F463178

General Info

Members Datasets Scaffolds Average Seq Length
556 235 1112 314

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10002916|JGI25406J46586_100029167
Length 350
Sequence MPRTPRVTIPADTNDVTLTVDRREIRLTNLRKLFWPERGITKGDLIQYYGDLAPVLLPHIADRAMVMKRYPHGAAGEFFFMKRAPEPRPKWIRTCEIDHGEENIINFPVIDDVPSLLWLINLGCIDLNQWYARCDDVDRPDYLHFDLDPGEGATFDQVRETALIVRDALETLGMKPLAKTSGSKGMHVYVPIVRGPEQKVVWTFAKALAVELASRHPKLMTSEYRVANRPKGRVLVDYNQNRWGSTLASIYSVRPRPLATVSTPVTWDEVAAGVRIEDFRLDNVRERIATVGDLWKPLLSARGRIDLNAFFSAGRRSDQARATSGSDKADPTRPAARRPASGPRRGRSRP

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 2.34
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 12.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002916 3300003203 Bacteria 8064
2 JGI25406J46586_10000465 3300003203 Bacteria 18917
3 Ga0065712_10088196 3300005290 Bacteria 2533
4 Ga0065715_10122464 3300005293 Bacteria 2204
5 Ga0065715_10159937 3300005293 Bacteria 1639
6 Ga0065707_10033284 3300005295 Bacteria 1418
7 Ga0070658_10014820 3300005327 Bacteria 6247
8 Ga0070683_100226953 3300005329 Bacteria 1775
9 Ga0070690_100108324 3300005330 Bacteria 1850
10 Ga0070670_100004018 3300005331 Bacteria 12279
11 Ga0070670_100023331 3300005331 Bacteria 5326
12 Ga0070670_100027449 3300005331 Bacteria 4897
13 Ga0070670_100032262 3300005331 Bacteria 4511
14 Ga0070670_100039674 3300005331 Bacteria 4048
15 Ga0070670_100125465 3300005331 Unclassified 2215
16 Ga0070670_100126280 3300005331 Bacteria 2208
17 Ga0070670_100353328 3300005331 Bacteria 1291
18 Ga0068869_100001962 3300005334 Bacteria 12329
19 Ga0068869_100339624 3300005334 Bacteria 1222
20 Ga0070680_100035854 3300005336 Bacteria 4006
21 Ga0070680_100070890 3300005336 Bacteria 2863
22 Ga0070680_100105144 3300005336 Bacteria 2347
23 Ga0070682_100109049 3300005337 Bacteria 1842
24 Ga0068868_100000316 3300005338 Bacteria 32452
25 Ga0068868_100282581 3300005338 Bacteria 1405
26 Ga0070660_100013950 3300005339 Bacteria 5781
27 Ga0070660_100168956 3300005339 Bacteria 1766
28 Ga0070689_100223358 3300005340 Unclassified 1546
29 Ga0070689_100514566 3300005340 Bacteria 1027
30 Ga0070661_100067498 3300005344 Bacteria 2628
31 Ga0070661_100109886 3300005344 Bacteria 2058
32 Ga0070668_100077444 3300005347 Bacteria 2599
33 Ga0070668_100156062 3300005347 Bacteria 1849
34 Ga0070669_100011002 3300005353 Bacteria 6422
35 Ga0070669_100075465 3300005353 Unclassified 2500
36 Ga0070669_100107640 3300005353 Bacteria 2112
37 Ga0070669_100115866 3300005353 Bacteria 2039
38 Ga0070669_100421102 3300005353 Bacteria 1096
39 Ga0070675_100000014 3300005354 Bacteria 206249
40 Ga0070675_100000442 3300005354 Bacteria 28196
41 Ga0070675_100012826 3300005354 Bacteria 6576
42 Ga0070675_100024303 3300005354 Bacteria 4852
43 Ga0070675_100110080 3300005354 Unclassified 2329
44 Ga0070675_100210376 3300005354 Bacteria 1690
45 Ga0070671_100001353 3300005355 Bacteria 18364
46 Ga0070671_100083507 3300005355 Bacteria 2671
47 Ga0070674_100074707 3300005356 Bacteria 2406
48 Ga0070673_100023165 3300005364 Bacteria 4534
49 Ga0070673_100051183 3300005364 Bacteria 3233
50 Ga0070673_100296623 3300005364 Bacteria 1422
51 Ga0070688_100006547 3300005365 Bacteria 6231
52 Ga0070659_100275925 3300005366 Bacteria 1398
53 Ga0070659_100282500 3300005366 Bacteria 1381
54 Ga0070714_100010499 3300005435 Bacteria 7320
