F463166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 555 | 331 | 1110 | 256 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2547132512|2548848690 |
| Length | 287 |
| Sequence | SQESGAAEESFLSHLVELRDRLIRALLAVLVVFVCLFPWSRELYTLLANPLLASLPAGGQMIATDVVGVFLVPMKITLMVAFLIALPYVLFQAWAFVAPGLYSHEKRLVLPLVFASVLLFFSGMAFAYFLVFPTVFGFMAKVAPEGVAWMTDIDKYLSFVLSTFVAFGVTFEVPVIVIVLVRIGLVDIAKLKEWRPYVIVGAFIIGAVFTPPDVLSQIMLAVPLWLLYELGIILASFIGRRPQPEVAAPAPSDPAPAAAPAADWQPMSAGEMDQALGHSQAPERKQD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 2 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 3 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 4 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 174 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 175 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 176 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 177 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 178 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 179 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 180 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 197 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 211 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 219 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 260 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 263 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 281 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 293 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 296 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 297 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 299 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 300 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 301 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 302 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 303 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 304 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 305 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 306 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 307 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 308 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 309 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 310 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 311 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 312 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 313 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 314 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 315 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 316 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 317 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 318 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 319 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 320 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 321 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 322 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 323 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 324 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 325 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 326 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 327 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 328 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 329 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 330 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 331 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.41 |
| Metatranscriptomes | 0 |
| Isolates | 5.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.95 |
| Nodule | 0.36 |
| Rhizoplane | 1.98 |
| Rhizosphere | 87.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055538_1000038 | 3300003751 | Bacteria | 186588 |
| 2 | Ga0055539_1000049 | 3300003752 | Bacteria | 186588 |
| 3 | Ga0055539_1005610 | 3300003752 | Bacteria | 1625 |
| 4 | Ga0055533_1000060 | 3300003756 | Bacteria | 186588 |
| 5 | Ga0055525_1000068 | 3300003759 | Bacteria | 186588 |
| 6 | Ga0055535_1000047 | 3300003761 | Bacteria | 139836 |
| 7 | Ga0055529_1000148 | 3300003763 | Bacteria | 100809 |
| 8 | Ga0055536_1011467 | 3300003781 | Bacteria | 3396 |
| 9 | Ga0055528_1020900 | 3300003790 | Bacteria | 2101 |
| 10 | Ga0055541_1000036 | 3300003841 | Bacteria | 186588 |
| 11 | Ga0070676_10026650 | 3300005328 | Bacteria | 3272 |
| 12 | Ga0070690_100342450 | 3300005330 | Bacteria | 1083 |
| 13 | Ga0070670_100000692 | 3300005331 | Bacteria | 26190 |
| 14 | Ga0070670_100452656 | 3300005331 | Bacteria | 1138 |
| 15 | Ga0070677_10020340 | 3300005333 | Bacteria | 2417 |
| 16 | Ga0070677_10098276 | 3300005333 | Bacteria | 1286 |
| 17 | Ga0068869_100022148 | 3300005334 | Bacteria | 4375 |
| 18 | Ga0068869_100059334 | 3300005334 | Bacteria | 2801 |
| 19 | Ga0070666_10065800 | 3300005335 | Bacteria | 2459 |
| 20 | Ga0070666_10323979 | 3300005335 | Bacteria | 1099 |
| 21 | Ga0070666_10348516 | 3300005335 | Bacteria | 1059 |
| 22 | Ga0070680_100092214 | 3300005336 | Bacteria | 2508 |
| 23 | Ga0070682_100168922 | 3300005337 | Bacteria | 1518 |
| 24 | Ga0070682_100334393 | 3300005337 | Bacteria | 1124 |
| 25 | Ga0068868_100000253 | 3300005338 | Bacteria | 36425 |
| 26 | Ga0068868_100022363 | 3300005338 | Bacteria | 4770 |
| 27 | Ga0068868_100183040 | 3300005338 | Bacteria | 1739 |
| 28 | Ga0070689_100053463 | 3300005340 | Bacteria | 3126 |
| 29 | Ga0070661_100003077 | 3300005344 | Bacteria | 11478 |
| 30 | Ga0070661_100005695 | 3300005344 | Bacteria | 8584 |
| 31 | Ga0070668_100024873 | 3300005347 | Bacteria | 4539 |
| 32 | Ga0070668_100027833 | 3300005347 | Bacteria | 4290 |
| 33 | Ga0070668_100190949 | 3300005347 | Bacteria | 1677 |
| 34 | Ga0070669_100017587 | 3300005353 | Bacteria | 5099 |
| 35 | Ga0070675_100011075 | 3300005354 | Bacteria | 7060 |
| 36 | Ga0070675_100019750 | 3300005354 | Bacteria | 5373 |
| 37 | Ga0070675_100053283 | 3300005354 | Bacteria | 3327 |
| 38 | Ga0070675_100240066 | 3300005354 | Bacteria | 1583 |
| 39 | Ga0070675_100387732 | 3300005354 | Bacteria | 1244 |
| 40 | Ga0070671_100000871 | 3300005355 | Bacteria | 22094 |
| 41 | Ga0070671_100022343 | 3300005355 | Bacteria | 5166 |
| 42 | Ga0070671_100096043 | 3300005355 | Bacteria | 2485 |
| 43 | Ga0070674_100037267 | 3300005356 | Bacteria | 3270 |
| 44 | Ga0070674_100207880 | 3300005356 | Bacteria | 1515 |
| 45 | Ga0070673_100006599 | 3300005364 | Bacteria | 7556 |
| 46 | Ga0070673_100071166 | 3300005364 | Bacteria | 2793 |
| 47 | Ga0070673_100308744 | 3300005364 | Bacteria | 1395 |
| 48 | Ga0070659_100109127 | 3300005366 | Bacteria | 2233 |
| 49 | Ga0070659_100121847 | 3300005366 | Unclassified | 2113 |
| 50 | Ga0070659_100190309 | 3300005366 | Bacteria | 1686 |
| 51 | Ga0070659_100333909 | 3300005366 | Bacteria | 1269 |
| 52 | Ga0070667_100033484 | 3300005367 | Bacteria | 4295 |
| 53 | Ga0070667_100257730 | 3300005367 | Bacteria | 1561 |
| 54 | Ga0070667_100318068 | 3300005367 | Bacteria | 1404 |
| 55 | Ga0070667_100679181 | 3300005367 | Bacteria | 952 |
| 56 | Ga0070713_100000035 | 3300005436 | Bacteria | 86284 |
