Ga0207706_10008475 3300025933 Bacteria 9481
305 Ga0207706_10224056 3300025933 Bacteria 1646
306 Ga0207706_10279851 3300025933 Bacteria 1455
307 Ga0207686_10051722 3300025934 Bacteria 2560
308 Ga0207686_10111659 3300025934 Bacteria 1845
309 Ga0207709_10004196 3300025935 Bacteria 8361
310 Ga0207709_10010801 3300025935 Bacteria 5028
311 Ga0207709_10033078 3300025935 Bacteria 3033
312 Ga0207669_10000725 3300025937 Bacteria 14268
313 Ga0207669_10138163 3300025937 Unclassified 1687
314 Ga0207704_10001008 3300025938 Bacteria 12492
315 Ga0207704_10002634 3300025938 Bacteria 8100
316 Ga0207704_10148057 3300025938 Bacteria 1652
317 Ga0207704_10227583 3300025938 Bacteria 1384
318 Ga0207704_10860757 3300025938 Bacteria 760
319 Ga0207665_10017636 3300025939 Bacteria 4691
320 Ga0207691_10002582 3300025940 Bacteria 17694
321 Ga0207691_10009767 3300025940 Bacteria 9211
322 Ga0207691_10075309 3300025940 Bacteria 3043
323 Ga0207691_10085414 3300025940 Bacteria 2832
324 Ga0207691_10119482 3300025940 Bacteria 2337
325 Ga0207691_10211435 3300025940 Bacteria 1684
326 Ga0207691_10444763 3300025940 Unclassified 1103
327 Ga0207711_10024925 3300025941 Bacteria 5017
328 Ga0207711_10028704 3300025941 Bacteria 4685
329 Ga0207689_10002808 3300025942 Bacteria 16090
330 Ga0207689_10005397 3300025942 Bacteria 11441
331 Ga0207689_10135934 3300025942 Unclassified 2024
332 Ga0207689_10317192 3300025942 Bacteria 1293
333 Ga0207679_10110804 3300025945 Bacteria 2166
334 Ga0207679_10305939 3300025945 Bacteria 1372
335 Ga0207667_10073768 3300025949 Bacteria 3545
336 Ga0207667_10115988 3300025949 Bacteria 2760
337 Ga0207651_10074361 3300025960 Bacteria 2419
338 Ga0207651_10147543 3300025960 Bacteria 1826
339 Ga0207651_10291583 3300025960 Bacteria 1353
340 Ga0207651_10871938 3300025960 Bacteria 801
341 Ga0207712_10012095 3300025961 Bacteria 5511
342 Ga0207712_10052892 3300025961 Bacteria 2846
343 Ga0207712_10328831 3300025961 Bacteria 1264
344 Ga0207668_10071966 3300025972 Bacteria 2472
345 Ga0207668_10219076 3300025972 Unclassified 1527
346 Ga0207640_10060522 3300025981 Bacteria 2503
347 Ga0207640_10414024 3300025981 Bacteria 1101
348 Ga0207658_10001166 3300025986 Bacteria 20974
349 Ga0207658_10111477 3300025986 Bacteria 2164
350 Ga0207658_10186754 3300025986 Bacteria 1720
351 Ga0207658_10331692 3300025986 Unclassified 1320
352 Ga0207658_10364220 3300025986 Bacteria 1262
353 Ga0207677_11049029 3300026023 Bacteria 741
354 Ga0207703_10000414 3300026035 Bacteria 45564
355 Ga0207639_10178761 3300026041 Bacteria 1803
356 Ga0207639_10801093 3300026041 Unclassified 878
357 Ga0207678_10002005 3300026067 Bacteria 18533
358 Ga0207708_10019250 3300026075 Bacteria 5143
359 Ga0207702_10153301 3300026078 Bacteria 2098
360 Ga0207641_10000615 3300026088 Bacteria 38942
361 Ga0207641_10333183 3300026088 Bacteria 1442
362 Ga0207648_10001283 3300026089 Bacteria 28030
363 Ga0207648_10001858 3300026089 Bacteria 23063
364 Ga0207648_10048979 3300026089 Bacteria 3699
365 Ga0207648_10100968 3300026089 Bacteria 2528
366 Ga0207648_10241859 3300026089 Bacteria 1607
367 Ga0207648_10421466 3300026089 Bacteria 1212
368 Ga0207648_10780704 3300026089 Bacteria 888
369 Ga0207676_10016903 3300026095 Bacteria 5282
370 Ga0207676_10025075 3300026095 Unclassified 4422
371 Ga0207676_10028948 3300026095 Bacteria 4143
