F463166

General Info

Members Datasets Scaffolds Average Seq Length
555 331 1110 256

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2547132512|2548848690
Length 287
Sequence SQESGAAEESFLSHLVELRDRLIRALLAVLVVFVCLFPWSRELYTLLANPLLASLPAGGQMIATDVVGVFLVPMKITLMVAFLIALPYVLFQAWAFVAPGLYSHEKRLVLPLVFASVLLFFSGMAFAYFLVFPTVFGFMAKVAPEGVAWMTDIDKYLSFVLSTFVAFGVTFEVPVIVIVLVRIGLVDIAKLKEWRPYVIVGAFIIGAVFTPPDVLSQIMLAVPLWLLYELGIILASFIGRRPQPEVAAPAPSDPAPAAAPAADWQPMSAGEMDQALGHSQAPERKQD

Samples

Sample ID Description Type Environment
1 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
2 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
3 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
174 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
175 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
176 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
177 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
178 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
179 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
180 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
280 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
296 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
297 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 2547132512 Azospira oryzae 6a3 Isolate Unclassified
302 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
303 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
304 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
305 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
306 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
307 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
308 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
309 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
310 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
311 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
312 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
313 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
314 2842677519 Variovorax sp. R-72495 Isolate Unclassified
315 2842733646 Variovorax sp. R-72446 Isolate Unclassified
316 2842747753 Variovorax sp. R-72060 Isolate Unclassified
317 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
318 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
319 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
320 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
321 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
322 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
323 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
324 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
325 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
326 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
327 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
328 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
329 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
330 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
331 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.41
Metatranscriptomes 0
Isolates 5.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.95
Nodule 0.36
Rhizoplane 1.98
Rhizosphere 87.57
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000038 3300003751 Bacteria 186588
2 Ga0055539_1000049 3300003752 Bacteria 186588
3 Ga0055539_1005610 3300003752 Bacteria 1625
4 Ga0055533_1000060 3300003756 Bacteria 186588
5 Ga0055525_1000068 3300003759 Bacteria 186588
6 Ga0055535_1000047 3300003761 Bacteria 139836
7 Ga0055529_1000148 3300003763 Bacteria 100809
8 Ga0055536_1011467 3300003781 Bacteria 3396
9 Ga0055528_1020900 3300003790 Bacteria 2101
10 Ga0055541_1000036 3300003841 Bacteria 186588
11 Ga0070676_10026650 3300005328 Bacteria 3272
12 Ga0070690_100342450 3300005330 Bacteria 1083
13 Ga0070670_100000692 3300005331 Bacteria 26190
14 Ga0070670_100452656 3300005331 Bacteria 1138
15 Ga0070677_10020340 3300005333 Bacteria 2417
16 Ga0070677_10098276 3300005333 Bacteria 1286
17 Ga0068869_100022148 3300005334 Bacteria 4375
18 Ga0068869_100059334 3300005334 Bacteria 2801
19 Ga0070666_10065800 3300005335 Bacteria 2459
20 Ga0070666_10323979 3300005335 Bacteria 1099
21 Ga0070666_10348516 3300005335 Bacteria 1059
22 Ga0070680_100092214 3300005336 Bacteria 2508
23 Ga0070682_100168922 3300005337 Bacteria 1518
24 Ga0070682_100334393 3300005337 Bacteria 1124
25 Ga0068868_100000253 3300005338 Bacteria 36425
26 Ga0068868_100022363 3300005338 Bacteria 4770
27 Ga0068868_100183040 3300005338 Bacteria 1739
28 Ga0070689_100053463 3300005340 Bacteria 3126
29 Ga0070661_100003077 3300005344 Bacteria 11478
30 Ga0070661_100005695 3300005344 Bacteria 8584
31 Ga0070668_100024873 3300005347 Bacteria 4539
32 Ga0070668_100027833 3300005347 Bacteria 4290
33 Ga0070668_100190949 3300005347 Bacteria 1677
34 Ga0070669_100017587 3300005353 Bacteria 5099
35 Ga0070675_100011075 3300005354 Bacteria 7060
36 Ga0070675_100019750 3300005354 Bacteria 5373
37 Ga0070675_100053283 3300005354 Bacteria 3327
38 Ga0070675_100240066 3300005354 Bacteria 1583
39 Ga0070675_100387732 3300005354 Bacteria 1244
40 Ga0070671_100000871 3300005355 Bacteria 22094
41 Ga0070671_100022343 3300005355 Bacteria 5166
42 Ga0070671_100096043 3300005355 Bacteria 2485
43 Ga0070674_100037267 3300005356 Bacteria 3270
44 Ga0070674_100207880 3300005356 Bacteria 1515
45 Ga0070673_100006599 3300005364 Bacteria 7556
46 Ga0070673_100071166 3300005364 Bacteria 2793
47 Ga0070673_100308744 3300005364 Bacteria 1395