| 57 | Ga0070701_10195939 | 3300005438 | Bacteria | 1191 |
| 58 | Ga0070711_100623062 | 3300005439 | Unclassified | 902 |
| 59 | Ga0070700_100016055 | 3300005441 | Bacteria | 4259 |
| 60 | Ga0070694_100190210 | 3300005444 | Bacteria | 1524 |
| 61 | Ga0070708_100000226 | 3300005445 | Bacteria | 42003 |
| 62 | Ga0070708_100016414 | 3300005445 | Bacteria | 6144 |
| 63 | Ga0070708_100278700 | 3300005445 | Bacteria | 1574 |
| 64 | Ga0070663_100191148 | 3300005455 | Bacteria | 1593 |
| 65 | Ga0070663_100443295 | 3300005455 | Bacteria | 1069 |
| 66 | Ga0070678_100002100 | 3300005456 | Bacteria | 10797 |
| 67 | Ga0070678_100022084 | 3300005456 | Bacteria | 4207 |
| 68 | Ga0070662_100004648 | 3300005457 | Bacteria | 8704 |
| 69 | Ga0070662_100052867 | 3300005457 | Bacteria | 2939 |
| 70 | Ga0070681_10005530 | 3300005458 | Bacteria | 12207 |
| 71 | Ga0070681_10018249 | 3300005458 | Bacteria | 7011 |
| 72 | Ga0070681_10029669 | 3300005458 | Bacteria | 5492 |
| 73 | Ga0070681_10070630 | 3300005458 | Bacteria | 3457 |
| 74 | Ga0068867_100014933 | 3300005459 | Bacteria | 5504 |
| 75 | Ga0068867_100021027 | 3300005459 | Bacteria | 4654 |
| 76 | Ga0068867_100311953 | 3300005459 | Bacteria | 1300 |
| 77 | Ga0068867_100445988 | 3300005459 | Bacteria | 1101 |
| 78 | Ga0070685_10017784 | 3300005466 | Bacteria | 3812 |
| 79 | Ga0070706_100014985 | 3300005467 | Bacteria | 7159 |
| 80 | Ga0070679_100005476 | 3300005530 | Bacteria | 11765 |
| 81 | Ga0070679_100007684 | 3300005530 | Bacteria | 10093 |
| 82 | Ga0070684_100064261 | 3300005535 | Bacteria | 3219 |
| 83 | Ga0068853_100008821 | 3300005539 | Bacteria | 8111 |
| 84 | Ga0068853_100103116 | 3300005539 | Bacteria | 2525 |
| 85 | Ga0068853_100256528 | 3300005539 | Unclassified | 1606 |
| 86 | Ga0068853_100274428 | 3300005539 | Bacteria | 1553 |
| 87 | Ga0070672_100013465 | 3300005543 | Bacteria | 5778 |
| 88 | Ga0070672_100022403 | 3300005543 | Bacteria | 4640 |
| 89 | Ga0070672_100032039 | 3300005543 | Bacteria | 3964 |
| 90 | Ga0070695_100176885 | 3300005545 | Bacteria | 1509 |
| 91 | Ga0070696_100057091 | 3300005546 | Bacteria | 2724 |
| 92 | Ga0070693_100005410 | 3300005547 | Bacteria | 6128 |
| 93 | Ga0070693_100186467 | 3300005547 | Bacteria | 1339 |
| 94 | Ga0070693_100235607 | 3300005547 | Bacteria | 1206 |
| 95 | Ga0070665_100010396 | 3300005548 | Bacteria | 9417 |
| 96 | Ga0070665_100041284 | 3300005548 | Bacteria | 4636 |
| 97 | Ga0070665_100042267 | 3300005548 | Bacteria | 4581 |
| 98 | Ga0070665_100200341 | 3300005548 | Bacteria | 1997 |
| 99 | Ga0068855_100004108 | 3300005563 | Bacteria | 17755 |
| 100 | Ga0068855_100208901 | 3300005563 | Bacteria | 2195 |
| 101 | Ga0068855_100315796 | 3300005563 | Bacteria | 1728 |
| 102 | Ga0068855_100364463 | 3300005563 | Bacteria | 1590 |
| 103 | Ga0070664_100040966 | 3300005564 | Bacteria | 3907 |
| 104 | Ga0068857_100091346 | 3300005577 | Bacteria | 2725 |
| 105 | Ga0068857_100276086 | 3300005577 | Bacteria | 1545 |
| 106 | Ga0068857_100523979 | 3300005577 | Bacteria | 1114 |
| 107 | Ga0068854_100000716 | 3300005578 | Bacteria | 19611 |
| 108 | Ga0068854_100069295 | 3300005578 | Bacteria | 2574 |
| 109 | Ga0068856_100305414 | 3300005614 | Bacteria | 1609 |
| 110 | Ga0068852_100001050 | 3300005616 | Bacteria | 18205 |
| 111 | Ga0068852_100099559 | 3300005616 | Bacteria | 2621 |
| 112 | Ga0068852_100260633 | 3300005616 | Bacteria | 1664 |
| 113 | Ga0068852_100263024 | 3300005616 | Bacteria | 1657 |
| 114 | Ga0068859_100035543 | 3300005617 | Bacteria | 4999 |
| 115 | Ga0068859_100359001 | 3300005617 | Bacteria | 1552 |
| 116 | Ga0068864_100008010 | 3300005618 | Bacteria | 8715 |
| 117 | Ga0068864_100029046 | 3300005618 | Bacteria | 4678 |
| 118 | Ga0068864_100035731 | 3300005618 | Bacteria | 4232 |
| 119 | Ga0068861_100095561 | 3300005719 | Bacteria | 2354 |
| 120 | Ga0068861_100375807 | 3300005719 | Bacteria | 1254 |
| 121 | Ga0068851_10005262 | 3300005834 | Bacteria | 5871 |
| 122 | Ga0068863_100035451 | 3300005841 | Bacteria | 4752 |
| 123 | Ga0068863_100122784 | 3300005841 | Bacteria | 2477 |
| 124 | Ga0068863_100131425 | 3300005841 | Bacteria | 2390 |
| 125 | Ga0068863_100276939 | 3300005841 | Bacteria | 1625 |
| 126 | Ga0068863_100508481 | 3300005841 | Bacteria | 1187 |
| 127 | Ga0068858_100019547 | 3300005842 | Bacteria | 6334 |
| 128 | Ga0068858_100020972 | 3300005842 | Bacteria | 6105 |
| 129 | Ga0068858_100390730 | 3300005842 | Bacteria | 1336 |
| 130 | Ga0068860_100019229 | 3300005843 | Bacteria | 6630 |
| 131 | Ga0068860_100069985 | 3300005843 | Bacteria | 3335 |
| 132 | Ga0068860_100125266 | 3300005843 | Bacteria | 2462 |
| 133 | Ga0068860_100305408 | 3300005843 | Bacteria | 1559 |
| 134 | Ga0068862_100050623 | 3300005844 | Bacteria | 3550 |
| 135 | Ga0068862_100106588 | 3300005844 | Bacteria | 2457 |
| 136 | Ga0068862_100111830 | 3300005844 | Bacteria | 2398 |
| 137 | Ga0081539_10062434 | 3300005985 | Bacteria | 2036 |
| 138 | Ga0075363_100007676 | 3300006048 | Bacteria | 4976 |
| 139 | Ga0075363_100070506 | 3300006048 | Bacteria | 1898 |
| 140 | Ga0070712_100082817 | 3300006175 | Bacteria | 2328 |
| 141 | Ga0075362_10053736 | 3300006177 | Bacteria | 1809 |
| 142 | Ga0075366_10009938 | 3300006195 | Bacteria | 5327 |
| 143 | Ga0097621_100001917 | 3300006237 | Bacteria | 14212 |
| 144 | Ga0097621_100005613 | 3300006237 | Bacteria | 8850 |
| 145 | Ga0097621_100062821 | 3300006237 | Bacteria | 3050 |
| 146 | Ga0068871_100000538 | 3300006358 | Bacteria | 25810 |
| 147 | Ga0068871_100051100 | 3300006358 | Bacteria | 3346 |
| 148 | Ga0068871_100204962 | 3300006358 | Unclassified | 1704 |
| 149 | Ga0068871_100388749 | 3300006358 | Bacteria | 1240 |
| 150 | Ga0075433_10251481 | 3300006852 | Bacteria | 1568 |
| 151 | Ga0075434_100138215 | 3300006871 | Bacteria | 2456 |
| 152 | Ga0068865_100010898 | 3300006881 | Bacteria | 5672 |
| 153 | Ga0068865_100028779 | 3300006881 | Bacteria | 3680 |
| 154 | Ga0075436_100014027 | 3300006914 | Bacteria | 5484 |
| 155 | Ga0075436_100418564 | 3300006914 | Bacteria | 972 |
| 156 | Ga0097620_100035547 | 3300006931 | Bacteria | 4999 |
| 157 | Ga0097620_100359021 | 3300006931 | Bacteria | 1552 |
| 158 | Ga0079104_1006836 | 3300006946 | Bacteria | 4228 |
| 159 | Ga0075435_100053501 | 3300007076 | Bacteria | 3256 |
| 160 | Ga0105244_10054494 | 3300009036 | Bacteria | 2028 |
| 161 | Ga0105240_10708133 | 3300009093 | Bacteria | 1098 |
| 162 | Ga0105240_10708135 | 3300009093 | Bacteria | 1098 |
| 163 | Ga0105245_10018056 | 3300009098 | Bacteria | 6163 |
| 164 | Ga0105245_10056864 | 3300009098 | Bacteria | 3517 |
| 165 | Ga0105245_10382112 | 3300009098 | Bacteria | 1403 |
| 166 | Ga0105245_10630202 | 3300009098 | Bacteria | 1101 |
| 167 | Ga0105243_10050213 | 3300009148 | Bacteria | 3294 |
| 168 | Ga0105243_10077065 | 3300009148 | Bacteria | 2711 |
| 169 | Ga0105243_10086933 | 3300009148 | Bacteria | 2565 |
| 170 | Ga0105241_10114475 | 3300009174 | Bacteria | 2163 |
| 171 | Ga0105241_10149275 | 3300009174 | Bacteria | 1911 |
| 172 | Ga0105241_10318323 | 3300009174 | Bacteria | 1341 |
| 173 | Ga0105242_10060271 | 3300009176 | Bacteria | 3117 |
| 174 | Ga0105237_10016005 | 3300009545 | Bacteria | 7799 |