372 Ga0207676_10347071 3300026095 Bacteria 1371
373 Ga0207674_10005690 3300026116 Bacteria 14779
374 Ga0207674_10051704 3300026116 Bacteria 4193
375 Ga0207674_10182374 3300026116 Bacteria 2050
376 Ga0207674_10321593 3300026116 Bacteria 1496
377 Ga0207674_10719175 3300026116 Bacteria 964
378 Ga0207675_100002985 3300026118 Bacteria 16625
379 Ga0207675_100078237 3300026118 Bacteria 3099
380 Ga0207675_100138013 3300026118 Bacteria 2315
381 Ga0207683_10039813 3300026121 Bacteria 4100
382 Ga0207683_10066045 3300026121 Bacteria 3190
383 Ga0207683_10169405 3300026121 Bacteria 1977
384 Ga0207698_10004887 3300026142 Bacteria 8219
385 Ga0207698_10022022 3300026142 Bacteria 4420
386 Ga0207698_10080048 3300026142 Bacteria 2630
387 Ga0210000_1001718 3300027462 Bacteria 3094
388 Ga0209999_1000757 3300027543 Bacteria 5274
389 Ga0209588_1021796 3300027671 Bacteria 2014
390 Ga0207428_10004772 3300027907 Bacteria 12803
391 Ga0268265_10002595 3300028380 Bacteria 13467
392 Ga0268265_10026127 3300028380 Bacteria 4151
393 Ga0268265_10301381 3300028380 Bacteria 1443
394 Ga0268265_10519404 3300028380 Unclassified 1125
395 Ga0268265_10642572 3300028380 Bacteria 1019
396 Ga0268264_10000780 3300028381 Bacteria 35025
397 Ga0268264_10019710 3300028381 Bacteria 5510
398 Ga0268264_10062513 3300028381 Bacteria 3127
399 Ga0268264_10062845 3300028381 Bacteria 3119
400 Ga0268264_10102221 3300028381 Bacteria 2494
401 Ga0268264_10580374 3300028381 Bacteria 1103
402 Ga0307408_100040891 3300031548 Bacteria 3285
403 Ga0307405_10090200 3300031731 Bacteria 2027
404 Ga0307413_10182145 3300031824 Bacteria 1499
405 Ga0307410_10149993 3300031852 Bacteria 1735
406 Ga0307407_10093160 3300031903 Bacteria 1852
407 Ga0307412_10439178 3300031911 Bacteria 1072
408 Ga0307409_100103265 3300031995 Bacteria 2370
409 Ga0307416_100001193 3300032002 Bacteria 13976
410 Ga0307416_100171118 3300032002 Bacteria 2022
411 Ga0307416_100388789 3300032002 Bacteria 1428
412 Ga0307414_11028472 3300032004 Bacteria 759
413 Ga0307411_10011045 3300032005 Bacteria 4851
414 Ga0307415_100001120 3300032126 Bacteria 12518
415 Ga0373949_0044485 3300035090 Bacteria 1102
416 Ga0373941_0160003 3300035115 Bacteria 832
417 Ga0373946_0314183 3300035171 Bacteria 777
418 Ga0373955_0021268 3300035172 Bacteria 3273
419 Ga0373955_0127423 3300035172 Bacteria 1484
420 Ga0373942_0030852 3300035207 Bacteria 1414
421 Ga0373924_0024407 3300035410 Bacteria 2382
422 Ga0373931_0001530 3300035691 Bacteria 9968
423 Ga0373935_0150814 3300035692 Bacteria 1577
424 Ga0373927_0078297 3300035695 Bacteria 2141
425 Ga0373927_0095432 3300035695 Bacteria 1933
426 Ga0373947_0064888 3300035725 Bacteria 2227
427 Ga0373947_0083668 3300035725 Bacteria 1979
428 Ga0373937_0038192 3300036401 Bacteria 4376
429 Ga0373937_0097813 3300036401 Bacteria 2722
430 Ga0373937_0413168 3300036401 Bacteria 1280
431 Ga0373925_0000845 3300037068 Bacteria 28162
432 Ga0451853_1783048 3300041512 Bacteria 1956
433 Ga0439441_011407 3300042001 Bacteria 1507
434 Ga0439464_0184906 3300042439 Bacteria 661
435 Ga0451576_0258777 3300045051 Bacteria 1819
436 Ga0495603_0159038 3300046455 Bacteria 1311
437 Ga0495603_0166158 3300046455 Bacteria 1279
438 Ga0495629_0159074 3300046459 Bacteria 1569
439 Ga0495641_0126388 3300046461 Bacteria 1141
440 Ga0495651_0399200 3300046462 Bacteria 898
441 Ga0495580_0156721 3300046472 Bacteria 1577