48 Ga0070659_100109127 3300005366 Bacteria 2233
49 Ga0070659_100121847 3300005366 Unclassified 2113
50 Ga0070659_100190309 3300005366 Bacteria 1686
51 Ga0070659_100333909 3300005366 Bacteria 1269
52 Ga0070667_100033484 3300005367 Bacteria 4295
53 Ga0070667_100257730 3300005367 Bacteria 1561
54 Ga0070667_100318068 3300005367 Bacteria 1404
55 Ga0070667_100679181 3300005367 Bacteria 952
56 Ga0070713_100000035 3300005436 Bacteria 86284
57 Ga0070701_10195939 3300005438 Bacteria 1191
58 Ga0070711_100623062 3300005439 Unclassified 902
59 Ga0070700_100016055 3300005441 Bacteria 4259
60 Ga0070694_100190210 3300005444 Bacteria 1524
61 Ga0070708_100000226 3300005445 Bacteria 42003
62 Ga0070708_100016414 3300005445 Bacteria 6144
63 Ga0070708_100278700 3300005445 Bacteria 1574
64 Ga0070663_100191148 3300005455 Bacteria 1593
65 Ga0070663_100443295 3300005455 Bacteria 1069
66 Ga0070678_100002100 3300005456 Bacteria 10797
67 Ga0070678_100022084 3300005456 Bacteria 4207
68 Ga0070662_100004648 3300005457 Bacteria 8704
69 Ga0070662_100052867 3300005457 Bacteria 2939
70 Ga0070681_10005530 3300005458 Bacteria 12207
71 Ga0070681_10018249 3300005458 Bacteria 7011
72 Ga0070681_10029669 3300005458 Bacteria 5492
73 Ga0070681_10070630 3300005458 Bacteria 3457
74 Ga0068867_100014933 3300005459 Bacteria 5504
75 Ga0068867_100021027 3300005459 Bacteria 4654
76 Ga0068867_100311953 3300005459 Bacteria 1300
77 Ga0068867_100445988 3300005459 Bacteria 1101
78 Ga0070685_10017784 3300005466 Bacteria 3812
79 Ga0070706_100014985 3300005467 Bacteria 7159
80 Ga0070679_100005476 3300005530 Bacteria 11765
81 Ga0070679_100007684 3300005530 Bacteria 10093
82 Ga0070684_100064261 3300005535 Bacteria 3219
83 Ga0068853_100008821 3300005539 Bacteria 8111
84 Ga0068853_100103116 3300005539 Bacteria 2525
85 Ga0068853_100256528 3300005539 Unclassified 1606
86 Ga0068853_100274428 3300005539 Bacteria 1553
87 Ga0070672_100013465 3300005543 Bacteria 5778
88 Ga0070672_100022403 3300005543 Bacteria 4640
89 Ga0070672_100032039 3300005543 Bacteria 3964
90 Ga0070695_100176885 3300005545 Bacteria 1509
91 Ga0070696_100057091 3300005546 Bacteria 2724
92 Ga0070693_100005410 3300005547 Bacteria 6128
93 Ga0070693_100186467 3300005547 Bacteria 1339
94 Ga0070693_100235607 3300005547 Bacteria 1206
95 Ga0070665_100010396 3300005548 Bacteria 9417
96 Ga0070665_100041284 3300005548 Bacteria 4636
97 Ga0070665_100042267 3300005548 Bacteria 4581
98 Ga0070665_100200341 3300005548 Bacteria 1997
99 Ga0068855_100004108 3300005563 Bacteria 17755
100 Ga0068855_100208901 3300005563 Bacteria 2195
101 Ga0068855_100315796 3300005563 Bacteria 1728
102 Ga0068855_100364463 3300005563 Bacteria 1590
103 Ga0070664_100040966 3300005564 Bacteria 3907
104 Ga0068857_100091346 3300005577 Bacteria 2725
105 Ga0068857_100276086 3300005577 Bacteria 1545
106 Ga0068857_100523979 3300005577 Bacteria 1114
107 Ga0068854_100000716 3300005578 Bacteria 19611
108 Ga0068854_100069295 3300005578 Bacteria 2574
109 Ga0068856_100305414 3300005614 Bacteria 1609
110 Ga0068852_100001050 3300005616 Bacteria 18205
111 Ga0068852_100099559 3300005616 Bacteria 2621
112 Ga0068852_100260633 3300005616 Bacteria 1664
113 Ga0068852_100263024 3300005616 Bacteria 1657
114 Ga0068859_100035543 3300005617 Bacteria 4999
115 Ga0068859_100359001 3300005617 Bacteria 1552
116 Ga0068864_100008010 3300005618 Bacteria 8715
117 Ga0068864_100029046 3300005618 Bacteria 4678
118 Ga0068864_100035731 3300005618 Bacteria 4232
119 Ga0068861_100095561 3300005719 Bacteria 2354
120 Ga0068861_100375807 3300005719 Bacteria 1254
121 Ga0068851_10005262 3300005834 Bacteria 5871
122 Ga0068863_100035451 3300005841 Bacteria 4752
123 Ga0068863_100122784 3300005841 Bacteria 2477
124 Ga0068863_100131425 3300005841 Bacteria 2390
125 Ga0068863_100276939 3300005841 Bacteria 1625
126 Ga0068863_100508481 3300005841 Bacteria 1187
127 Ga0068858_100019547 3300005842 Bacteria 6334
128 Ga0068858_100020972 3300005842 Bacteria 6105
129 Ga0068858_100390730 3300005842 Bacteria 1336
130 Ga0068860_100019229 3300005843 Bacteria 6630
131 Ga0068860_100069985 3300005843 Bacteria 3335
132 Ga0068860_100125266 3300005843 Bacteria 2462
133 Ga0068860_100305408 3300005843 Bacteria 1559
134 Ga0068862_100050623 3300005844 Bacteria 3550
135 Ga0068862_100106588 3300005844 Bacteria 2457
136 Ga0068862_100111830 3300005844 Bacteria 2398
137 Ga0081539_10062434 3300005985 Bacteria 2036
138 Ga0075363_100007676 3300006048 Bacteria 4976
139 Ga0075363_100070506 3300006048 Bacteria 1898
140 Ga0070712_100082817 3300006175 Bacteria 2328
141 Ga0075362_10053736 3300006177 Bacteria 1809
142 Ga0075366_10009938 3300006195 Bacteria 5327
143 Ga0097621_100001917 3300006237 Bacteria 14212
144 Ga0097621_100005613 3300006237 Bacteria 8850
145 Ga0097621_100062821 3300006237 Bacteria 3050
146 Ga0068871_100000538 3300006358 Bacteria 25810
147 Ga0068871_100051100 3300006358 Bacteria 3346
148 Ga0068871_100204962 3300006358 Unclassified 1704
149 Ga0068871_100388749 3300006358 Bacteria 1240
150 Ga0075433_10251481 3300006852 Bacteria 1568
151 Ga0075434_100138215 3300006871 Bacteria 2456
152 Ga0068865_100010898 3300006881 Bacteria 5672
153 Ga0068865_100028779 3300006881 Bacteria 3680
154 Ga0075436_100014027 3300006914 Bacteria 5484
155 Ga0075436_100418564 3300006914 Bacteria 972
156 Ga0097620_100035547 3300006931 Bacteria 4999
157 Ga0097620_100359021 3300006931 Bacteria 1552
158 Ga0079104_1006836 3300006946 Bacteria 4228
159 Ga0075435_100053501 3300007076 Bacteria 3256
160 Ga0105244_10054494 3300009036 Bacteria 2028
161 Ga0105240_10708133 3300009093 Bacteria 1098