| 175 | Ga0105237_10078196 | 3300009545 | Bacteria | 3298 |
| 176 | Ga0105238_10000037 | 3300009551 | Bacteria | 163954 |
| 177 | Ga0105238_10518786 | 3300009551 | Bacteria | 1194 |
| 178 | Ga0105249_10029150 | 3300009553 | Bacteria | 4984 |
| 179 | Ga0105249_10099999 | 3300009553 | Bacteria | 2726 |
| 180 | Ga0105249_10473196 | 3300009553 | Bacteria | 1295 |
| 181 | Ga0105239_10003694 | 3300010375 | Bacteria | 18647 |
| 182 | Ga0105246_10159816 | 3300011119 | Bacteria | 1715 |
| 183 | Ga0157373_10024975 | 3300013100 | Bacteria | 4326 |
| 184 | Ga0157373_10132676 | 3300013100 | Bacteria | 1751 |
| 185 | Ga0157370_10010855 | 3300013104 | Bacteria | 9566 |
| 186 | Ga0157369_10437601 | 3300013105 | Bacteria | 1355 |
| 187 | Ga0157374_10002909 | 3300013296 | Bacteria | 14341 |
| 188 | Ga0157374_10037000 | 3300013296 | Bacteria | 4475 |
| 189 | Ga0157374_10051813 | 3300013296 | Bacteria | 3820 |
| 190 | Ga0157378_10001459 | 3300013297 | Bacteria | 21320 |
| 191 | Ga0157378_10044438 | 3300013297 | Bacteria | 3945 |
| 192 | Ga0157378_10413229 | 3300013297 | Unclassified | 1332 |
| 193 | Ga0163162_10174597 | 3300013306 | Bacteria | 2274 |
| 194 | Ga0163162_10183383 | 3300013306 | Bacteria | 2219 |
| 195 | Ga0163162_10455547 | 3300013306 | Bacteria | 1411 |
| 196 | Ga0157372_10115336 | 3300013307 | Bacteria | 3080 |
| 197 | Ga0157372_10329778 | 3300013307 | Bacteria | 1777 |
| 198 | Ga0157375_10021885 | 3300013308 | Bacteria | 5876 |
| 199 | Ga0157375_10207285 | 3300013308 | Bacteria | 2117 |
| 200 | Ga0157375_10317574 | 3300013308 | Bacteria | 1722 |
| 201 | Ga0157375_10363863 | 3300013308 | Unclassified | 1613 |
| 202 | Ga0163163_10173820 | 3300014325 | Bacteria | 2200 |
| 203 | Ga0163163_10651472 | 3300014325 | Bacteria | 1117 |
| 204 | Ga0157380_10078157 | 3300014326 | Bacteria | 2698 |
| 205 | Ga0182008_10001806 | 3300014497 | Bacteria | 13972 |
| 206 | Ga0182008_10112366 | 3300014497 | Bacteria | 1350 |
| 207 | Ga0157377_10532896 | 3300014745 | Bacteria | 826 |
| 208 | Ga0157379_10016632 | 3300014968 | Bacteria | 6468 |
| 209 | Ga0157376_10039601 | 3300014969 | Bacteria | 3845 |
| 210 | Ga0157376_10140549 | 3300014969 | Bacteria | 2165 |
| 211 | Ga0182006_1013171 | 3300015261 | Bacteria | 3594 |
| 212 | Ga0163161_10090431 | 3300017792 | Bacteria | 2265 |
| 213 | Ga0163161_10154696 | 3300017792 | Unclassified | 1745 |
| 214 | Ga0163161_10174532 | 3300017792 | Bacteria | 1645 |
| 215 | Ga0163161_10187366 | 3300017792 | Bacteria | 1589 |
| 216 | Ga0163161_10521370 | 3300017792 | Bacteria | 970 |
| 217 | Ga0213872_10002128 | 3300021361 | Bacteria | 11902 |
| 218 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 219 | Ga0209566_100039 | 3300025225 | Bacteria | 303368 |
| 220 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 221 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 222 | Ga0209258_100072 | 3300025242 | Bacteria | 274355 |
| 223 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 224 | Ga0209677_102144 | 3300025253 | Bacteria | 7722 |
| 225 | Ga0209148_1007931 | 3300025254 | Bacteria | 2167 |
| 226 | Ga0209759_1001427 | 3300025256 | Bacteria | 13561 |
| 227 | Ga0209455_1000053 | 3300025272 | Bacteria | 365949 |
| 228 | Ga0209051_1007486 | 3300025303 | Bacteria | 5959 |
| 229 | Ga0207656_10005860 | 3300025321 | Bacteria | 4379 |
| 230 | Ga0207682_10025296 | 3300025893 | Bacteria | 2354 |
| 231 | Ga0207688_10050323 | 3300025901 | Bacteria | 2332 |
| 232 | Ga0207645_10000283 | 3300025907 | Bacteria | 42259 |
| 233 | Ga0207645_10028682 | 3300025907 | Bacteria | 3592 |
| 234 | Ga0207645_10178984 | 3300025907 | Bacteria | 1391 |
| 235 | Ga0207643_10008729 | 3300025908 | Bacteria | 5437 |
| 236 | Ga0207684_10011988 | 3300025910 | Bacteria | 7549 |
| 237 | Ga0207654_10097941 | 3300025911 | Bacteria | 1801 |
| 238 | Ga0207707_10004312 | 3300025912 | Bacteria | 12593 |
| 239 | Ga0207707_10020642 | 3300025912 | Bacteria | 5754 |
| 240 | Ga0207707_10174920 | 3300025912 | Bacteria | 1875 |
| 241 | Ga0207695_10010922 | 3300025913 | Bacteria | 11045 |
| 242 | Ga0207671_10035886 | 3300025914 | Bacteria | 3676 |
| 243 | Ga0207657_10002121 | 3300025919 | Bacteria | 21468 |
| 244 | Ga0207649_10011463 | 3300025920 | Bacteria | 4889 |
| 245 | Ga0207652_10089317 | 3300025921 | Bacteria | 2706 |
| 246 | Ga0207646_10197327 | 3300025922 | Bacteria | 1817 |
| 247 | Ga0207681_10082324 | 3300025923 | Bacteria | 2275 |
| 248 | Ga0207681_10306512 | 3300025923 | Bacteria | 1258 |
| 249 | Ga0207694_10000054 | 3300025924 | Bacteria | 152124 |
| 250 | Ga0207650_10001040 | 3300025925 | Bacteria | 20814 |
| 251 | Ga0207650_10383206 | 3300025925 | Bacteria | 1161 |
| 252 | Ga0207659_10018683 | 3300025926 | Bacteria | 4548 |
| 253 | Ga0207687_10303146 | 3300025927 | Bacteria | 1287 |
| 254 | Ga0207687_10479923 | 3300025927 | Bacteria | 1035 |
| 255 | Ga0207700_10000023 | 3300025928 | Bacteria | 152285 |
| 256 | Ga0207644_10000402 | 3300025931 | Bacteria | 28200 |
| 257 | Ga0207690_10001407 | 3300025932 | Bacteria | 15134 |
| 258 | Ga0207690_10082797 | 3300025932 | Bacteria | 2245 |
| 259 | Ga0207706_10002114 | 3300025933 | Bacteria | 19441 |
| 260 | Ga0207706_10059775 | 3300025933 | Bacteria | 3356 |
| 261 | Ga0207706_10446029 | 3300025933 | Bacteria | 1120 |
| 262 | Ga0207686_10239474 | 3300025934 | Bacteria | 1320 |
| 263 | Ga0207709_10250731 | 3300025935 | Bacteria | 1293 |
| 264 | Ga0207670_10069961 | 3300025936 | Bacteria | 2422 |
| 265 | Ga0207670_10187804 | 3300025936 | Bacteria | 1562 |
| 266 | Ga0207669_10012250 | 3300025937 | Bacteria | 4211 |
| 267 | Ga0207669_10176811 | 3300025937 | Bacteria | 1525 |
| 268 | Ga0207704_10003973 | 3300025938 | Bacteria | 6728 |
| 269 | Ga0207704_10102374 | 3300025938 | Bacteria | 1912 |
| 270 | Ga0207691_10000546 | 3300025940 | Bacteria | 37681 |
| 271 | Ga0207691_10001560 | 3300025940 | Bacteria | 22750 |
| 272 | Ga0207691_10012147 | 3300025940 | Bacteria | 8257 |
| 273 | Ga0207691_10604474 | 3300025940 | Bacteria | 928 |
| 274 | Ga0207711_10041752 | 3300025941 | Bacteria | 3907 |
| 275 | Ga0207689_10008822 | 3300025942 | Bacteria | 8763 |
| 276 | Ga0207689_10039270 | 3300025942 | Bacteria | 3919 |
| 277 | Ga0207661_10000756 | 3300025944 | Bacteria | 21025 |
| 278 | Ga0207679_10000697 | 3300025945 | Bacteria | 22447 |
| 279 | Ga0207679_10162609 | 3300025945 | Bacteria | 1829 |
| 280 | Ga0207679_10389051 | 3300025945 | Bacteria | 1224 |
| 281 | Ga0207667_10000043 | 3300025949 | Bacteria | 261426 |
| 282 | Ga0207667_10008425 | 3300025949 | Bacteria | 12250 |
| 283 | Ga0207651_10013718 | 3300025960 | Bacteria | 4649 |
| 284 | Ga0207651_10043941 | 3300025960 | Bacteria | 2986 |
| 285 | Ga0207651_10066681 | 3300025960 | Bacteria | 2530 |
| 286 | Ga0207651_10298268 | 3300025960 | Bacteria | 1339 |
| 287 | Ga0207712_10092850 | 3300025961 | Bacteria | 2226 |
| 288 | Ga0207712_10113339 | 3300025961 | Bacteria | 2038 |
| 289 | Ga0207668_10208204 | 3300025972 | Bacteria | 1562 |
| 290 | Ga0207640_10011266 | 3300025981 | Bacteria | 5059 |
| 291 | Ga0207658_10032442 | 3300025986 | Bacteria | 3717 |
| 292 | Ga0207658_10204014 | 3300025986 | Bacteria | 1652 |
| 293 | Ga0207658_10513676 | 3300025986 | Bacteria | 1068 |