442 Ga0495580_0315555 3300046472 Bacteria 1063
443 Ga0495585_0372991 3300046492 Bacteria 690
444 Ga0495620_0171489 3300046515 Bacteria 841
445 Ga0495628_0153973 3300046516 Bacteria 1750
446 Ga0495663_0063229 3300046525 Bacteria 1167
447 Ga0495586_0127151 3300046535 Bacteria 1426
448 Ga0495586_0130446 3300046535 Bacteria 1407
449 Ga0495621_0100855 3300046539 Bacteria 1098
450 Ga0495645_0032857 3300046543 Bacteria 3785
451 Ga0495656_0056435 3300046615 Bacteria 1697
452 Ga0495635_0057299 3300046663 Bacteria 2681
453 Ga0495657_0445751 3300046675 Bacteria 758
454 Ga0495599_0046159 3300046678 Bacteria 2732
455 Ga0495647_0064064 3300046681 Bacteria 1457
456 Ga0495658_0012026 3300046683 Bacteria 4371
457 Ga0495658_0017020 3300046683 Bacteria 3748
458 Ga0495669_0005865 3300046684 Bacteria 5120
459 Ga0495669_0353461 3300046684 Bacteria 710
460 Ga0495674_0134010 3300047319 Bacteria 2086
461 Ga0495680_0053172 3300047322 Bacteria 3154
462 Ga0495684_0026078 3300047471 Bacteria 4493
463 Ga0496102_0008252 3300048905 Bacteria 8920
464 Ga0496103_0092684 3300048906 Bacteria 1907
465 Ga0496106_0283417 3300048909 Bacteria 1327
466 Ga0496108_0123745 3300048911 Bacteria 2219
467 Ga0496109_0229061 3300048912 Bacteria 1748
468 Ga0496109_0233687 3300048912 Bacteria 1730
469 Ga0496110_0092527 3300048913 Bacteria 2706
470 Ga0501032_0065492 3300049569 Bacteria 2430
471 Ga0501033_0004048 3300049570 Bacteria 11838
472 Ga0501034_0000406 3300049571 Bacteria 72755
473 Ga0501034_0002174 3300049571 Bacteria 24290
474 Ga0501036_0011077 3300049572 Bacteria 7457
475 Ga0501037_0023042 3300049573 Bacteria 4605
476 Ga0501038_0000668 3300049574 Bacteria 30539
477 Ga0501039_0007014 3300049575 Bacteria 8578
478 Ga0501040_0002705 3300049576 Bacteria 11427
479 Ga0501040_0037480 3300049576 Bacteria 3294
480 Ga0501040_0225807 3300049576 Bacteria 1333
481 Ga0501041_0000098 3300049577 Bacteria 35755
482 Ga0501041_0081699 3300049577 Bacteria 1990
483 Ga0501042_0000242 3300049578 Bacteria 26466
484 Ga0501042_0112725 3300049578 Bacteria 1958
485 Ga0501042_0178129 3300049578 Bacteria 1533
486 Ga0501043_0101839 3300049579 Bacteria 2257
487 Ga0501046_0000144 3300049580 Bacteria 74352
488 Ga0501047_0157730 3300049581 Bacteria 2142
489 Ga0501048_0008341 3300049582 Bacteria 7835
490 Ga0501067_0124185 3300049583 Bacteria 1437
491 Ga0501068_0005592 3300049584 Bacteria 6883
492 Ga0501068_0018055 3300049584 Bacteria 4085
493 Ga0501069_0186441 3300049585 Bacteria 1200
494 Ga0501069_0355022 3300049585 Bacteria 864
495 Ga0501070_0058828 3300049586 Bacteria 3186
496 Ga0501070_0074020 3300049586 Bacteria 2819
497 Ga0501071_0006755 3300049587 Bacteria 7470
498 Ga0501071_0112682 3300049587 Bacteria 2011
499 Ga0501072_0001347 3300049588 Bacteria 18406
500 Ga0501072_0001685 3300049588 Bacteria 16461
501 Ga0501072_0054971 3300049588 Bacteria 3138
502 Ga0501073_0032995 3300049589 Bacteria 3689
503 Ga0501074_0063744 3300049590 Bacteria 2654
504 Ga0501074_0433471 3300049590 Bacteria 932
505 Ga0501074_0512083 3300049590 Bacteria 850
506 Ga0501075_0000101 3300049591 Bacteria 39774
507 Ga0501075_0017493 3300049591 Bacteria 5180
508 Ga0501075_0018641 3300049591 Bacteria 5025
509 Ga0501076_0035324 3300049592 Bacteria 3911
510 Ga0501076_0160853 3300049592 Bacteria 1829
511 Ga0501076_0170270 3300049592 Bacteria 1775