162 Ga0105240_10708135 3300009093 Bacteria 1098
163 Ga0105245_10018056 3300009098 Bacteria 6163
164 Ga0105245_10056864 3300009098 Bacteria 3517
165 Ga0105245_10382112 3300009098 Bacteria 1403
166 Ga0105245_10630202 3300009098 Bacteria 1101
167 Ga0105243_10050213 3300009148 Bacteria 3294
168 Ga0105243_10077065 3300009148 Bacteria 2711
169 Ga0105243_10086933 3300009148 Bacteria 2565
170 Ga0105241_10114475 3300009174 Bacteria 2163
171 Ga0105241_10149275 3300009174 Bacteria 1911
172 Ga0105241_10318323 3300009174 Bacteria 1341
173 Ga0105242_10060271 3300009176 Bacteria 3117
174 Ga0105237_10016005 3300009545 Bacteria 7799
175 Ga0105237_10078196 3300009545 Bacteria 3298
176 Ga0105238_10000037 3300009551 Bacteria 163954
177 Ga0105238_10518786 3300009551 Bacteria 1194
178 Ga0105249_10029150 3300009553 Bacteria 4984
179 Ga0105249_10099999 3300009553 Bacteria 2726
180 Ga0105249_10473196 3300009553 Bacteria 1295
181 Ga0105239_10003694 3300010375 Bacteria 18647
182 Ga0105246_10159816 3300011119 Bacteria 1715
183 Ga0157373_10024975 3300013100 Bacteria 4326
184 Ga0157373_10132676 3300013100 Bacteria 1751
185 Ga0157370_10010855 3300013104 Bacteria 9566
186 Ga0157369_10437601 3300013105 Bacteria 1355
187 Ga0157374_10002909 3300013296 Bacteria 14341
188 Ga0157374_10037000 3300013296 Bacteria 4475
189 Ga0157374_10051813 3300013296 Bacteria 3820
190 Ga0157378_10001459 3300013297 Bacteria 21320
191 Ga0157378_10044438 3300013297 Bacteria 3945
192 Ga0157378_10413229 3300013297 Unclassified 1332
193 Ga0163162_10174597 3300013306 Bacteria 2274
194 Ga0163162_10183383 3300013306 Bacteria 2219
195 Ga0163162_10455547 3300013306 Bacteria 1411
196 Ga0157372_10115336 3300013307 Bacteria 3080
197 Ga0157372_10329778 3300013307 Bacteria 1777
198 Ga0157375_10021885 3300013308 Bacteria 5876
199 Ga0157375_10207285 3300013308 Bacteria 2117
200 Ga0157375_10317574 3300013308 Bacteria 1722
201 Ga0157375_10363863 3300013308 Unclassified 1613
202 Ga0163163_10173820 3300014325 Bacteria 2200
203 Ga0163163_10651472 3300014325 Bacteria 1117
204 Ga0157380_10078157 3300014326 Bacteria 2698
205 Ga0182008_10001806 3300014497 Bacteria 13972
206 Ga0182008_10112366 3300014497 Bacteria 1350
207 Ga0157377_10532896 3300014745 Bacteria 826
208 Ga0157379_10016632 3300014968 Bacteria 6468
209 Ga0157376_10039601 3300014969 Bacteria 3845
210 Ga0157376_10140549 3300014969 Bacteria 2165
211 Ga0182006_1013171 3300015261 Bacteria 3594
212 Ga0163161_10090431 3300017792 Bacteria 2265
213 Ga0163161_10154696 3300017792 Unclassified 1745
214 Ga0163161_10174532 3300017792 Bacteria 1645
215 Ga0163161_10187366 3300017792 Bacteria 1589
216 Ga0163161_10521370 3300017792 Bacteria 970
217 Ga0213872_10002128 3300021361 Bacteria 11902
218 Ga0209784_100021 3300025224 Bacteria 408534
219 Ga0209566_100039 3300025225 Bacteria 303368
220 Ga0209674_100036 3300025226 Bacteria 408534
221 Ga0209563_100040 3300025230 Bacteria 408534
222 Ga0209258_100072 3300025242 Bacteria 274355
223 Ga0209677_100023 3300025253 Bacteria 408534
224 Ga0209677_102144 3300025253 Bacteria 7722
225 Ga0209148_1007931 3300025254 Bacteria 2167
226 Ga0209759_1001427 3300025256 Bacteria 13561
227 Ga0209455_1000053 3300025272 Bacteria 365949
228 Ga0209051_1007486 3300025303 Bacteria 5959
229 Ga0207656_10005860 3300025321 Bacteria 4379
230 Ga0207682_10025296 3300025893 Bacteria 2354
231 Ga0207688_10050323 3300025901 Bacteria 2332
232 Ga0207645_10000283 3300025907 Bacteria 42259
233 Ga0207645_10028682 3300025907 Bacteria 3592
234 Ga0207645_10178984 3300025907 Bacteria 1391
235 Ga0207643_10008729 3300025908 Bacteria 5437
236 Ga0207684_10011988 3300025910 Bacteria 7549
237 Ga0207654_10097941 3300025911 Bacteria 1801
238 Ga0207707_10004312 3300025912 Bacteria 12593
239 Ga0207707_10020642 3300025912 Bacteria 5754
240 Ga0207707_10174920 3300025912 Bacteria 1875
241 Ga0207695_10010922 3300025913 Bacteria 11045
242 Ga0207671_10035886 3300025914 Bacteria 3676
243 Ga0207657_10002121 3300025919 Bacteria 21468
244 Ga0207649_10011463 3300025920 Bacteria 4889
245 Ga0207652_10089317 3300025921 Bacteria 2706
246 Ga0207646_10197327 3300025922 Bacteria 1817
247 Ga0207681_10082324 3300025923 Bacteria 2275
248 Ga0207681_10306512 3300025923 Bacteria 1258
249 Ga0207694_10000054 3300025924 Bacteria 152124
250 Ga0207650_10001040 3300025925 Bacteria 20814
251 Ga0207650_10383206 3300025925 Bacteria 1161
252 Ga0207659_10018683 3300025926 Bacteria 4548
253 Ga0207687_10303146 3300025927 Bacteria 1287
254 Ga0207687_10479923 3300025927 Bacteria 1035
255 Ga0207700_10000023 3300025928 Bacteria 152285
256 Ga0207644_10000402 3300025931 Bacteria 28200
257 Ga0207690_10001407 3300025932 Bacteria 15134
258 Ga0207690_10082797 3300025932 Bacteria 2245
259 Ga0207706_10002114 3300025933 Bacteria 19441
260 Ga0207706_10059775 3300025933 Bacteria 3356
261 Ga0207706_10446029 3300025933 Bacteria 1120
262 Ga0207686_10239474 3300025934 Bacteria 1320
263 Ga0207709_10250731 3300025935 Bacteria 1293
264 Ga0207670_10069961 3300025936 Bacteria 2422
265 Ga0207670_10187804 3300025936 Bacteria 1562
266 Ga0207669_10012250 3300025937 Bacteria 4211
267 Ga0207669_10176811 3300025937 Bacteria 1525
268 Ga0207704_10003973 3300025938 Bacteria 6728
269 Ga0207704_10102374 3300025938 Bacteria 1912
270 Ga0207691_10000546 3300025940 Bacteria 37681
271 Ga0207691_10001560 3300025940 Bacteria 22750
272 Ga0207691_10012147 3300025940 Bacteria 8257
273 Ga0207691_10604474 3300025940 Bacteria 928
274 Ga0207711_10041752 3300025941 Bacteria 3907
275 Ga0207689_10008822 3300025942 Bacteria 8763