| 294 | Ga0207677_10000512 | 3300026023 | Bacteria | 25019 |
| 295 | Ga0207677_10019482 | 3300026023 | Bacteria | 4098 |
| 296 | Ga0207703_10034843 | 3300026035 | Bacteria | 3997 |
| 297 | Ga0207703_10113406 | 3300026035 | Bacteria | 2317 |
| 298 | Ga0207703_10118946 | 3300026035 | Bacteria | 2266 |
| 299 | Ga0207639_10057686 | 3300026041 | Bacteria | 2983 |
| 300 | Ga0207639_10075230 | 3300026041 | Bacteria | 2655 |
| 301 | Ga0207639_10268137 | 3300026041 | Bacteria | 1496 |
| 302 | Ga0207639_10570450 | 3300026041 | Unclassified | 1041 |
| 303 | Ga0207678_10046959 | 3300026067 | Bacteria | 3735 |
| 304 | Ga0207678_10085878 | 3300026067 | Bacteria | 2690 |
| 305 | Ga0207678_10123933 | 3300026067 | Bacteria | 2205 |
| 306 | Ga0207678_10227405 | 3300026067 | Bacteria | 1597 |
| 307 | Ga0207708_10050914 | 3300026075 | Bacteria | 3153 |
| 308 | Ga0207708_10087305 | 3300026075 | Bacteria | 2401 |
| 309 | Ga0207641_10018054 | 3300026088 | Bacteria | 5781 |
| 310 | Ga0207641_10037656 | 3300026088 | Bacteria | 4041 |
| 311 | Ga0207641_10223972 | 3300026088 | Bacteria | 1745 |
| 312 | Ga0207641_10295824 | 3300026088 | Bacteria | 1527 |
| 313 | Ga0207641_10478364 | 3300026088 | Bacteria | 1207 |
| 314 | Ga0207648_10000564 | 3300026089 | Bacteria | 41549 |
| 315 | Ga0207648_10015018 | 3300026089 | Bacteria | 7133 |
| 316 | Ga0207648_10035837 | 3300026089 | Bacteria | 4371 |
| 317 | Ga0207648_10091830 | 3300026089 | Bacteria | 2654 |
| 318 | Ga0207648_10195079 | 3300026089 | Bacteria | 1795 |
| 319 | Ga0207648_10253815 | 3300026089 | Bacteria | 1568 |
| 320 | Ga0207648_10342563 | 3300026089 | Unclassified | 1346 |
| 321 | Ga0207676_10052190 | 3300026095 | Bacteria | 3195 |
| 322 | Ga0207674_10193450 | 3300026116 | Bacteria | 1984 |
| 323 | Ga0207674_10208649 | 3300026116 | Bacteria | 1903 |
| 324 | Ga0207674_10417981 | 3300026116 | Bacteria | 1296 |
| 325 | Ga0207675_100643818 | 3300026118 | Bacteria | 1066 |
| 326 | Ga0207683_10000424 | 3300026121 | Bacteria | 39012 |
| 327 | Ga0207683_10000548 | 3300026121 | Bacteria | 34736 |
| 328 | Ga0207683_10012009 | 3300026121 | Bacteria | 7394 |
| 329 | Ga0207683_10250098 | 3300026121 | Bacteria | 1618 |
| 330 | Ga0207698_10000476 | 3300026142 | Bacteria | 23298 |
| 331 | Ga0207698_10048588 | 3300026142 | Bacteria | 3222 |
| 332 | Ga0207698_10062962 | 3300026142 | Bacteria | 2900 |
| 333 | Ga0209179_1012211 | 3300027512 | Bacteria | 1539 |
| 334 | Ga0268266_10108027 | 3300028379 | Bacteria | 2461 |
| 335 | Ga0268266_10117154 | 3300028379 | Bacteria | 2367 |
| 336 | Ga0268266_10153902 | 3300028379 | Bacteria | 2075 |
| 337 | Ga0268266_10518578 | 3300028379 | Bacteria | 1139 |
| 338 | Ga0268265_10037481 | 3300028380 | Bacteria | 3560 |
| 339 | Ga0268265_10275831 | 3300028380 | Bacteria | 1502 |
| 340 | Ga0268265_10625524 | 3300028380 | Bacteria | 1032 |
| 341 | Ga0268264_11112301 | 3300028381 | Bacteria | 799 |
| 342 | Ga0265318_10004501 | 3300028577 | Bacteria | 6744 |
| 343 | Ga0265324_10008018 | 3300029957 | Bacteria | 4232 |
| 344 | Ga0316177_1085660 | 3300030731 | Bacteria | 2710 |
| 345 | Ga0316176_1044943 | 3300030732 | Bacteria | 5479 |
| 346 | Ga0314311_1181387 | 3300030733 | Bacteria | 8006 |
| 347 | Ga0316179_1050503 | 3300030734 | Bacteria | 1904 |
| 348 | Ga0316178_1075936 | 3300030735 | Bacteria | 5005 |
| 349 | Ga0316180_1013705 | 3300030736 | Bacteria | 2008 |
| 350 | Ga0316183_1046501 | 3300030742 | Bacteria | 6498 |
| 351 | Ga0316181_1019721 | 3300030744 | Bacteria | 5168 |
| 352 | Ga0265332_10000027 | 3300031238 | Bacteria | 190796 |
| 353 | Ga0265332_10000058 | 3300031238 | Bacteria | 102565 |
| 354 | Ga0265332_10006633 | 3300031238 | Bacteria | 5244 |
| 355 | Ga0265328_10001134 | 3300031239 | Bacteria | 12267 |
| 356 | Ga0265320_10058923 | 3300031240 | Bacteria | 1837 |
| 357 | Ga0265325_10111888 | 3300031241 | Bacteria | 1326 |
| 358 | Ga0265329_10005964 | 3300031242 | Bacteria | 4877 |
| 359 | Ga0265331_10001042 | 3300031250 | Bacteria | 21611 |
| 360 | Ga0265331_10129345 | 3300031250 | Bacteria | 1153 |
| 361 | Ga0265327_10093456 | 3300031251 | Bacteria | 1463 |
| 362 | Ga0265316_10022931 | 3300031344 | Bacteria | 5252 |
| 363 | Ga0265316_10154158 | 3300031344 | Bacteria | 1720 |
| 364 | Ga0307509_10000054 | 3300031507 | Bacteria | 163301 |
| 365 | Ga0265314_10000488 | 3300031711 | Bacteria | 51640 |
| 366 | Ga0265314_10030723 | 3300031711 | Bacteria | 3973 |
| 367 | Ga0265314_10033689 | 3300031711 | Bacteria | 3751 |
| 368 | Ga0265342_10016954 | 3300031712 | Bacteria | 4746 |
| 369 | Ga0307516_10136281 | 3300031730 | Bacteria | 2229 |
| 370 | Ga0307405_10100508 | 3300031731 | Bacteria | 1938 |
| 371 | Ga0307405_10284453 | 3300031731 | Bacteria | 1246 |
| 372 | Ga0307412_10206806 | 3300031911 | Bacteria | 1494 |
| 373 | Ga0307416_100109982 | 3300032002 | Bacteria | 2425 |
| 374 | Ga0316583_10098424 | 3300032133 | Bacteria | 1020 |
| 375 | Ga0373930_0055638 | 3300034816 | Bacteria | 873 |
| 376 | Ga0373934_0000524 | 3300035086 | Bacteria | 13506 |
| 377 | Ga0373923_0001446 | 3300035111 | Bacteria | 6812 |
| 378 | Ga0373954_0012566 | 3300035118 | Bacteria | 3766 |
| 379 | Ga0373954_0056931 | 3300035118 | Bacteria | 1841 |
| 380 | Ga0373956_0000135 | 3300035119 | Bacteria | 26321 |
| 381 | Ga0373956_0011618 | 3300035119 | Bacteria | 3630 |
| 382 | Ga0373957_0017749 | 3300035120 | Bacteria | 2484 |
| 383 | Ga0373946_0004173 | 3300035171 | Bacteria | 5148 |
| 384 | Ga0373955_0029049 | 3300035172 | Bacteria | 2872 |
| 385 | Ga0373933_0005320 | 3300035724 | Bacteria | 7015 |
| 386 | Ga0373933_0206802 | 3300035724 | Bacteria | 1257 |
| 387 | Ga0373933_0234681 | 3300035724 | Bacteria | 1179 |
| 388 | Ga0373933_0257344 | 3300035724 | Bacteria | 1125 |
| 389 | Ga0373937_0017569 | 3300036401 | Bacteria | 6375 |
| 390 | Ga0373937_0047907 | 3300036401 | Bacteria | 3910 |
| 391 | Ga0373937_0117711 | 3300036401 | Bacteria | 2475 |
| 392 | Ga0395900_0000050 | 3300037418 | Bacteria | 224616 |
| 393 | Ga0395900_0051406 | 3300037418 | Bacteria | 4245 |
| 394 | Ga0395900_0144169 | 3300037418 | Bacteria | 2437 |
| 395 | Ga0395898_0001856 | 3300037466 | Bacteria | 27096 |
| 396 | Ga0395901_0002440 | 3300038443 | Bacteria | 18848 |
| 397 | Ga0436361_0704696 | 3300039447 | Bacteria | 13555 |
| 398 | Ga0466969_0000169 | 3300044656 | Bacteria | 35088 |
| 399 | Ga0466969_0018822 | 3300044656 | Bacteria | 3594 |
| 400 | Ga0466972_0001750 | 3300044658 | Bacteria | 10659 |
| 401 | Ga0466965_0002178 | 3300044683 | Bacteria | 8245 |
| 402 | Ga0466965_0005843 | 3300044683 | Bacteria | 5553 |
| 403 | Ga0466965_0148890 | 3300044683 | Bacteria | 1223 |
| 404 | Ga0466966_0001013 | 3300044684 | Bacteria | 17899 |
| 405 | Ga0466966_0007854 | 3300044684 | Bacteria | 7059 |
| 406 | Ga0466966_0017912 | 3300044684 | Bacteria | 4677 |
| 407 | Ga0466961_0013769 | 3300044693 | Bacteria | 5183 |
| 408 | Ga0466963_0005987 | 3300044694 | Bacteria | 7165 |
| 409 | Ga0466964_0001613 | 3300044706 | Bacteria | 7783 |
| 410 | Ga0466964_0003452 | 3300044706 | Bacteria | 5766 |
| 411 | Ga0453684_0000716 | 3300044712 | Bacteria | 117287 |
| 412 | Ga0453684_0087252 | 3300044712 | Bacteria | 3868 |