512 Ga0501076_0174084 3300049592 Bacteria 1754
513 Ga0501077_0000994 3300049593 Bacteria 17080
514 Ga0501077_0020557 3300049593 Bacteria 4179
515 Ga0501077_0094343 3300049593 Bacteria 1897
516 Ga0501079_0000459 3300049741 Bacteria 26782
517 Ga0501079_0011265 3300049741 Bacteria 6822
518 Ga0501080_0042174 3300049742 Bacteria 4250
519 Ga0501080_0044844 3300049742 Bacteria 4115
520 Ga0501080_0086996 3300049742 Bacteria 2904
521 Ga0501080_0628343 3300049742 Bacteria 952
522 Ga0501081_0000680 3300049743 Bacteria 19572
523 Ga0501081_0002406 3300049743 Bacteria 11800
524 Ga0501083_0197124 3300049744 Bacteria 1314
525 Ga0501035_0080030 3300049822 Bacteria 2885
526 Ga0501035_0144481 3300049822 Bacteria 2067
527 Ga0501044_0071240 3300049823 Bacteria 3535
528 Ga0501045_0002526 3300049824 Bacteria 12452
529 Ga0501045_0092703 3300049824 Bacteria 2234
530 nmdc:mga05p37_29333_c1 3300050507 Bacteria 6714
531 nmdc:mga05p37_510_c1 3300050507 Bacteria 42907
532 nmdc:mga05p37_931_c1 3300050507 Bacteria 32975
533 nmdc:mga09592_1086_c1 3300050508 Bacteria 21589
534 nmdc:mga09592_49676_c1 3300050508 Bacteria 3537
535 nmdc:mga09592_75_c1 3300050508 Bacteria 56459
536 nmdc:mga0qj67_368_c1 3300050509 Bacteria 30906
537 nmdc:mga06r32_136009_c1 3300050510 Bacteria 2432
538 nmdc:mga06r32_148618_c1 3300050510 Bacteria 2321
539 nmdc:mga06r32_15504_c1 3300050510 Bacteria 6920
540 nmdc:mga06r32_1675_c1 3300050510 Bacteria 20002
541 nmdc:mga06r32_564910_c1 3300050510 Bacteria 1111
542 nmdc:mga08y16_124755_c1 3300050511 Bacteria 2679
543 nmdc:mga08y16_183697_c1 3300050511 Bacteria 2170
544 nmdc:mga08y16_56348_c1 3300050511 Bacteria 4108
545 nmdc:mga08x19_22243_c1 3300050514 Bacteria 3925
546 nmdc:mga0a205_538952_c1 3300050515 Bacteria 1023
547 Ga0495601_0042566 3300053077 Bacteria 2850
548 Ga0495601_0141193 3300053077 Bacteria 1571
549 Ga0495612_0027102 3300053078 Bacteria 2304
550 Ga0495595_0071075 3300053084 Bacteria 1645
551 Ga0495619_0075349 3300053085 Bacteria 2264
552 Ga0501084_0053651 3300054114 Bacteria 3372
553 Ga0501082_0024634 3300060353 Bacteria 5187
554 Ga0501082_0389290 3300060353 Bacteria 1216
555 Ga0530510_0000221 3300061734 Bacteria 35515
556 Ga0501031_0048841
557 Ga0065715_10003987
558 Ga0065707_10102385
559 Ga0070658_10804171
560 Ga0070690_100087630
561 Ga0070690_100130640
562 Ga0070670_100116738
563 Ga0070677_10353802
564 Ga0068869_100005372
565 Ga0068869_100744620
566 Ga0070666_10005295
567 Ga0070666_10265066
568 Ga0070680_100047216
569 Ga0070680_100156120
570 Ga0068868_100005931
571 Ga0068868_100027304
572 Ga0070689_100804621
573 Ga0070689_101190369
574 Ga0070687_100073931
575 Ga0070661_100052696
576 Ga0070692_10026184
577 Ga0070692_10046708
578 Ga0070668_100000332
579 Ga0070669_100000950
580 Ga0070669_100028821
581 Ga0070669_100476026
582 Ga0070675_100003748
583 Ga0070675_100021734
584 Ga0070671_100012508
585 Ga0070671_100015021
586 Ga0070671_100367410
587 Ga0070674_100002766
588 Ga0070674_100117056
589 Ga0070673_100006099
590 Ga0070673_100126353
591 Ga0070688_100147183
592 Ga0070659_100254311
593 Ga0070667_100004997
594 Ga0070667_100283900
595 Ga0070667_100845792
596 Ga0070703_10002969
597 Ga0070709_10755978
598 Ga0070714_100008968
599 Ga0070714_100561293
600 Ga0070701_10016655
601 Ga0070705_100056657
602 Ga0070705_100161743
603 Ga0070705_100254304
604 Ga0070705_100317857