276 Ga0207689_10039270 3300025942 Bacteria 3919
277 Ga0207661_10000756 3300025944 Bacteria 21025
278 Ga0207679_10000697 3300025945 Bacteria 22447
279 Ga0207679_10162609 3300025945 Bacteria 1829
280 Ga0207679_10389051 3300025945 Bacteria 1224
281 Ga0207667_10000043 3300025949 Bacteria 261426
282 Ga0207667_10008425 3300025949 Bacteria 12250
283 Ga0207651_10013718 3300025960 Bacteria 4649
284 Ga0207651_10043941 3300025960 Bacteria 2986
285 Ga0207651_10066681 3300025960 Bacteria 2530
286 Ga0207651_10298268 3300025960 Bacteria 1339
287 Ga0207712_10092850 3300025961 Bacteria 2226
288 Ga0207712_10113339 3300025961 Bacteria 2038
289 Ga0207668_10208204 3300025972 Bacteria 1562
290 Ga0207640_10011266 3300025981 Bacteria 5059
291 Ga0207658_10032442 3300025986 Bacteria 3717
292 Ga0207658_10204014 3300025986 Bacteria 1652
293 Ga0207658_10513676 3300025986 Bacteria 1068
294 Ga0207677_10000512 3300026023 Bacteria 25019
295 Ga0207677_10019482 3300026023 Bacteria 4098
296 Ga0207703_10034843 3300026035 Bacteria 3997
297 Ga0207703_10113406 3300026035 Bacteria 2317
298 Ga0207703_10118946 3300026035 Bacteria 2266
299 Ga0207639_10057686 3300026041 Bacteria 2983
300 Ga0207639_10075230 3300026041 Bacteria 2655
301 Ga0207639_10268137 3300026041 Bacteria 1496
302 Ga0207639_10570450 3300026041 Unclassified 1041
303 Ga0207678_10046959 3300026067 Bacteria 3735
304 Ga0207678_10085878 3300026067 Bacteria 2690
305 Ga0207678_10123933 3300026067 Bacteria 2205
306 Ga0207678_10227405 3300026067 Bacteria 1597
307 Ga0207708_10050914 3300026075 Bacteria 3153
308 Ga0207708_10087305 3300026075 Bacteria 2401
309 Ga0207641_10018054 3300026088 Bacteria 5781
310 Ga0207641_10037656 3300026088 Bacteria 4041
311 Ga0207641_10223972 3300026088 Bacteria 1745
312 Ga0207641_10295824 3300026088 Bacteria 1527
313 Ga0207641_10478364 3300026088 Bacteria 1207
314 Ga0207648_10000564 3300026089 Bacteria 41549
315 Ga0207648_10015018 3300026089 Bacteria 7133
316 Ga0207648_10035837 3300026089 Bacteria 4371
317 Ga0207648_10091830 3300026089 Bacteria 2654
318 Ga0207648_10195079 3300026089 Bacteria 1795
319 Ga0207648_10253815 3300026089 Bacteria 1568
320 Ga0207648_10342563 3300026089 Unclassified 1346
321 Ga0207676_10052190 3300026095 Bacteria 3195
322 Ga0207674_10193450 3300026116 Bacteria 1984
323 Ga0207674_10208649 3300026116 Bacteria 1903
324 Ga0207674_10417981 3300026116 Bacteria 1296
325 Ga0207675_100643818 3300026118 Bacteria 1066
326 Ga0207683_10000424 3300026121 Bacteria 39012
327 Ga0207683_10000548 3300026121 Bacteria 34736
328 Ga0207683_10012009 3300026121 Bacteria 7394
329 Ga0207683_10250098 3300026121 Bacteria 1618
330 Ga0207698_10000476 3300026142 Bacteria 23298
331 Ga0207698_10048588 3300026142 Bacteria 3222
332 Ga0207698_10062962 3300026142 Bacteria 2900
333 Ga0209179_1012211 3300027512 Bacteria 1539
334 Ga0268266_10108027 3300028379 Bacteria 2461
335 Ga0268266_10117154 3300028379 Bacteria 2367
336 Ga0268266_10153902 3300028379 Bacteria 2075
337 Ga0268266_10518578 3300028379 Bacteria 1139
338 Ga0268265_10037481 3300028380 Bacteria 3560
339 Ga0268265_10275831 3300028380 Bacteria 1502
340 Ga0268265_10625524 3300028380 Bacteria 1032
341 Ga0268264_11112301 3300028381 Bacteria 799
342 Ga0265318_10004501 3300028577 Bacteria 6744
343 Ga0265324_10008018 3300029957 Bacteria 4232
344 Ga0316177_1085660 3300030731 Bacteria 2710
345 Ga0316176_1044943 3300030732 Bacteria 5479
346 Ga0314311_1181387 3300030733 Bacteria 8006
347 Ga0316179_1050503 3300030734 Bacteria 1904
348 Ga0316178_1075936 3300030735 Bacteria 5005
349 Ga0316180_1013705 3300030736 Bacteria 2008
350 Ga0316183_1046501 3300030742 Bacteria 6498
351 Ga0316181_1019721 3300030744 Bacteria 5168
352 Ga0265332_10000027 3300031238 Bacteria 190796
353 Ga0265332_10000058 3300031238 Bacteria 102565
354 Ga0265332_10006633 3300031238 Bacteria 5244
355 Ga0265328_10001134 3300031239 Bacteria 12267
356 Ga0265320_10058923 3300031240 Bacteria 1837
357 Ga0265325_10111888 3300031241 Bacteria 1326
358 Ga0265329_10005964 3300031242 Bacteria 4877
359 Ga0265331_10001042 3300031250 Bacteria 21611
360 Ga0265331_10129345 3300031250 Bacteria 1153
361 Ga0265327_10093456 3300031251 Bacteria 1463
362 Ga0265316_10022931 3300031344 Bacteria 5252
363 Ga0265316_10154158 3300031344 Bacteria 1720
364 Ga0307509_10000054 3300031507 Bacteria 163301
365 Ga0265314_10000488 3300031711 Bacteria 51640
366 Ga0265314_10030723 3300031711 Bacteria 3973
367 Ga0265314_10033689 3300031711 Bacteria 3751
368 Ga0265342_10016954 3300031712 Bacteria 4746
369 Ga0307516_10136281 3300031730 Bacteria 2229
370 Ga0307405_10100508 3300031731 Bacteria 1938
371 Ga0307405_10284453 3300031731 Bacteria 1246
372 Ga0307412_10206806 3300031911 Bacteria 1494
373 Ga0307416_100109982 3300032002 Bacteria 2425
374 Ga0316583_10098424 3300032133 Bacteria 1020
375 Ga0373930_0055638 3300034816 Bacteria 873
376 Ga0373934_0000524 3300035086 Bacteria 13506
377 Ga0373923_0001446 3300035111 Bacteria 6812
378 Ga0373954_0012566 3300035118 Bacteria 3766
379 Ga0373954_0056931 3300035118 Bacteria 1841
380 Ga0373956_0000135 3300035119 Bacteria 26321
381 Ga0373956_0011618 3300035119 Bacteria 3630
382 Ga0373957_0017749 3300035120 Bacteria 2484
383 Ga0373946_0004173 3300035171 Bacteria 5148
384 Ga0373955_0029049 3300035172 Bacteria 2872
385 Ga0373933_0005320 3300035724 Bacteria 7015
386 Ga0373933_0206802 3300035724 Bacteria 1257
387 Ga0373933_0234681 3300035724 Bacteria 1179
388 Ga0373933_0257344 3300035724 Bacteria 1125
389 Ga0373937_0017569 3300036401 Bacteria 6375