| 413 | Ga0453684_0561752 | 3300044712 | Bacteria | 1256 |
| 414 | Ga0466971_0051300 | 3300044719 | Bacteria | 1856 |
| 415 | Ga0466970_0001919 | 3300044765 | Bacteria | 10053 |
| 416 | Ga0466970_0005112 | 3300044765 | Bacteria | 6478 |
| 417 | Ga0466970_0160131 | 3300044765 | Bacteria | 1245 |
| 418 | Ga0466957_0006987 | 3300044842 | Bacteria | 6380 |
| 419 | Ga0466957_0173928 | 3300044842 | Bacteria | 1403 |
| 420 | Ga0466957_0207433 | 3300044842 | Bacteria | 1289 |
| 421 | Ga0466959_0000027 | 3300045049 | Bacteria | 114262 |
| 422 | Ga0466959_0028132 | 3300045049 | Bacteria | 4169 |
| 423 | Ga0451576_0000239 | 3300045051 | Bacteria | 134323 |
| 424 | Ga0451576_0003419 | 3300045051 | Bacteria | 21835 |
| 425 | Ga0451576_0005794 | 3300045051 | Bacteria | 15361 |
| 426 | Ga0451576_0028374 | 3300045051 | Bacteria | 5996 |
| 427 | Ga0451576_0077112 | 3300045051 | Bacteria | 3468 |
| 428 | Ga0451576_0136797 | 3300045051 | Bacteria | 2555 |
| 429 | Ga0466958_0062516 | 3300045836 | Bacteria | 2270 |
| 430 | Ga0466967_0027792 | 3300045976 | Bacteria | 4710 |
| 431 | Ga0466967_0490917 | 3300045976 | Bacteria | 1204 |
| 432 | Ga0495592_0008918 | 3300046454 | Bacteria | 7532 |
| 433 | Ga0495592_0409397 | 3300046454 | Bacteria | 857 |
| 434 | Ga0495641_0003418 | 3300046461 | Bacteria | 11897 |
| 435 | Ga0495651_0000274 | 3300046462 | Bacteria | 40100 |
| 436 | Ga0495651_0001676 | 3300046462 | Bacteria | 17133 |
| 437 | Ga0495653_0005409 | 3300046463 | Bacteria | 10393 |
| 438 | Ga0495580_0009275 | 3300046472 | Bacteria | 7743 |
| 439 | Ga0495580_0029630 | 3300046472 | Bacteria | 3971 |
| 440 | Ga0495639_0005050 | 3300046475 | Bacteria | 5667 |
| 441 | Ga0495662_0003458 | 3300046476 | Bacteria | 7997 |
| 442 | Ga0495664_0010079 | 3300046477 | Bacteria | 5301 |
| 443 | Ga0495608_0007610 | 3300046511 | Bacteria | 7636 |
| 444 | Ga0495628_0036419 | 3300046516 | Bacteria | 3949 |
| 445 | Ga0495628_0043026 | 3300046516 | Bacteria | 3600 |
| 446 | Ga0495630_0010579 | 3300046517 | Bacteria | 6664 |
| 447 | Ga0495666_0038884 | 3300046526 | Bacteria | 2312 |
| 448 | Ga0495640_0005911 | 3300046533 | Bacteria | 9704 |
| 449 | Ga0495587_0002749 | 3300046536 | Bacteria | 11735 |
| 450 | Ga0495587_0125192 | 3300046536 | Bacteria | 1471 |
| 451 | Ga0495667_0007160 | 3300046559 | Bacteria | 7569 |
| 452 | Ga0495667_0244002 | 3300046559 | Bacteria | 1144 |
| 453 | Ga0495634_0004588 | 3300046642 | Bacteria | 10791 |
| 454 | Ga0495657_0029252 | 3300046675 | Bacteria | 3866 |
| 455 | Ga0495599_0003076 | 3300046678 | Bacteria | 9713 |
| 456 | Ga0495647_0005191 | 3300046681 | Bacteria | 4266 |
| 457 | Ga0495613_0008045 | 3300046689 | Bacteria | 7841 |
| 458 | Ga0495600_0001375 | 3300046809 | Bacteria | 13432 |
| 459 | Ga0495674_0005197 | 3300047319 | Bacteria | 12503 |
| 460 | Ga0495674_0419153 | 3300047319 | Bacteria | 1079 |
| 461 | Ga0495684_0004387 | 3300047471 | Bacteria | 11028 |
| 462 | Ga0496100_0040915 | 3300048903 | Bacteria | 2952 |
| 463 | Ga0496102_0200506 | 3300048905 | Bacteria | 1881 |
| 464 | Ga0496104_0143170 | 3300048907 | Bacteria | 2297 |
| 465 | Ga0496105_0247573 | 3300048908 | Bacteria | 1445 |
| 466 | Ga0496106_0183394 | 3300048909 | Bacteria | 1662 |
| 467 | Ga0496108_0018163 | 3300048911 | Bacteria | 5756 |
| 468 | Ga0496109_0018049 | 3300048912 | Bacteria | 6194 |
| 469 | Ga0496110_0002372 | 3300048913 | Bacteria | 14103 |
| 470 | Ga0496114_0011388 | 3300048917 | Bacteria | 7106 |
| 471 | Ga0496114_0055364 | 3300048917 | Bacteria | 3308 |
| 472 | Ga0496115_0164423 | 3300048918 | Unclassified | 1835 |
| 473 | Ga0496122_0000612 | 3300048925 | Bacteria | 73307 |
| 474 | Ga0496123_0000274 | 3300048926 | Bacteria | 101783 |
| 475 | Ga0496126_0030353 | 3300048929 | Bacteria | 5122 |
| 476 | Ga0501290_011354 | 3300049513 | Bacteria | 1146 |
| 477 | Ga0501031_0082893 | 3300049568 | Bacteria | 2090 |
| 478 | Ga0501032_0005458 | 3300049569 | Bacteria | 9438 |
| 479 | Ga0501033_0022882 | 3300049570 | Bacteria | 4711 |
| 480 | Ga0501036_0004087 | 3300049572 | Bacteria | 11744 |
| 481 | Ga0501037_0005227 | 3300049573 | Bacteria | 9438 |
| 482 | Ga0501038_0063645 | 3300049574 | Bacteria | 3148 |
| 483 | Ga0501038_0134816 | 3300049574 | Bacteria | 2024 |
| 484 | Ga0501039_0530700 | 3300049575 | Bacteria | 924 |
| 485 | Ga0501040_0006407 | 3300049576 | Bacteria | 7644 |
| 486 | Ga0501042_0002271 | 3300049578 | Bacteria | 11737 |
| 487 | Ga0501043_0000590 | 3300049579 | Bacteria | 32162 |
| 488 | Ga0501046_0003768 | 3300049580 | Bacteria | 13880 |
| 489 | Ga0501047_0004747 | 3300049581 | Bacteria | 12779 |
| 490 | Ga0501048_0062112 | 3300049582 | Bacteria | 2644 |
| 491 | Ga0501068_0001005 | 3300049584 | Bacteria | 14851 |
| 492 | Ga0501069_0160507 | 3300049585 | Bacteria | 1294 |
| 493 | Ga0501070_0137960 | 3300049586 | Unclassified | 2014 |
| 494 | Ga0501077_0290642 | 3300049593 | Bacteria | 1041 |
| 495 | Ga0501225_0007716 | 3300049705 | Bacteria | 3114 |
| 496 | Ga0501083_0021614 | 3300049744 | Bacteria | 4469 |
| 497 | Ga0501262_000513 | 3300049759 | Bacteria | 4596 |
| 498 | Ga0501035_0028798 | 3300049822 | Bacteria | 5068 |
| 499 | Ga0501035_0114899 | 3300049822 | Bacteria | 2357 |
| 500 | Ga0501035_0380529 | 3300049822 | Bacteria | 1177 |
| 501 | Ga0501044_0001129 | 3300049823 | Bacteria | 31721 |
| 502 | Ga0501045_0001357 | 3300049824 | Bacteria | 16252 |
| 503 | nmdc:mga03n38_78093_c1 | 3300050490 | Bacteria | 1549 |
| 504 | nmdc:mga0n895_465232_c1 | 3300050512 | Bacteria | 1276 |
| 505 | nmdc:mga0n895_90459_c1 | 3300050512 | Bacteria | 3062 |
| 506 | nmdc:mga0rr50_53542_c1 | 3300050513 | Bacteria | 3002 |
| 507 | nmdc:mga08x19_386221_c1 | 3300050514 | Bacteria | 981 |
| 508 | nmdc:mga0a205_304774_c1 | 3300050515 | Bacteria | 1465 |
| 509 | nmdc:mga0a205_477478_c1 | 3300050515 | Bacteria | 1105 |
| 510 | Ga0495601_0033932 | 3300053077 | Bacteria | 3180 |
| 511 | Ga0495601_0185700 | 3300053077 | Bacteria | 1359 |
| 512 | Ga0500635_0000030 | 3300053080 | Bacteria | 99936 |
| 513 | Ga0495595_0000266 | 3300053084 | Bacteria | 20675 |
| 514 | Ga0495619_0127635 | 3300053085 | Bacteria | 1746 |
| 515 | Ga0495619_0238195 | 3300053085 | Bacteria | 1261 |
| 516 | Ga0500594_0003939 | 3300053118 | Bacteria | 3270 |
| 517 | Ga0500608_009376 | 3300053122 | Bacteria | 4156 |
| 518 | Ga0500608_013000 | 3300053122 | Bacteria | 3676 |
| 519 | Ga0500608_084030 | 3300053122 | Bacteria | 1498 |
| 520 | Ga0500618_004506 | 3300053125 | Bacteria | 4421 |
| 521 | Ga0500636_0007280 | 3300053177 | Bacteria | 6397 |
| 522 | Ga0500661_025996 | 3300055283 | Bacteria | 1035 |
| 523 | Ga0466962_0002224 | 3300061719 | Bacteria | 9174 |
| 524 | Ga0466962_0149606 | 3300061719 | Bacteria | 1132 |
| 525 | 2548848690 | 2547132512 | Bacteria | 3416496 |
| 526 | 2511385829 | 2511231026 | Bacteria | 5225445 |
| 527 | 2521560056 | 2521172590 | Bacteria | 5047645 |
| 528 | 2526211228 | 2526164512 | Bacteria | 4025691 |
| 529 | 2553008074 | 2551306416 | Bacteria | 6152985 |
| 530 | 2644162180 | 2643221628 | Bacteria | 5745828 |
| 531 | 2687577755 | 2687453129 | Bacteria | 4387428 |
| 532 | 2765571235 | 2765235838 | Bacteria | 5445269 |