605 Ga0070705_100509810
606 Ga0070700_100004257
607 Ga0070700_100100323
608 Ga0070694_100038005
609 Ga0070694_100162342
610 Ga0070694_100516275
611 Ga0070708_100046870
612 Ga0070708_100687731
613 Ga0070663_100026998
614 Ga0070663_100217322
615 Ga0070678_100057728
616 Ga0070678_100102152
617 Ga0070678_100223481
618 Ga0070662_100001231
619 Ga0070662_100070608
620 Ga0070662_100563012
621 Ga0070681_10025566
622 Ga0070681_10039177
623 Ga0070681_10098815
624 Ga0068867_100005647
625 Ga0068867_100094045
626 Ga0068867_100170513
627 Ga0068867_100434576
628 Ga0068867_100593770
629 Ga0070685_10324796
630 Ga0070706_100543298
631 Ga0070707_100254889
632 Ga0070707_100453719
633 Ga0070698_100005029
634 Ga0070698_100365492
635 Ga0070698_100849800
636 Ga0070699_100018485
637 Ga0070699_100558360
638 Ga0070679_100140166
639 Ga0070679_100175238
640 Ga0070679_100751922
641 Ga0070697_100247936
642 Ga0068853_100038903
643 Ga0068853_100064855
644 Ga0068853_100409884
645 Ga0068853_100766476
646 Ga0068853_100888899
647 Ga0070672_100001876
648 Ga0070672_100014880
649 Ga0070672_100038870
650 Ga0070672_100051107
651 Ga0070672_100078033
652 Ga0070672_100078980
653 Ga0070672_100152168
654 Ga0070672_100205319
655 Ga0070672_100206118
656 Ga0070695_100002311
657 Ga0070695_100033929
658 Ga0070695_100164841
659 Ga0070695_101069200
660 Ga0070696_100254971
661 Ga0070696_100406806
662 Ga0070693_100369884
663 Ga0070693_100435490
664 Ga0070665_100347379
665 Ga0070665_101325077
666 Ga0070704_100000613
667 Ga0070704_100026341
668 Ga0070704_100167527
669 Ga0068855_100075269
670 Ga0068855_100104224
671 Ga0070664_100017520
672 Ga0070664_100340199
673 Ga0070664_100757459
674 Ga0068857_100002520
675 Ga0068857_100045138
676 Ga0068857_100065261
677 Ga0068857_100088417
678 Ga0068857_100154375
679 Ga0068854_100314158
680 Ga0068856_100011081
681 Ga0068852_100031495
682 Ga0068852_100200383
683 Ga0068859_100026239
684 Ga0068859_100026644
685 Ga0068859_100033758
686 Ga0068859_100182735
687 Ga0068859_101337531
688 Ga0068864_100001428
689 Ga0068864_100024342
690 Ga0068866_10001483
691 Ga0068861_100000426
692 Ga0068861_100317967
693 Ga0068851_10004147
694 Ga0068851_10063663
695 Ga0068851_10282498
696 Ga0068870_10114659
697 Ga0068870_10173438
698 Ga0068863_100001953
699 Ga0068863_100162558
700 Ga0068863_100211152
701 Ga0068863_100359631
702 Ga0068863_100523878
703 Ga0068858_100001000
704 Ga0068858_100789672
705 Ga0068860_100001048
706 Ga0068860_100062489
707 Ga0068860_100074490
708 Ga0068860_100153687
709 Ga0068860_100217624
710 Ga0068860_101716961
711 Ga0068862_100005035
712 Ga0068862_100098828
713 Ga0068862_100105584
714 Ga0068862_100382222
715 Ga0068862_100482282
716 Ga0075432_10037521
717 Ga0075366_10027341
718 Ga0075366_10225245
719 Ga0097621_100026552
720 Ga0097621_100130435
721 Ga0068871_100352182
722 Ga0068871_100604616
723 Ga0075428_100000828
724 Ga0075428_100018021
725 Ga0075428_100025930
726 Ga0075428_100034331
727 Ga0075430_100000127
728 Ga0075431_100006196
729 Ga0075431_100040114
730 Ga0075431_100047352
731 Ga0075431_100105217
732 Ga0075431_100240629
733 Ga0075433_10530058
734 Ga0075429_100000075
735 Ga0075429_100000762
736 Ga0075429_100019307
737 Ga0075429_100057422
738 Ga0068865_100002225
739 Ga0068865_100313460
740 Ga0097620_100026240
741 Ga0097620_100026645
742 Ga0097620_100033755
743 Ga0097620_100182723