390 Ga0373937_0047907 3300036401 Bacteria 3910
391 Ga0373937_0117711 3300036401 Bacteria 2475
392 Ga0395900_0000050 3300037418 Bacteria 224616
393 Ga0395900_0051406 3300037418 Bacteria 4245
394 Ga0395900_0144169 3300037418 Bacteria 2437
395 Ga0395898_0001856 3300037466 Bacteria 27096
396 Ga0395901_0002440 3300038443 Bacteria 18848
397 Ga0436361_0704696 3300039447 Bacteria 13555
398 Ga0466969_0000169 3300044656 Bacteria 35088
399 Ga0466969_0018822 3300044656 Bacteria 3594
400 Ga0466972_0001750 3300044658 Bacteria 10659
401 Ga0466965_0002178 3300044683 Bacteria 8245
402 Ga0466965_0005843 3300044683 Bacteria 5553
403 Ga0466965_0148890 3300044683 Bacteria 1223
404 Ga0466966_0001013 3300044684 Bacteria 17899
405 Ga0466966_0007854 3300044684 Bacteria 7059
406 Ga0466966_0017912 3300044684 Bacteria 4677
407 Ga0466961_0013769 3300044693 Bacteria 5183
408 Ga0466963_0005987 3300044694 Bacteria 7165
409 Ga0466964_0001613 3300044706 Bacteria 7783
410 Ga0466964_0003452 3300044706 Bacteria 5766
411 Ga0453684_0000716 3300044712 Bacteria 117287
412 Ga0453684_0087252 3300044712 Bacteria 3868
413 Ga0453684_0561752 3300044712 Bacteria 1256
414 Ga0466971_0051300 3300044719 Bacteria 1856
415 Ga0466970_0001919 3300044765 Bacteria 10053
416 Ga0466970_0005112 3300044765 Bacteria 6478
417 Ga0466970_0160131 3300044765 Bacteria 1245
418 Ga0466957_0006987 3300044842 Bacteria 6380
419 Ga0466957_0173928 3300044842 Bacteria 1403
420 Ga0466957_0207433 3300044842 Bacteria 1289
421 Ga0466959_0000027 3300045049 Bacteria 114262
422 Ga0466959_0028132 3300045049 Bacteria 4169
423 Ga0451576_0000239 3300045051 Bacteria 134323
424 Ga0451576_0003419 3300045051 Bacteria 21835
425 Ga0451576_0005794 3300045051 Bacteria 15361
426 Ga0451576_0028374 3300045051 Bacteria 5996
427 Ga0451576_0077112 3300045051 Bacteria 3468
428 Ga0451576_0136797 3300045051 Bacteria 2555
429 Ga0466958_0062516 3300045836 Bacteria 2270
430 Ga0466967_0027792 3300045976 Bacteria 4710
431 Ga0466967_0490917 3300045976 Bacteria 1204
432 Ga0495592_0008918 3300046454 Bacteria 7532
433 Ga0495592_0409397 3300046454 Bacteria 857
434 Ga0495641_0003418 3300046461 Bacteria 11897
435 Ga0495651_0000274 3300046462 Bacteria 40100
436 Ga0495651_0001676 3300046462 Bacteria 17133
437 Ga0495653_0005409 3300046463 Bacteria 10393
438 Ga0495580_0009275 3300046472 Bacteria 7743
439 Ga0495580_0029630 3300046472 Bacteria 3971
440 Ga0495639_0005050 3300046475 Bacteria 5667
441 Ga0495662_0003458 3300046476 Bacteria 7997
442 Ga0495664_0010079 3300046477 Bacteria 5301
443 Ga0495608_0007610 3300046511 Bacteria 7636
444 Ga0495628_0036419 3300046516 Bacteria 3949
445 Ga0495628_0043026 3300046516 Bacteria 3600
446 Ga0495630_0010579 3300046517 Bacteria 6664
447 Ga0495666_0038884 3300046526 Bacteria 2312
448 Ga0495640_0005911 3300046533 Bacteria 9704
449 Ga0495587_0002749 3300046536 Bacteria 11735
450 Ga0495587_0125192 3300046536 Bacteria 1471
451 Ga0495667_0007160 3300046559 Bacteria 7569
452 Ga0495667_0244002 3300046559 Bacteria 1144
453 Ga0495634_0004588 3300046642 Bacteria 10791
454 Ga0495657_0029252 3300046675 Bacteria 3866
455 Ga0495599_0003076 3300046678 Bacteria 9713
456 Ga0495647_0005191 3300046681 Bacteria 4266
457 Ga0495613_0008045 3300046689 Bacteria 7841
458 Ga0495600_0001375 3300046809 Bacteria 13432
459 Ga0495674_0005197 3300047319 Bacteria 12503
460 Ga0495674_0419153 3300047319 Bacteria 1079
461 Ga0495684_0004387 3300047471 Bacteria 11028
462 Ga0496100_0040915 3300048903 Bacteria 2952
463 Ga0496102_0200506 3300048905 Bacteria 1881
464 Ga0496104_0143170 3300048907 Bacteria 2297
465 Ga0496105_0247573 3300048908 Bacteria 1445
466 Ga0496106_0183394 3300048909 Bacteria 1662
467 Ga0496108_0018163 3300048911 Bacteria 5756
468 Ga0496109_0018049 3300048912 Bacteria 6194
469 Ga0496110_0002372 3300048913 Bacteria 14103
470 Ga0496114_0011388 3300048917 Bacteria 7106
471 Ga0496114_0055364 3300048917 Bacteria 3308
472 Ga0496115_0164423 3300048918 Unclassified 1835
473 Ga0496122_0000612 3300048925 Bacteria 73307
474 Ga0496123_0000274 3300048926 Bacteria 101783
475 Ga0496126_0030353 3300048929 Bacteria 5122
476 Ga0501290_011354 3300049513 Bacteria 1146
477 Ga0501031_0082893 3300049568 Bacteria 2090
478 Ga0501032_0005458 3300049569 Bacteria 9438
479 Ga0501033_0022882 3300049570 Bacteria 4711
480 Ga0501036_0004087 3300049572 Bacteria 11744
481 Ga0501037_0005227 3300049573 Bacteria 9438
482 Ga0501038_0063645 3300049574 Bacteria 3148
483 Ga0501038_0134816 3300049574 Bacteria 2024
484 Ga0501039_0530700 3300049575 Bacteria 924
485 Ga0501040_0006407 3300049576 Bacteria 7644
486 Ga0501042_0002271 3300049578 Bacteria 11737
487 Ga0501043_0000590 3300049579 Bacteria 32162
488 Ga0501046_0003768 3300049580 Bacteria 13880
489 Ga0501047_0004747 3300049581 Bacteria 12779
490 Ga0501048_0062112 3300049582 Bacteria 2644
491 Ga0501068_0001005 3300049584 Bacteria 14851
492 Ga0501069_0160507 3300049585 Bacteria 1294
493 Ga0501070_0137960 3300049586 Unclassified 2014
494 Ga0501077_0290642 3300049593 Bacteria 1041
495 Ga0501225_0007716 3300049705 Bacteria 3114
496 Ga0501083_0021614 3300049744 Bacteria 4469
497 Ga0501262_000513 3300049759 Bacteria 4596
498 Ga0501035_0028798 3300049822 Bacteria 5068
499 Ga0501035_0114899 3300049822 Bacteria 2357
500 Ga0501035_0380529 3300049822 Bacteria 1177
501 Ga0501044_0001129 3300049823 Bacteria 31721
502 Ga0501045_0001357 3300049824 Bacteria 16252
503 nmdc:mga03n38_78093_c1 3300050490 Bacteria 1549
504 nmdc:mga0n895_465232_c1 3300050512 Bacteria 1276
505 nmdc:mga0n895_90459_c1 3300050512 Bacteria 3062