| 533 | 2808982598 | 2808606386 | Bacteria | 4471946 |
| 534 | 2809129575 | 2808606415 | Bacteria | 4576710 |
| 535 | 2809149370 | 2808606419 | Bacteria | 4576925 |
| 536 | 2819616419 | 2818991449 | Bacteria | 5518009 |
| 537 | 2839099076 | 2839094727 | Bacteria | 5534556 |
| 538 | 2842680603 | 2842677519 | Bacteria | 5615038 |
| 539 | 2842736397 | 2842733646 | Bacteria | 5716726 |
| 540 | 2842748905 | 2842747753 | Bacteria | 5578255 |
| 541 | 2852619512 | 2852618963 | Bacteria | 4577824 |
| 542 | 2887376234 | 2887375801 | Bacteria | 5334027 |
| 543 | 2904440910 | 2904439833 | Bacteria | 5931679 |
| 544 | 2904535512 | 2904530477 | Bacteria | 5876334 |
| 545 | 2904588347 | 2904584206 | Bacteria | 6028872 |
| 546 | 2904594765 | 2904589729 | Bacteria | 6113573 |
| 547 | 2904606028 | 2904601388 | Bacteria | 5884906 |
| 548 | 2919049077 | 2919046199 | Bacteria | 5567169 |
| 549 | 2919084686 | 2919079590 | Bacteria | 5946433 |
| 550 | 2919462718 | 2919462493 | Bacteria | 5817112 |
| 551 | 2919691049 | 2919688452 | Bacteria | 4595932 |
| 552 | 2923513787 | 2923510766 | Bacteria | 5926163 |
| 553 | 2928134373 | 2928130867 | Bacteria | 5467269 |
| 554 | 2945949482 | 2945945610 | Bacteria | 5951079 |
| 555 | 2998345342 | 2998344455 | Bacteria | 4222996 |
| 556 | Ga0055538_1000038 | |||
| 557 | Ga0055539_1000049 | |||
| 558 | Ga0055539_1005610 | |||
| 559 | Ga0055533_1000060 | |||
| 560 | Ga0055525_1000068 | |||
| 561 | Ga0055535_1000047 | |||
| 562 | Ga0055529_1000148 | |||
| 563 | Ga0055536_1011467 | |||
| 564 | Ga0055528_1020900 | |||
| 565 | Ga0055541_1000036 | |||
| 566 | Ga0070676_10026650 | |||
| 567 | Ga0070690_100342450 | |||
| 568 | Ga0070670_100000692 | |||
| 569 | Ga0070670_100452656 | |||
| 570 | Ga0070677_10020340 | |||
| 571 | Ga0070677_10098276 | |||
| 572 | Ga0068869_100022148 | |||
| 573 | Ga0068869_100059334 | |||
| 574 | Ga0070666_10065800 | |||
| 575 | Ga0070666_10323979 | |||
| 576 | Ga0070666_10348516 | |||
| 577 | Ga0070680_100092214 | |||
| 578 | Ga0070682_100168922 | |||
| 579 | Ga0070682_100334393 | |||
| 580 | Ga0068868_100000253 | |||
| 581 | Ga0068868_100022363 | |||
| 582 | Ga0068868_100183040 | |||
| 583 | Ga0070689_100053463 | |||
| 584 | Ga0070661_100003077 | |||
| 585 | Ga0070661_100005695 | |||
| 586 | Ga0070668_100024873 | |||
| 587 | Ga0070668_100027833 | |||
| 588 | Ga0070668_100190949 | |||
| 589 | Ga0070669_100017587 | |||
| 590 | Ga0070675_100011075 | |||
| 591 | Ga0070675_100019750 | |||
| 592 | Ga0070675_100053283 | |||
| 593 | Ga0070675_100240066 | |||
| 594 | Ga0070675_100387732 | |||
| 595 | Ga0070671_100000871 | |||
| 596 | Ga0070671_100022343 | |||
| 597 | Ga0070671_100096043 | |||
| 598 | Ga0070674_100037267 | |||
| 599 | Ga0070674_100207880 | |||
| 600 | Ga0070673_100006599 | |||
| 601 | Ga0070673_100071166 | |||
| 602 | Ga0070673_100308744 | |||
| 603 | Ga0070659_100109127 | |||
| 604 | Ga0070659_100121847 | |||
| 605 | Ga0070659_100190309 | |||
| 606 | Ga0070659_100333909 | |||
| 607 | Ga0070667_100033484 | |||
| 608 | Ga0070667_100257730 | |||
| 609 | Ga0070667_100318068 | |||
| 610 | Ga0070667_100679181 | |||
| 611 | Ga0070713_100000035 | |||
| 612 | Ga0070701_10195939 | |||
| 613 | Ga0070711_100623062 | |||
| 614 | Ga0070700_100016055 | |||
| 615 | Ga0070694_100190210 | |||
| 616 | Ga0070708_100000226 | |||
| 617 | Ga0070708_100016414 | |||
| 618 | Ga0070708_100278700 | |||
| 619 | Ga0070663_100191148 | |||
| 620 | Ga0070663_100443295 | |||
| 621 | Ga0070678_100002100 | |||
| 622 | Ga0070678_100022084 | |||
| 623 | Ga0070662_100004648 | |||
| 624 | Ga0070662_100052867 | |||
| 625 | Ga0070681_10005530 | |||
| 626 | Ga0070681_10018249 | |||
| 627 | Ga0070681_10029669 | |||
| 628 | Ga0070681_10070630 | |||
| 629 | Ga0068867_100014933 | |||
| 630 | Ga0068867_100021027 | |||
| 631 | Ga0068867_100311953 | |||
| 632 | Ga0068867_100445988 | |||
| 633 | Ga0070685_10017784 | |||
| 634 | Ga0070706_100014985 | |||
| 635 | Ga0070679_100005476 | |||
| 636 | Ga0070679_100007684 | |||
| 637 | Ga0070684_100064261 | |||
| 638 | Ga0068853_100008821 | |||
| 639 | Ga0068853_100103116 | |||
| 640 | Ga0068853_100256528 | |||
| 641 | Ga0068853_100274428 | |||
| 642 | Ga0070672_100013465 | |||
| 643 | Ga0070672_100022403 | |||
| 644 | Ga0070672_100032039 | |||
| 645 | Ga0070695_100176885 | |||
| 646 | Ga0070696_100057091 | |||
| 647 | Ga0070693_100005410 | |||
| 648 | Ga0070693_100186467 | |||
| 649 | Ga0070693_100235607 | |||
| 650 | Ga0070665_100010396 | |||
| 651 | Ga0070665_100041284 | |||
| 652 | Ga0070665_100042267 | |||
| 653 | Ga0070665_100200341 | |||
| 654 | Ga0068855_100004108 | |||
| 655 | Ga0068855_100208901 | |||
| 656 | Ga0068855_100315796 | |||
| 657 | Ga0068855_100364463 | |||
| 658 | Ga0070664_100040966 | |||
| 659 | Ga0068857_100091346 | |||
| 660 | Ga0068857_100276086 | |||
| 661 | Ga0068857_100523979 | |||
| 662 | Ga0068854_100000716 | |||
| 663 | Ga0068854_100069295 | |||
| 664 | Ga0068856_100305414 | |||
| 665 | Ga0068852_100001050 | |||
| 666 | Ga0068852_100099559 | |||
| 667 | Ga0068852_100260633 | |||
| 668 | Ga0068852_100263024 | |||
| 669 | Ga0068859_100035543 | |||
| 670 | Ga0068859_100359001 | |||
| 671 | Ga0068864_100008010 | |||
| 672 | Ga0068864_100029046 | |||
| 673 | Ga0068864_100035731 | |||
| 674 | Ga0068861_100095561 | |||
| 675 | Ga0068861_100375807 | |||
| 676 | Ga0068851_10005262 | |||
| 677 | Ga0068863_100035451 | |||
| 678 | Ga0068863_100122784 | |||
| 679 | Ga0068863_100131425 | |||
| 680 | Ga0068863_100276939 | |||
| 681 | Ga0068863_100508481 | |||
| 682 | Ga0068858_100019547 | |||
| 683 | Ga0068858_100020972 | |||
| 684 | Ga0068858_100390730 | |||
| 685 | Ga0068860_100019229 | |||
| 686 | Ga0068860_100069985 | |||
| 687 | Ga0068860_100125266 | |||
| 688 | Ga0068860_100305408 | |||
| 689 | Ga0068862_100050623 | |||
| 690 | Ga0068862_100106588 | |||
| 691 | Ga0068862_100111830 | |||
| 692 | Ga0081539_10062434 | |||
| 693 | Ga0075363_100007676 | |||
| 694 | Ga0075363_100070506 | |||
| 695 | Ga0070712_100082817 | |||
| 696 | Ga0075362_10053736 | |||
| 697 | Ga0075366_10009938 | |||
| 698 | Ga0097621_100001917 | |||
| 699 | Ga0097621_100005613 | |||
| 700 | Ga0097621_100062821 | |||
| 701 | Ga0068871_100000538 | |||
| 702 | Ga0068871_100051100 | |||
| 703 | Ga0068871_100204962 | |||
| 704 | Ga0068871_100388749 | |||
| 705 | Ga0075433_10251481 | |||
| 706 | Ga0075434_100138215 | |||
| 707 | Ga0068865_100010898 | |||
| 708 | Ga0068865_100028779 | |||
| 709 | Ga0075436_100014027 | |||
| 710 | Ga0075436_100418564 | |||
| 711 | Ga0097620_100035547 | |||
| 712 | Ga0097620_100359021 | |||
| 713 | Ga0079104_1006836 | |||
| 714 | Ga0075435_100053501 | |||
| 715 | Ga0105244_10054494 | |||
| 716 | Ga0105240_10708133 | |||
| 717 | Ga0105240_10708135 | |||
| 718 | Ga0105245_10018056 | |||
| 719 | Ga0105245_10056864 | |||
| 720 | Ga0105245_10382112 | |||
| 721 | Ga0105245_10630202 | |||
| 722 | Ga0105243_10050213 | |||
| 723 | Ga0105243_10077065 | |||
| 724 | Ga0105243_10086933 | |||
| 725 | Ga0105241_10114475 | |||
| 726 | Ga0105241_10149275 | |||
| 727 | Ga0105241_10318323 | |||
| 728 | Ga0105242_10060271 | |||
| 729 | Ga0105237_10016005 | |||