744 Ga0097620_101337223
745 Ga0099794_10002719
746 Ga0105240_10323099
747 Ga0105240_10590580
748 Ga0111539_10000275
749 Ga0111539_10066518
750 Ga0111539_10366001
751 Ga0111539_11030207
752 Ga0114129_10002034
753 Ga0114129_10003702
754 Ga0114129_10020604
755 Ga0114129_10264738
756 Ga0114129_10795816
757 Ga0105243_10179075
758 Ga0105243_10218957
759 Ga0105243_10221556
760 Ga0105243_10606175
761 Ga0105241_10158053
762 Ga0105242_10063926
763 Ga0105242_11308421
764 Ga0105237_10076521
765 Ga0105249_10006010
766 Ga0105249_10113090
767 Ga0105249_10126985
768 Ga0105249_10390457
769 Ga0105239_10054807
770 Ga0105239_10076828
771 Ga0105239_10417656
772 Ga0105246_10275379
773 Ga0157373_10156416
774 Ga0157369_10000125
775 Ga0157369_10035338
776 Ga0157374_10132805
777 Ga0157374_10167080
778 Ga0157378_10030746
779 Ga0157378_10231683
780 Ga0157378_11615747
781 Ga0163162_10063807
782 Ga0163162_10105025
783 Ga0163162_10583511
784 Ga0163162_11196484
785 Ga0157372_10249913
786 Ga0157375_10002055
787 Ga0157375_10002541
788 Ga0157375_10016354
789 Ga0157375_10048095
790 Ga0157375_10150354
791 Ga0157375_10169790
792 Ga0163163_10028522
793 Ga0157380_10001799
794 Ga0157380_10292158
795 Ga0157380_10324419
796 Ga0157377_10333822
797 Ga0157379_10003578
798 Ga0157379_10051980
799 Ga0157379_10101656
800 Ga0157379_10260300
801 Ga0157376_10011472
802 Ga0157376_10414817
803 Ga0163161_10020557
804 Ga0163161_10050183
805 Ga0207697_10032724
806 Ga0207656_10051403
807 Ga0207656_10157806
808 Ga0207653_10009738
809 Ga0207682_10030239
810 Ga0207682_10057582
811 Ga0207642_10001183
812 Ga0207642_10037267
813 Ga0207710_10035686
814 Ga0207680_10002952
815 Ga0207680_10097218
816 Ga0207645_10002094
817 Ga0207645_10074227
818 Ga0207705_10960190
819 Ga0207684_10003422
820 Ga0207684_10292962
821 Ga0207684_11099752
822 Ga0207654_10084565
823 Ga0207654_10112945
824 Ga0207707_10044769
825 Ga0207707_10058244
826 Ga0207707_10145849
827 Ga0207695_10071380
828 Ga0207695_10336237
829 Ga0207671_10002001
830 Ga0207660_10029109
831 Ga0207660_10148486
832 Ga0207662_10011160
833 Ga0207662_10132734
834 Ga0207657_10384418
835 Ga0207649_10084164
836 Ga0207652_10028509
837 Ga0207652_10300546
838 Ga0207646_10079823
839 Ga0207681_10000308
840 Ga0207681_10140066
841 Ga0207681_10147949
842 Ga0207681_10352707
843 Ga0207681_10508941
844 Ga0207694_10039863
845 Ga0207694_10179720
846 Ga0207650_10001008
847 Ga0207650_10002178
848 Ga0207650_10101075
849 Ga0207659_10012776
850 Ga0207687_10255921
851 Ga0207664_10589841
852 Ga0207644_10000233
853 Ga0207644_10025887
854 Ga0207644_10053943
855 Ga0207644_10173294
856 Ga0207644_10241897
857 Ga0207690_10351389
858 Ga0207706_10004526
859 Ga0207706_10008475
860 Ga0207706_10224056
861 Ga0207706_10279851
862 Ga0207686_10051722
863 Ga0207686_10111659
864 Ga0207709_10004196
865 Ga0207709_10010801
866 Ga0207709_10033078
867 Ga0207669_10000725
868 Ga0207669_10138163
869 Ga0207704_10001008
870 Ga0207704_10002634
871 Ga0207704_10148057
872 Ga0207704_10227583
873 Ga0207704_10860757
874 Ga0207665_10017636
875 Ga0207691_10002582
876 Ga0207691_10009767
877 Ga0207691_10075309
878 Ga0207691_10085414
879 Ga0207691_10119482
880 Ga0207691_10211435
881 Ga0207691_10444763
882 Ga0207711_10024925
883 Ga0207711_10028704
884 Ga0207689_10002808
885 Ga0207689_10005397
886 Ga0207689_10135934
887 Ga0207689_10317192