506 nmdc:mga0rr50_53542_c1 3300050513 Bacteria 3002
507 nmdc:mga08x19_386221_c1 3300050514 Bacteria 981
508 nmdc:mga0a205_304774_c1 3300050515 Bacteria 1465
509 nmdc:mga0a205_477478_c1 3300050515 Bacteria 1105
510 Ga0495601_0033932 3300053077 Bacteria 3180
511 Ga0495601_0185700 3300053077 Bacteria 1359
512 Ga0500635_0000030 3300053080 Bacteria 99936
513 Ga0495595_0000266 3300053084 Bacteria 20675
514 Ga0495619_0127635 3300053085 Bacteria 1746
515 Ga0495619_0238195 3300053085 Bacteria 1261
516 Ga0500594_0003939 3300053118 Bacteria 3270
517 Ga0500608_009376 3300053122 Bacteria 4156
518 Ga0500608_013000 3300053122 Bacteria 3676
519 Ga0500608_084030 3300053122 Bacteria 1498
520 Ga0500618_004506 3300053125 Bacteria 4421
521 Ga0500636_0007280 3300053177 Bacteria 6397
522 Ga0500661_025996 3300055283 Bacteria 1035
523 Ga0466962_0002224 3300061719 Bacteria 9174
524 Ga0466962_0149606 3300061719 Bacteria 1132
525 2548848690 2547132512 Bacteria 3416496
526 2511385829 2511231026 Bacteria 5225445
527 2521560056 2521172590 Bacteria 5047645
528 2526211228 2526164512 Bacteria 4025691
529 2553008074 2551306416 Bacteria 6152985
530 2644162180 2643221628 Bacteria 5745828
531 2687577755 2687453129 Bacteria 4387428
532 2765571235 2765235838 Bacteria 5445269
533 2808982598 2808606386 Bacteria 4471946
534 2809129575 2808606415 Bacteria 4576710
535 2809149370 2808606419 Bacteria 4576925
536 2819616419 2818991449 Bacteria 5518009
537 2839099076 2839094727 Bacteria 5534556
538 2842680603 2842677519 Bacteria 5615038
539 2842736397 2842733646 Bacteria 5716726
540 2842748905 2842747753 Bacteria 5578255
541 2852619512 2852618963 Bacteria 4577824
542 2887376234 2887375801 Bacteria 5334027
543 2904440910 2904439833 Bacteria 5931679
544 2904535512 2904530477 Bacteria 5876334
545 2904588347 2904584206 Bacteria 6028872
546 2904594765 2904589729 Bacteria 6113573
547 2904606028 2904601388 Bacteria 5884906
548 2919049077 2919046199 Bacteria 5567169
549 2919084686 2919079590 Bacteria 5946433
550 2919462718 2919462493 Bacteria 5817112
551 2919691049 2919688452 Bacteria 4595932
552 2923513787 2923510766 Bacteria 5926163
553 2928134373 2928130867 Bacteria 5467269
554 2945949482 2945945610 Bacteria 5951079
555 2998345342 2998344455 Bacteria 4222996
556 Ga0055538_1000038
557 Ga0055539_1000049
558 Ga0055539_1005610
559 Ga0055533_1000060
560 Ga0055525_1000068
561 Ga0055535_1000047
562 Ga0055529_1000148
563 Ga0055536_1011467
564 Ga0055528_1020900
565 Ga0055541_1000036
566 Ga0070676_10026650
567 Ga0070690_100342450
568 Ga0070670_100000692
569 Ga0070670_100452656
570 Ga0070677_10020340
571 Ga0070677_10098276
572 Ga0068869_100022148
573 Ga0068869_100059334
574 Ga0070666_10065800
575 Ga0070666_10323979
576 Ga0070666_10348516
577 Ga0070680_100092214
578 Ga0070682_100168922
579 Ga0070682_100334393
580 Ga0068868_100000253
581 Ga0068868_100022363
582 Ga0068868_100183040
583 Ga0070689_100053463
584 Ga0070661_100003077
585 Ga0070661_100005695
586 Ga0070668_100024873
587 Ga0070668_100027833
588 Ga0070668_100190949
589 Ga0070669_100017587
590 Ga0070675_100011075
591 Ga0070675_100019750
592 Ga0070675_100053283
593 Ga0070675_100240066
594 Ga0070675_100387732
595 Ga0070671_100000871
596 Ga0070671_100022343
597 Ga0070671_100096043
598 Ga0070674_100037267
599 Ga0070674_100207880
600 Ga0070673_100006599
601 Ga0070673_100071166
602 Ga0070673_100308744
603 Ga0070659_100109127
604 Ga0070659_100121847
605 Ga0070659_100190309
606 Ga0070659_100333909
607 Ga0070667_100033484
608 Ga0070667_100257730
609 Ga0070667_100318068
610 Ga0070667_100679181
611 Ga0070713_100000035
612 Ga0070701_10195939
613 Ga0070711_100623062
614 Ga0070700_100016055
615 Ga0070694_100190210
616 Ga0070708_100000226
617 Ga0070708_100016414
618 Ga0070708_100278700
619 Ga0070663_100191148
620 Ga0070663_100443295
621 Ga0070678_100002100
622 Ga0070678_100022084
623 Ga0070662_100004648
624 Ga0070662_100052867
625 Ga0070681_10005530
626 Ga0070681_10018249
627 Ga0070681_10029669
628 Ga0070681_10070630
629 Ga0068867_100014933
630 Ga0068867_100021027
631 Ga0068867_100311953
632 Ga0068867_100445988
633 Ga0070685_10017784
634 Ga0070706_100014985
635 Ga0070679_100005476
636 Ga0070679_100007684
637 Ga0070684_100064261
638 Ga0068853_100008821
639 Ga0068853_100103116
640 Ga0068853_100256528
641 Ga0068853_100274428
642 Ga0070672_100013465
643 Ga0070672_100022403
644 Ga0070672_100032039
645 Ga0070695_100176885
646 Ga0070696_100057091
647 Ga0070693_100005410
648 Ga0070693_100186467
649 Ga0070693_100235607
650 Ga0070665_100010396
651 Ga0070665_100041284
652 Ga0070665_100042267
653 Ga0070665_100200341
654 Ga0068855_100004108
655 Ga0068855_100208901
656 Ga0068855_100315796
657 Ga0068855_100364463
658 Ga0070664_100040966
659 Ga0068857_100091346
660 Ga0068857_100276086
661 Ga0068857_100523979
662 Ga0068854_100000716
663 Ga0068854_100069295
664 Ga0068856_100305414
665 Ga0068852_100001050
666 Ga0068852_100099559
667 Ga0068852_100260633
668 Ga0068852_100263024
669 Ga0068859_100035543
670 Ga0068859_100359001
671 Ga0068864_100008010
672 Ga0068864_100029046
673 Ga0068864_100035731
674 Ga0068861_100095561
675 Ga0068861_100375807
676 Ga0068851_10005262
677 Ga0068863_100035451
678 Ga0068863_100122784
679 Ga0068863_100131425
680 Ga0068863_100276939
681 Ga0068863_100508481
682 Ga0068858_100019547
683 Ga0068858_100020972
684 Ga0068858_100390730
685 Ga0068860_100019229
686 Ga0068860_100069985
687 Ga0068860_100125266
688 Ga0068860_100305408
689 Ga0068862_100050623
690 Ga0068862_100106588
691 Ga0068862_100111830
692 Ga0081539_10062434