| 730 | Ga0105237_10078196 | |||
| 731 | Ga0105238_10000037 | |||
| 732 | Ga0105238_10518786 | |||
| 733 | Ga0105249_10029150 | |||
| 734 | Ga0105249_10099999 | |||
| 735 | Ga0105249_10473196 | |||
| 736 | Ga0105239_10003694 | |||
| 737 | Ga0105246_10159816 | |||
| 738 | Ga0157373_10024975 | |||
| 739 | Ga0157373_10132676 | |||
| 740 | Ga0157370_10010855 | |||
| 741 | Ga0157369_10437601 | |||
| 742 | Ga0157374_10002909 | |||
| 743 | Ga0157374_10037000 | |||
| 744 | Ga0157374_10051813 | |||
| 745 | Ga0157378_10001459 | |||
| 746 | Ga0157378_10044438 | |||
| 747 | Ga0157378_10413229 | |||
| 748 | Ga0163162_10174597 | |||
| 749 | Ga0163162_10183383 | |||
| 750 | Ga0163162_10455547 | |||
| 751 | Ga0157372_10115336 | |||
| 752 | Ga0157372_10329778 | |||
| 753 | Ga0157375_10021885 | |||
| 754 | Ga0157375_10207285 | |||
| 755 | Ga0157375_10317574 | |||
| 756 | Ga0157375_10363863 | |||
| 757 | Ga0163163_10173820 | |||
| 758 | Ga0163163_10651472 | |||
| 759 | Ga0157380_10078157 | |||
| 760 | Ga0182008_10001806 | |||
| 761 | Ga0182008_10112366 | |||
| 762 | Ga0157377_10532896 | |||
| 763 | Ga0157379_10016632 | |||
| 764 | Ga0157376_10039601 | |||
| 765 | Ga0157376_10140549 | |||
| 766 | Ga0182006_1013171 | |||
| 767 | Ga0163161_10090431 | |||
| 768 | Ga0163161_10154696 | |||
| 769 | Ga0163161_10174532 | |||
| 770 | Ga0163161_10187366 | |||
| 771 | Ga0163161_10521370 | |||
| 772 | Ga0213872_10002128 | |||
| 773 | Ga0209784_100021 | |||
| 774 | Ga0209566_100039 | |||
| 775 | Ga0209674_100036 | |||
| 776 | Ga0209563_100040 | |||
| 777 | Ga0209258_100072 | |||
| 778 | Ga0209677_100023 | |||
| 779 | Ga0209677_102144 | |||
| 780 | Ga0209148_1007931 | |||
| 781 | Ga0209759_1001427 | |||
| 782 | Ga0209455_1000053 | |||
| 783 | Ga0209051_1007486 | |||
| 784 | Ga0207656_10005860 | |||
| 785 | Ga0207682_10025296 | |||
| 786 | Ga0207688_10050323 | |||
| 787 | Ga0207645_10000283 | |||
| 788 | Ga0207645_10028682 | |||
| 789 | Ga0207645_10178984 | |||
| 790 | Ga0207643_10008729 | |||
| 791 | Ga0207684_10011988 | |||
| 792 | Ga0207654_10097941 | |||
| 793 | Ga0207707_10004312 | |||
| 794 | Ga0207707_10020642 | |||
| 795 | Ga0207707_10174920 | |||
| 796 | Ga0207695_10010922 | |||
| 797 | Ga0207671_10035886 | |||
| 798 | Ga0207657_10002121 | |||
| 799 | Ga0207649_10011463 | |||
| 800 | Ga0207652_10089317 | |||
| 801 | Ga0207646_10197327 | |||
| 802 | Ga0207681_10082324 | |||
| 803 | Ga0207681_10306512 | |||
| 804 | Ga0207694_10000054 | |||
| 805 | Ga0207650_10001040 | |||
| 806 | Ga0207650_10383206 | |||
| 807 | Ga0207659_10018683 | |||
| 808 | Ga0207687_10303146 | |||
| 809 | Ga0207687_10479923 | |||
| 810 | Ga0207700_10000023 | |||
| 811 | Ga0207644_10000402 | |||
| 812 | Ga0207690_10001407 | |||
| 813 | Ga0207690_10082797 | |||
| 814 | Ga0207706_10002114 | |||
| 815 | Ga0207706_10059775 | |||
| 816 | Ga0207706_10446029 | |||
| 817 | Ga0207686_10239474 | |||
| 818 | Ga0207709_10250731 | |||
| 819 | Ga0207670_10069961 | |||
| 820 | Ga0207670_10187804 | |||
| 821 | Ga0207669_10012250 | |||
| 822 | Ga0207669_10176811 | |||
| 823 | Ga0207704_10003973 | |||
| 824 | Ga0207704_10102374 | |||
| 825 | Ga0207691_10000546 | |||
| 826 | Ga0207691_10001560 | |||
| 827 | Ga0207691_10012147 | |||
| 828 | Ga0207691_10604474 | |||
| 829 | Ga0207711_10041752 | |||
| 830 | Ga0207689_10008822 | |||
| 831 | Ga0207689_10039270 | |||
| 832 | Ga0207661_10000756 | |||
| 833 | Ga0207679_10000697 | |||
| 834 | Ga0207679_10162609 | |||
| 835 | Ga0207679_10389051 | |||
| 836 | Ga0207667_10000043 | |||
| 837 | Ga0207667_10008425 | |||
| 838 | Ga0207651_10013718 | |||
| 839 | Ga0207651_10043941 | |||
| 840 | Ga0207651_10066681 | |||
| 841 | Ga0207651_10298268 | |||
| 842 | Ga0207712_10092850 | |||
| 843 | Ga0207712_10113339 | |||
| 844 | Ga0207668_10208204 | |||
| 845 | Ga0207640_10011266 | |||
| 846 | Ga0207658_10032442 | |||
| 847 | Ga0207658_10204014 | |||
| 848 | Ga0207658_10513676 | |||
| 849 | Ga0207677_10000512 | |||
| 850 | Ga0207677_10019482 | |||
| 851 | Ga0207703_10034843 | |||
| 852 | Ga0207703_10113406 | |||
| 853 | Ga0207703_10118946 | |||
| 854 | Ga0207639_10057686 | |||
| 855 | Ga0207639_10075230 | |||
| 856 | Ga0207639_10268137 | |||
| 857 | Ga0207639_10570450 | |||
| 858 | Ga0207678_10046959 | |||
| 859 | Ga0207678_10085878 | |||
| 860 | Ga0207678_10123933 | |||
| 861 | Ga0207678_10227405 | |||
| 862 | Ga0207708_10050914 | |||
| 863 | Ga0207708_10087305 | |||
| 864 | Ga0207641_10018054 | |||
| 865 | Ga0207641_10037656 | |||
| 866 | Ga0207641_10223972 | |||
| 867 | Ga0207641_10295824 | |||
| 868 | Ga0207641_10478364 | |||
| 869 | Ga0207648_10000564 | |||
| 870 | Ga0207648_10015018 | |||
| 871 | Ga0207648_10035837 | |||
| 872 | Ga0207648_10091830 | |||
| 873 | Ga0207648_10195079 | |||
| 874 | Ga0207648_10253815 | |||
| 875 | Ga0207648_10342563 | |||
| 876 | Ga0207676_10052190 | |||
| 877 | Ga0207674_10193450 | |||
| 878 | Ga0207674_10208649 | |||
| 879 | Ga0207674_10417981 | |||
| 880 | Ga0207675_100643818 | |||
| 881 | Ga0207683_10000424 | |||
| 882 | Ga0207683_10000548 | |||
| 883 | Ga0207683_10012009 | |||
| 884 | Ga0207683_10250098 | |||
| 885 | Ga0207698_10000476 | |||
| 886 | Ga0207698_10048588 | |||
| 887 | Ga0207698_10062962 | |||
| 888 | Ga0209179_1012211 | |||
| 889 | Ga0268266_10108027 | |||
| 890 | Ga0268266_10117154 | |||
| 891 | Ga0268266_10153902 | |||
| 892 | Ga0268266_10518578 | |||
| 893 | Ga0268265_10037481 | |||
| 894 | Ga0268265_10275831 | |||
| 895 | Ga0268265_10625524 | |||
| 896 | Ga0268264_11112301 | |||
| 897 | Ga0265318_10004501 | |||
| 898 | Ga0265324_10008018 | |||
| 899 | Ga0316177_1085660 | |||
| 900 | Ga0316176_1044943 | |||
| 901 | Ga0314311_1181387 | |||
| 902 | Ga0316179_1050503 | |||
| 903 | Ga0316178_1075936 | |||
| 904 | Ga0316180_1013705 | |||
| 905 | Ga0316183_1046501 | |||
| 906 | Ga0316181_1019721 | |||
| 907 | Ga0265332_10000027 | |||
| 908 | Ga0265332_10000058 | |||
| 909 | Ga0265332_10006633 | |||
| 910 | Ga0265328_10001134 | |||
| 911 | Ga0265320_10058923 | |||
| 912 | Ga0265325_10111888 | |||
| 913 | Ga0265329_10005964 | |||
| 914 | Ga0265331_10001042 | |||
| 915 | Ga0265331_10129345 | |||
| 916 | Ga0265327_10093456 | |||
| 917 | Ga0265316_10022931 | |||
| 918 | Ga0265316_10154158 | |||
| 919 | Ga0307509_10000054 | |||
| 920 | Ga0265314_10000488 | |||
| 921 | Ga0265314_10030723 | |||
| 922 | Ga0265314_10033689 | |||
| 923 | Ga0265342_10016954 | |||
| 924 | Ga0307516_10136281 | |||
| 925 | Ga0307405_10100508 | |||
| 926 | Ga0307405_10284453 | |||
| 927 | Ga0307412_10206806 | |||
| 928 | Ga0307416_100109982 | |||
| 929 | Ga0316583_10098424 | |||
| 930 | Ga0373930_0055638 | |||
| 931 | Ga0373934_0000524 | |||
| 932 | Ga0373923_0001446 | |||
| 933 | Ga0373954_0012566 | |||
| 934 | Ga0373954_0056931 | |||
| 935 | Ga0373956_0000135 | |||
| 936 | Ga0373956_0011618 | |||
| 937 | Ga0373957_0017749 | |||
| 938 | Ga0373946_0004173 | |||
| 939 | Ga0373955_0029049 | |||
| 940 | Ga0373933_0005320 | |||
| 941 | Ga0373933_0206802 | |||
| 942 | Ga0373933_0234681 | |||
| 943 | Ga0373933_0257344 | |||
| 944 | Ga0373937_0017569 | |||
| 945 | Ga0373937_0047907 | |||
| 946 | Ga0373937_0117711 | |||