888 Ga0207679_10110804
889 Ga0207679_10305939
890 Ga0207667_10073768
891 Ga0207667_10115988
892 Ga0207651_10074361
893 Ga0207651_10147543
894 Ga0207651_10291583
895 Ga0207651_10871938
896 Ga0207712_10012095
897 Ga0207712_10052892
898 Ga0207712_10328831
899 Ga0207668_10071966
900 Ga0207668_10219076
901 Ga0207640_10060522
902 Ga0207640_10414024
903 Ga0207658_10001166
904 Ga0207658_10111477
905 Ga0207658_10186754
906 Ga0207658_10331692
907 Ga0207658_10364220
908 Ga0207677_11049029
909 Ga0207703_10000414
910 Ga0207639_10178761
911 Ga0207639_10801093
912 Ga0207678_10002005
913 Ga0207708_10019250
914 Ga0207702_10153301
915 Ga0207641_10000615
916 Ga0207641_10333183
917 Ga0207648_10001283
918 Ga0207648_10001858
919 Ga0207648_10048979
920 Ga0207648_10100968
921 Ga0207648_10241859
922 Ga0207648_10421466
923 Ga0207648_10780704
924 Ga0207676_10016903
925 Ga0207676_10025075
926 Ga0207676_10028948
927 Ga0207676_10347071
928 Ga0207674_10005690
929 Ga0207674_10051704
930 Ga0207674_10182374
931 Ga0207674_10321593
932 Ga0207674_10719175
933 Ga0207675_100002985
934 Ga0207675_100078237
935 Ga0207675_100138013
936 Ga0207683_10039813
937 Ga0207683_10066045
938 Ga0207683_10169405
939 Ga0207698_10004887
940 Ga0207698_10022022
941 Ga0207698_10080048
942 Ga0210000_1001718
943 Ga0209999_1000757
944 Ga0209588_1021796
945 Ga0207428_10004772
946 Ga0268265_10002595
947 Ga0268265_10026127
948 Ga0268265_10301381
949 Ga0268265_10519404
950 Ga0268265_10642572
951 Ga0268264_10000780
952 Ga0268264_10019710
953 Ga0268264_10062513
954 Ga0268264_10062845
955 Ga0268264_10102221
956 Ga0268264_10580374
957 Ga0307408_100040891
958 Ga0307405_10090200
959 Ga0307413_10182145
960 Ga0307410_10149993
961 Ga0307407_10093160
962 Ga0307412_10439178
963 Ga0307409_100103265
964 Ga0307416_100001193
965 Ga0307416_100171118
966 Ga0307416_100388789
967 Ga0307414_11028472
968 Ga0307411_10011045
969 Ga0307415_100001120
970 Ga0373949_0044485
971 Ga0373941_0160003
972 Ga0373946_0314183
973 Ga0373955_0021268
974 Ga0373955_0127423
975 Ga0373942_0030852
976 Ga0373924_0024407
977 Ga0373931_0001530
978 Ga0373935_0150814
979 Ga0373927_0078297
980 Ga0373927_0095432
981 Ga0373947_0064888
982 Ga0373947_0083668
983 Ga0373937_0038192
984 Ga0373937_0097813
985 Ga0373937_0413168
986 Ga0373925_0000845
987 Ga0451853_1783048
988 Ga0439441_011407
989 Ga0439464_0184906
990 Ga0451576_0258777
991 Ga0495603_0159038
992 Ga0495603_0166158
993 Ga0495629_0159074
994 Ga0495641_0126388
995 Ga0495651_0399200
996 Ga0495580_0156721
997 Ga0495580_0315555
998 Ga0495585_0372991
999 Ga0495620_0171489
1000 Ga0495628_0153973
1001 Ga0495663_0063229
1002 Ga0495586_0127151
1003 Ga0495586_0130446
1004 Ga0495621_0100855
1005 Ga0495645_0032857
1006 Ga0495656_0056435
1007 Ga0495635_0057299
1008 Ga0495657_0445751
1009 Ga0495599_0046159
1010 Ga0495647_0064064
1011 Ga0495658_0012026
1012 Ga0495658_0017020
1013 Ga0495669_0005865
1014 Ga0495669_0353461
1015 Ga0495674_0134010
1016 Ga0495680_0053172
1017 Ga0495684_0026078
1018 Ga0496102_0008252
1019 Ga0496103_0092684
1020 Ga0496106_0283417
1021 Ga0496108_0123745
1022 Ga0496109_0229061
1023 Ga0496109_0233687
1024 Ga0496110_0092527
1025 Ga0501032_0065492
1026 Ga0501033_0004048
1027 Ga0501034_0000406
1028 Ga0501034_0002174
1029 Ga0501036_0011077
1030 Ga0501037_0023042
1031 Ga0501038_0000668
1032 Ga0501039_0007014