693 Ga0075363_100007676
694 Ga0075363_100070506
695 Ga0070712_100082817
696 Ga0075362_10053736
697 Ga0075366_10009938
698 Ga0097621_100001917
699 Ga0097621_100005613
700 Ga0097621_100062821
701 Ga0068871_100000538
702 Ga0068871_100051100
703 Ga0068871_100204962
704 Ga0068871_100388749
705 Ga0075433_10251481
706 Ga0075434_100138215
707 Ga0068865_100010898
708 Ga0068865_100028779
709 Ga0075436_100014027
710 Ga0075436_100418564
711 Ga0097620_100035547
712 Ga0097620_100359021
713 Ga0079104_1006836
714 Ga0075435_100053501
715 Ga0105244_10054494
716 Ga0105240_10708133
717 Ga0105240_10708135
718 Ga0105245_10018056
719 Ga0105245_10056864
720 Ga0105245_10382112
721 Ga0105245_10630202
722 Ga0105243_10050213
723 Ga0105243_10077065
724 Ga0105243_10086933
725 Ga0105241_10114475
726 Ga0105241_10149275
727 Ga0105241_10318323
728 Ga0105242_10060271
729 Ga0105237_10016005
730 Ga0105237_10078196
731 Ga0105238_10000037
732 Ga0105238_10518786
733 Ga0105249_10029150
734 Ga0105249_10099999
735 Ga0105249_10473196
736 Ga0105239_10003694
737 Ga0105246_10159816
738 Ga0157373_10024975
739 Ga0157373_10132676
740 Ga0157370_10010855
741 Ga0157369_10437601
742 Ga0157374_10002909
743 Ga0157374_10037000
744 Ga0157374_10051813
745 Ga0157378_10001459
746 Ga0157378_10044438
747 Ga0157378_10413229
748 Ga0163162_10174597
749 Ga0163162_10183383
750 Ga0163162_10455547
751 Ga0157372_10115336
752 Ga0157372_10329778
753 Ga0157375_10021885
754 Ga0157375_10207285
755 Ga0157375_10317574
756 Ga0157375_10363863
757 Ga0163163_10173820
758 Ga0163163_10651472
759 Ga0157380_10078157
760 Ga0182008_10001806
761 Ga0182008_10112366
762 Ga0157377_10532896
763 Ga0157379_10016632
764 Ga0157376_10039601
765 Ga0157376_10140549
766 Ga0182006_1013171
767 Ga0163161_10090431
768 Ga0163161_10154696
769 Ga0163161_10174532
770 Ga0163161_10187366
771 Ga0163161_10521370
772 Ga0213872_10002128
773 Ga0209784_100021
774 Ga0209566_100039
775 Ga0209674_100036
776 Ga0209563_100040
777 Ga0209258_100072
778 Ga0209677_100023
779 Ga0209677_102144
780 Ga0209148_1007931
781 Ga0209759_1001427
782 Ga0209455_1000053
783 Ga0209051_1007486
784 Ga0207656_10005860
785 Ga0207682_10025296
786 Ga0207688_10050323
787 Ga0207645_10000283
788 Ga0207645_10028682
789 Ga0207645_10178984
790 Ga0207643_10008729
791 Ga0207684_10011988
792 Ga0207654_10097941
793 Ga0207707_10004312
794 Ga0207707_10020642
795 Ga0207707_10174920
796 Ga0207695_10010922
797 Ga0207671_10035886
798 Ga0207657_10002121
799 Ga0207649_10011463
800 Ga0207652_10089317
801 Ga0207646_10197327
802 Ga0207681_10082324
803 Ga0207681_10306512
804 Ga0207694_10000054
805 Ga0207650_10001040
806 Ga0207650_10383206
807 Ga0207659_10018683
808 Ga0207687_10303146
809 Ga0207687_10479923
810 Ga0207700_10000023
811 Ga0207644_10000402
812 Ga0207690_10001407
813 Ga0207690_10082797
814 Ga0207706_10002114
815 Ga0207706_10059775
816 Ga0207706_10446029
817 Ga0207686_10239474
818 Ga0207709_10250731
819 Ga0207670_10069961
820 Ga0207670_10187804
821 Ga0207669_10012250
822 Ga0207669_10176811
823 Ga0207704_10003973
824 Ga0207704_10102374
825 Ga0207691_10000546
826 Ga0207691_10001560
827 Ga0207691_10012147
828 Ga0207691_10604474
829 Ga0207711_10041752
830 Ga0207689_10008822
831 Ga0207689_10039270
832 Ga0207661_10000756
833 Ga0207679_10000697
834 Ga0207679_10162609
835 Ga0207679_10389051
836 Ga0207667_10000043
837 Ga0207667_10008425
838 Ga0207651_10013718
839 Ga0207651_10043941
840 Ga0207651_10066681
841 Ga0207651_10298268
842 Ga0207712_10092850
843 Ga0207712_10113339
844 Ga0207668_10208204
845 Ga0207640_10011266
846 Ga0207658_10032442
847 Ga0207658_10204014
848 Ga0207658_10513676
849 Ga0207677_10000512
850 Ga0207677_10019482
851 Ga0207703_10034843
852 Ga0207703_10113406
853 Ga0207703_10118946
854 Ga0207639_10057686
855 Ga0207639_10075230
856 Ga0207639_10268137
857 Ga0207639_10570450
858 Ga0207678_10046959
859 Ga0207678_10085878
860 Ga0207678_10123933
861 Ga0207678_10227405
862 Ga0207708_10050914
863 Ga0207708_10087305
864 Ga0207641_10018054
865 Ga0207641_10037656
866 Ga0207641_10223972
867 Ga0207641_10295824
868 Ga0207641_10478364
869 Ga0207648_10000564
870 Ga0207648_10015018
871 Ga0207648_10035837
872 Ga0207648_10091830
873 Ga0207648_10195079
874 Ga0207648_10253815
875 Ga0207648_10342563
876 Ga0207676_10052190
877 Ga0207674_10193450
878 Ga0207674_10208649
879 Ga0207674_10417981
880 Ga0207675_100643818
881 Ga0207683_10000424
882 Ga0207683_10000548
883 Ga0207683_10012009
884 Ga0207683_10250098
885 Ga0207698_10000476
886 Ga0207698_10048588
887 Ga0207698_10062962
888 Ga0209179_1012211
889 Ga0268266_10108027
890 Ga0268266_10117154
891 Ga0268266_10153902
892 Ga0268266_10518578
893 Ga0268265_10037481
894 Ga0268265_10275831
895 Ga0268265_10625524
896 Ga0268264_11112301
897 Ga0265318_10004501
898 Ga0265324_10008018
899 Ga0316177_1085660
900 Ga0316176_1044943
901 Ga0314311_1181387
902 Ga0316179_1050503
903 Ga0316178_1075936
904 Ga0316180_1013705
905 Ga0316183_1046501
906 Ga0316181_1019721
907 Ga0265332_10000027
908 Ga0265332_10000058
909 Ga0265332_10006633
910 Ga0265328_10001134
911 Ga0265320_10058923
912 Ga0265325_10111888
913 Ga0265329_10005964
914 Ga0265331_10001042
915 Ga0265331_10129345
916 Ga0265327_10093456
917 Ga0265316_10022931
918 Ga0265316_10154158
919 Ga0307509_10000054
920 Ga0265314_10000488
921 Ga0265314_10030723
922 Ga0265314_10033689
923 Ga0265342_10016954
924 Ga0307516_10136281
925 Ga0307405_10100508
926 Ga0307405_10284453
927 Ga0307412_10206806
928 Ga0307416_100109982
929 Ga0316583_10098424
930 Ga0373930_0055638
931 Ga0373934_0000524
932 Ga0373923_0001446