| 947 | Ga0395900_0000050 | |||
| 948 | Ga0395900_0051406 | |||
| 949 | Ga0395900_0144169 | |||
| 950 | Ga0395898_0001856 | |||
| 951 | Ga0395901_0002440 | |||
| 952 | Ga0436361_0704696 | |||
| 953 | Ga0466969_0000169 | |||
| 954 | Ga0466969_0018822 | |||
| 955 | Ga0466972_0001750 | |||
| 956 | Ga0466965_0002178 | |||
| 957 | Ga0466965_0005843 | |||
| 958 | Ga0466965_0148890 | |||
| 959 | Ga0466966_0001013 | |||
| 960 | Ga0466966_0007854 | |||
| 961 | Ga0466966_0017912 | |||
| 962 | Ga0466961_0013769 | |||
| 963 | Ga0466963_0005987 | |||
| 964 | Ga0466964_0001613 | |||
| 965 | Ga0466964_0003452 | |||
| 966 | Ga0453684_0000716 | |||
| 967 | Ga0453684_0087252 | |||
| 968 | Ga0453684_0561752 | |||
| 969 | Ga0466971_0051300 | |||
| 970 | Ga0466970_0001919 | |||
| 971 | Ga0466970_0005112 | |||
| 972 | Ga0466970_0160131 | |||
| 973 | Ga0466957_0006987 | |||
| 974 | Ga0466957_0173928 | |||
| 975 | Ga0466957_0207433 | |||
| 976 | Ga0466959_0000027 | |||
| 977 | Ga0466959_0028132 | |||
| 978 | Ga0451576_0000239 | |||
| 979 | Ga0451576_0003419 | |||
| 980 | Ga0451576_0005794 | |||
| 981 | Ga0451576_0028374 | |||
| 982 | Ga0451576_0077112 | |||
| 983 | Ga0451576_0136797 | |||
| 984 | Ga0466958_0062516 | |||
| 985 | Ga0466967_0027792 | |||
| 986 | Ga0466967_0490917 | |||
| 987 | Ga0495592_0008918 | |||
| 988 | Ga0495592_0409397 | |||
| 989 | Ga0495641_0003418 | |||
| 990 | Ga0495651_0000274 | |||
| 991 | Ga0495651_0001676 | |||
| 992 | Ga0495653_0005409 | |||
| 993 | Ga0495580_0009275 | |||
| 994 | Ga0495580_0029630 | |||
| 995 | Ga0495639_0005050 | |||
| 996 | Ga0495662_0003458 | |||
| 997 | Ga0495664_0010079 | |||
| 998 | Ga0495608_0007610 | |||
| 999 | Ga0495628_0036419 | |||
| 1000 | Ga0495628_0043026 | |||
| 1001 | Ga0495630_0010579 | |||
| 1002 | Ga0495666_0038884 | |||
| 1003 | Ga0495640_0005911 | |||
| 1004 | Ga0495587_0002749 | |||
| 1005 | Ga0495587_0125192 | |||
| 1006 | Ga0495667_0007160 | |||
| 1007 | Ga0495667_0244002 | |||
| 1008 | Ga0495634_0004588 | |||
| 1009 | Ga0495657_0029252 | |||
| 1010 | Ga0495599_0003076 | |||
| 1011 | Ga0495647_0005191 | |||
| 1012 | Ga0495613_0008045 | |||
| 1013 | Ga0495600_0001375 | |||
| 1014 | Ga0495674_0005197 | |||
| 1015 | Ga0495674_0419153 | |||
| 1016 | Ga0495684_0004387 | |||
| 1017 | Ga0496100_0040915 | |||
| 1018 | Ga0496102_0200506 | |||
| 1019 | Ga0496104_0143170 | |||
| 1020 | Ga0496105_0247573 | |||
| 1021 | Ga0496106_0183394 | |||
| 1022 | Ga0496108_0018163 | |||
| 1023 | Ga0496109_0018049 | |||
| 1024 | Ga0496110_0002372 | |||
| 1025 | Ga0496114_0011388 | |||
| 1026 | Ga0496114_0055364 | |||
| 1027 | Ga0496115_0164423 | |||
| 1028 | Ga0496122_0000612 | |||
| 1029 | Ga0496123_0000274 | |||
| 1030 | Ga0496126_0030353 | |||
| 1031 | Ga0501290_011354 | |||
| 1032 | Ga0501031_0082893 | |||
| 1033 | Ga0501032_0005458 | |||
| 1034 | Ga0501033_0022882 | |||
| 1035 | Ga0501036_0004087 | |||
| 1036 | Ga0501037_0005227 | |||
| 1037 | Ga0501038_0063645 | |||
| 1038 | Ga0501038_0134816 | |||
| 1039 | Ga0501039_0530700 | |||
| 1040 | Ga0501040_0006407 | |||
| 1041 | Ga0501042_0002271 | |||
| 1042 | Ga0501043_0000590 | |||
| 1043 | Ga0501046_0003768 | |||
| 1044 | Ga0501047_0004747 | |||
| 1045 | Ga0501048_0062112 | |||
| 1046 | Ga0501068_0001005 | |||
| 1047 | Ga0501069_0160507 | |||
| 1048 | Ga0501070_0137960 | |||
| 1049 | Ga0501077_0290642 | |||
| 1050 | Ga0501225_0007716 | |||
| 1051 | Ga0501083_0021614 | |||
| 1052 | Ga0501262_000513 | |||
| 1053 | Ga0501035_0028798 | |||
| 1054 | Ga0501035_0114899 | |||
| 1055 | Ga0501035_0380529 | |||
| 1056 | Ga0501044_0001129 | |||
| 1057 | Ga0501045_0001357 | |||
| 1058 | nmdc:mga03n38_78093_c1 | |||
| 1059 | nmdc:mga0n895_465232_c1 | |||
| 1060 | nmdc:mga0n895_90459_c1 | |||
| 1061 | nmdc:mga0rr50_53542_c1 | |||
| 1062 | nmdc:mga08x19_386221_c1 | |||
| 1063 | nmdc:mga0a205_304774_c1 | |||
| 1064 | nmdc:mga0a205_477478_c1 | |||
| 1065 | Ga0495601_0033932 | |||
| 1066 | Ga0495601_0185700 | |||
| 1067 | Ga0500635_0000030 | |||
| 1068 | Ga0495595_0000266 | |||
| 1069 | Ga0495619_0127635 | |||
| 1070 | Ga0495619_0238195 | |||
| 1071 | Ga0500594_0003939 | |||
| 1072 | Ga0500608_009376 | |||
| 1073 | Ga0500608_013000 | |||
| 1074 | Ga0500608_084030 | |||
| 1075 | Ga0500618_004506 | |||
| 1076 | Ga0500636_0007280 | |||
| 1077 | Ga0500661_025996 | |||
| 1078 | Ga0466962_0002224 | |||
| 1079 | Ga0466962_0149606 | |||
| 1080 | 2548848690 | |||
| 1081 | 2511385829 | |||
| 1082 | 2521560056 | |||
| 1083 | 2526211228 | |||
| 1084 | 2553008074 | |||
| 1085 | 2644162180 | |||
| 1086 | 2687577755 | |||
| 1087 | 2765571235 | |||
| 1088 | 2808982598 | |||
| 1089 | 2809129575 | |||
| 1090 | 2809149370 | |||
| 1091 | 2819616419 | |||
| 1092 | 2839099076 | |||
| 1093 | 2842680603 | |||
| 1094 | 2842736397 | |||
| 1095 | 2842748905 | |||
| 1096 | 2852619512 | |||
| 1097 | 2887376234 | |||
| 1098 | 2904440910 | |||
| 1099 | 2904535512 | |||
| 1100 | 2904588347 | |||
| 1101 | 2904594765 | |||
| 1102 | 2904606028 | |||
| 1103 | 2919049077 | |||
| 1104 | 2919084686 | |||
| 1105 | 2919462718 | |||
| 1106 | 2919691049 | |||
| 1107 | 2923513787 | |||
| 1108 | 2928134373 | |||
| 1109 | 2945949482 | |||
| 1110 | 2998345342 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4htt-assembly2.cif.gz_B | crystal structure of twin arginine translocase receptor- tatc in ddm | 0.8744 | 15 | 236 |
| 4hts-assembly1.cif.gz_A | crystal structure of twin arginine translocase receptor- tatc | 0.86 | 15 | 238 |
| 4htt-assembly2.cif.gz_B | crystal structure of twin arginine translocase receptor- tatc in ddm | 0.86 | 15 | 236 |
| 4hts-assembly1.cif.gz_A | crystal structure of twin arginine translocase receptor- tatc | 0.843 | 15 | 238 |
| 8gym-assembly1.cif.gz_an | cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 | 0.3432 | 91 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJV5_535_729_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.4667 | 59 | 242 | 1.20.1640.10 |
| af_P9WJV5_535_729_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.4479 | 59 | 242 | 1.20.1640.10 |
| af_A3KFU9_372_573_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.4202 | 34 | 242 | 1.20.1640.10 |
| af_P9WJT9_505_699_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.4187 | 59 | 242 | 1.20.1640.10 |
| af_P0AG90_434_612_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.4159 | 61 | 242 | 1.20.1640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521XTW2-F1-model_v4 | Sec-independent protein translocase protein TatC | 0.9783 | 9 | 243 |
GO:0009977
GO:0033281 GO:0043953 GO:0065002 |
| AF-A0A286EEL0-F1-model_v4 | Sec-independent protein translocase protein TatC | 0.9782 | 4 | 241 |
GO:0009977
GO:0033281 GO:0043953 GO:0065002 |
| AF-A0A2R4XM52-F1-model_v4 | Sec-independent protein translocase protein TatC | 0.978 | 1 | 238 |
GO:0009977
GO:0033281 GO:0043953 GO:0065002 |
| AF-A0A3A3FYA7-F1-model_v4 | Sec-independent protein translocase protein TatC | 0.9777 | 3 | 248 |
GO:0009977
GO:0033281 GO:0043953 GO:0065002 |
| AF-A0A7Y9LM31-F1-model_v4 | Sec-independent protein translocase protein TatC | 0.9729 | 8 | 242 |
GO:0009977
GO:0033281 GO:0043953 GO:0065002 |