1033 Ga0501040_0002705
1034 Ga0501040_0037480
1035 Ga0501040_0225807
1036 Ga0501041_0000098
1037 Ga0501041_0081699
1038 Ga0501042_0000242
1039 Ga0501042_0112725
1040 Ga0501042_0178129
1041 Ga0501043_0101839
1042 Ga0501046_0000144
1043 Ga0501047_0157730
1044 Ga0501048_0008341
1045 Ga0501067_0124185
1046 Ga0501068_0005592
1047 Ga0501068_0018055
1048 Ga0501069_0186441
1049 Ga0501069_0355022
1050 Ga0501070_0058828
1051 Ga0501070_0074020
1052 Ga0501071_0006755
1053 Ga0501071_0112682
1054 Ga0501072_0001347
1055 Ga0501072_0001685
1056 Ga0501072_0054971
1057 Ga0501073_0032995
1058 Ga0501074_0063744
1059 Ga0501074_0433471
1060 Ga0501074_0512083
1061 Ga0501075_0000101
1062 Ga0501075_0017493
1063 Ga0501075_0018641
1064 Ga0501076_0035324
1065 Ga0501076_0160853
1066 Ga0501076_0170270
1067 Ga0501076_0174084
1068 Ga0501077_0000994
1069 Ga0501077_0020557
1070 Ga0501077_0094343
1071 Ga0501079_0000459
1072 Ga0501079_0011265
1073 Ga0501080_0042174
1074 Ga0501080_0044844
1075 Ga0501080_0086996
1076 Ga0501080_0628343
1077 Ga0501081_0000680
1078 Ga0501081_0002406
1079 Ga0501083_0197124
1080 Ga0501035_0080030
1081 Ga0501035_0144481
1082 Ga0501044_0071240
1083 Ga0501045_0002526
1084 Ga0501045_0092703
1085 nmdc:mga05p37_29333_c1
1086 nmdc:mga05p37_510_c1
1087 nmdc:mga05p37_931_c1
1088 nmdc:mga09592_1086_c1
1089 nmdc:mga09592_49676_c1
1090 nmdc:mga09592_75_c1
1091 nmdc:mga0qj67_368_c1
1092 nmdc:mga06r32_136009_c1
1093 nmdc:mga06r32_148618_c1
1094 nmdc:mga06r32_15504_c1
1095 nmdc:mga06r32_1675_c1
1096 nmdc:mga06r32_564910_c1
1097 nmdc:mga08y16_124755_c1
1098 nmdc:mga08y16_183697_c1
1099 nmdc:mga08y16_56348_c1
1100 nmdc:mga08x19_22243_c1
1101 nmdc:mga0a205_538952_c1
1102 Ga0495601_0042566
1103 Ga0495601_0141193
1104 Ga0495612_0027102
1105 Ga0495595_0071075
1106 Ga0495619_0075349
1107 Ga0501084_0053651
1108 Ga0501082_0024634
1109 Ga0501082_0389290
1110 Ga0530510_0000221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

80

174

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eg5-assembly1.cif.gz_B fmn-bound form of yvic from lactococcus lactis subsp. lactis il1403 0.8295 37 152
1flm-assembly1.cif.gz_B dimer of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8191 49 152
3amf-assembly1.cif.gz_B e13r mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8183 36 152
3awh-assembly1.cif.gz_B e13k mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8176 36 152
2e83-assembly1.cif.gz_B t31v mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8163 36 152
ID Description Score Start End Superfamily
1wliA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8143 42 152 2.30.110.10
af_Q57730_15_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7928 36 150 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7826 36 152 2.30.110.10
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.779 33 149 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7657 36 152 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A3N5H7Z0-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9815 3 199
AF-A0A433B166-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.981 7 192
AF-A0A538DHM8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.977 6 196
AF-A0A7W1DYC8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9769 6 196
AF-A0A536U4P0-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9764 4 199

Map