933 Ga0373954_0012566
934 Ga0373954_0056931
935 Ga0373956_0000135
936 Ga0373956_0011618
937 Ga0373957_0017749
938 Ga0373946_0004173
939 Ga0373955_0029049
940 Ga0373933_0005320
941 Ga0373933_0206802
942 Ga0373933_0234681
943 Ga0373933_0257344
944 Ga0373937_0017569
945 Ga0373937_0047907
946 Ga0373937_0117711
947 Ga0395900_0000050
948 Ga0395900_0051406
949 Ga0395900_0144169
950 Ga0395898_0001856
951 Ga0395901_0002440
952 Ga0436361_0704696
953 Ga0466969_0000169
954 Ga0466969_0018822
955 Ga0466972_0001750
956 Ga0466965_0002178
957 Ga0466965_0005843
958 Ga0466965_0148890
959 Ga0466966_0001013
960 Ga0466966_0007854
961 Ga0466966_0017912
962 Ga0466961_0013769
963 Ga0466963_0005987
964 Ga0466964_0001613
965 Ga0466964_0003452
966 Ga0453684_0000716
967 Ga0453684_0087252
968 Ga0453684_0561752
969 Ga0466971_0051300
970 Ga0466970_0001919
971 Ga0466970_0005112
972 Ga0466970_0160131
973 Ga0466957_0006987
974 Ga0466957_0173928
975 Ga0466957_0207433
976 Ga0466959_0000027
977 Ga0466959_0028132
978 Ga0451576_0000239
979 Ga0451576_0003419
980 Ga0451576_0005794
981 Ga0451576_0028374
982 Ga0451576_0077112
983 Ga0451576_0136797
984 Ga0466958_0062516
985 Ga0466967_0027792
986 Ga0466967_0490917
987 Ga0495592_0008918
988 Ga0495592_0409397
989 Ga0495641_0003418
990 Ga0495651_0000274
991 Ga0495651_0001676
992 Ga0495653_0005409
993 Ga0495580_0009275
994 Ga0495580_0029630
995 Ga0495639_0005050
996 Ga0495662_0003458
997 Ga0495664_0010079
998 Ga0495608_0007610
999 Ga0495628_0036419
1000 Ga0495628_0043026
1001 Ga0495630_0010579
1002 Ga0495666_0038884
1003 Ga0495640_0005911
1004 Ga0495587_0002749
1005 Ga0495587_0125192
1006 Ga0495667_0007160
1007 Ga0495667_0244002
1008 Ga0495634_0004588
1009 Ga0495657_0029252
1010 Ga0495599_0003076
1011 Ga0495647_0005191
1012 Ga0495613_0008045
1013 Ga0495600_0001375
1014 Ga0495674_0005197
1015 Ga0495674_0419153
1016 Ga0495684_0004387
1017 Ga0496100_0040915
1018 Ga0496102_0200506
1019 Ga0496104_0143170
1020 Ga0496105_0247573
1021 Ga0496106_0183394
1022 Ga0496108_0018163
1023 Ga0496109_0018049
1024 Ga0496110_0002372
1025 Ga0496114_0011388
1026 Ga0496114_0055364
1027 Ga0496115_0164423
1028 Ga0496122_0000612
1029 Ga0496123_0000274
1030 Ga0496126_0030353
1031 Ga0501290_011354
1032 Ga0501031_0082893
1033 Ga0501032_0005458
1034 Ga0501033_0022882
1035 Ga0501036_0004087
1036 Ga0501037_0005227
1037 Ga0501038_0063645
1038 Ga0501038_0134816
1039 Ga0501039_0530700
1040 Ga0501040_0006407
1041 Ga0501042_0002271
1042 Ga0501043_0000590
1043 Ga0501046_0003768
1044 Ga0501047_0004747
1045 Ga0501048_0062112
1046 Ga0501068_0001005
1047 Ga0501069_0160507
1048 Ga0501070_0137960
1049 Ga0501077_0290642
1050 Ga0501225_0007716
1051 Ga0501083_0021614
1052 Ga0501262_000513
1053 Ga0501035_0028798
1054 Ga0501035_0114899
1055 Ga0501035_0380529
1056 Ga0501044_0001129
1057 Ga0501045_0001357
1058 nmdc:mga03n38_78093_c1
1059 nmdc:mga0n895_465232_c1
1060 nmdc:mga0n895_90459_c1
1061 nmdc:mga0rr50_53542_c1
1062 nmdc:mga08x19_386221_c1
1063 nmdc:mga0a205_304774_c1
1064 nmdc:mga0a205_477478_c1
1065 Ga0495601_0033932
1066 Ga0495601_0185700
1067 Ga0500635_0000030
1068 Ga0495595_0000266
1069 Ga0495619_0127635
1070 Ga0495619_0238195
1071 Ga0500594_0003939
1072 Ga0500608_009376
1073 Ga0500608_013000
1074 Ga0500608_084030
1075 Ga0500618_004506
1076 Ga0500636_0007280
1077 Ga0500661_025996
1078 Ga0466962_0002224
1079 Ga0466962_0149606
1080 2548848690
1081 2511385829
1082 2521560056
1083 2526211228
1084 2553008074
1085 2644162180
1086 2687577755
1087 2765571235
1088 2808982598
1089 2809129575
1090 2809149370
1091 2819616419
1092 2839099076
1093 2842680603
1094 2842736397
1095 2842748905
1096 2852619512
1097 2887376234
1098 2904440910
1099 2904535512
1100 2904588347
1101 2904594765
1102 2904606028
1103 2919049077
1104 2919084686
1105 2919462718
1106 2919691049
1107 2923513787
1108 2928134373
1109 2945949482
1110 2998345342

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

13

223

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.8744 15 236
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.86 15 238
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.86 15 236
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.843 15 238
8gym-assembly1.cif.gz_an cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.3432 91 257
ID Description Score Start End Superfamily
af_P9WJV5_535_729_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4667 59 242 1.20.1640.10
af_P9WJV5_535_729_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4479 59 242 1.20.1640.10
af_A3KFU9_372_573_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4202 34 242 1.20.1640.10
af_P9WJT9_505_699_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4187 59 242 1.20.1640.10
af_P0AG90_434_612_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4159 61 242 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A521XTW2-F1-model_v4 Sec-independent protein translocase protein TatC 0.9783 9 243 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A286EEL0-F1-model_v4 Sec-independent protein translocase protein TatC 0.9782 4 241 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A2R4XM52-F1-model_v4 Sec-independent protein translocase protein TatC 0.978 1 238 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A3A3FYA7-F1-model_v4 Sec-independent protein translocase protein TatC 0.9777 3 248 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A7Y9LM31-F1-model_v4 Sec-independent protein translocase protein TatC 0.9729 8 242 GO:0009977
GO:0033281
GO:0043953
GO:0065002

Map