55 Ga0070713_100059506 3300005436 Bacteria 3191
56 Ga0070713_100420674 3300005436 Bacteria 1251
57 Ga0070701_10020548 3300005438 Bacteria 3137
58 Ga0070701_10109268 3300005438 Bacteria 1543
59 Ga0070700_100003978 3300005441 Bacteria 7679
60 Ga0070700_100396207 3300005441 Unclassified 1037
61 Ga0070694_100007700 3300005444 Bacteria 6575
62 Ga0070694_100129977 3300005444 Bacteria 1818
63 Ga0070708_100117092 3300005445 Unclassified 2454
64 Ga0070708_100139222 3300005445 Unclassified 2250
65 Ga0070708_100283345 3300005445 Bacteria 1560
66 Ga0070678_100180355 3300005456 Bacteria 1728
67 Ga0070678_100352367 3300005456 Unclassified 1266
68 Ga0070662_100133236 3300005457 Bacteria 1919
69 Ga0070681_10046171 3300005458 Bacteria 4356
70 Ga0070681_10166650 3300005458 Bacteria 2126
71 Ga0068867_100042961 3300005459 Bacteria 3308
72 Ga0068867_100323069 3300005459 Bacteria 1279
73 Ga0070685_10064882 3300005466 Bacteria 2148
74 Ga0070706_100180037 3300005467 Unclassified 1973
75 Ga0070707_100037290 3300005468 Bacteria 4639
76 Ga0070707_100133904 3300005468 Bacteria 2411
77 Ga0070707_100179301 3300005468 Bacteria 2065
78 Ga0070707_100319821 3300005468 Bacteria 1508
79 Ga0070698_100001654 3300005471 Bacteria 24859
80 Ga0070698_100017547 3300005471 Bacteria 7543
81 Ga0070698_100106789 3300005471 Unclassified 2768
82 Ga0070698_100158772 3300005471 Bacteria 2206
83 Ga0070699_100000558 3300005518 Bacteria 35133
84 Ga0070699_100001909 3300005518 Bacteria 18820
85 Ga0070699_100091222 3300005518 Bacteria 2664
86 Ga0070699_100137944 3300005518 Bacteria 2152
87 Ga0070679_100004319 3300005530 Bacteria 13121
88 Ga0070679_100240080 3300005530 Bacteria 1770
89 Ga0070679_100298478 3300005530 Bacteria 1562
90 Ga0070684_100010485 3300005535 Bacteria 7343
91 Ga0070684_100109630 3300005535 Bacteria 2474
92 Ga0070697_100173822 3300005536 Bacteria 1824
93 Ga0070672_100005374 3300005543 Bacteria 8487
94 Ga0070686_100008329 3300005544 Bacteria 5805
95 Ga0070686_100077074 3300005544 Bacteria 2197
96 Ga0070686_100236057 3300005544 Bacteria 1329
97 Ga0070695_100008733 3300005545 Bacteria 6021
98 Ga0070695_100021399 3300005545 Bacteria 3956
99 Ga0070696_100015554 3300005546 Bacteria 5110
100 Ga0070696_100017843 3300005546 Bacteria 4792
101 Ga0070696_100076177 3300005546 Bacteria 2368
102 Ga0070665_100012904 3300005548 Bacteria 8415
103 Ga0070704_100041380 3300005549 Bacteria 3180
104 Ga0070704_100147270 3300005549 Bacteria 1847
105 Ga0068855_100051623 3300005563 Bacteria 4844
106 Ga0068855_100314599 3300005563 Bacteria 1732
107 Ga0070664_100008947 3300005564 Bacteria 8119
108 Ga0070664_100011086 3300005564 Bacteria 7309
109 Ga0070664_100027878 3300005564 Bacteria 4697
110 Ga0070664_100040581 3300005564 Unclassified 3925
111 Ga0070664_100080794 3300005564 Unclassified 2800
112 Ga0070664_100333324 3300005564 Unclassified 1377
113 Ga0068857_100011541 3300005577 Bacteria 7687
114 Ga0068854_100099806 3300005578 Bacteria 2175
115 Ga0068856_100466749 3300005614 Bacteria 1283
116 Ga0068859_100066715 3300005617 Bacteria 3634
117 Ga0068859_100434494 3300005617 Unclassified 1409
118 Ga0068859_100687154 3300005617 Bacteria 1114
119 Ga0068864_100002331 3300005618 Bacteria 15700
120 Ga0068864_100058206 3300005618 Bacteria 3339
121 Ga0068864_100085084 3300005618 Bacteria 2780
122 Ga0068866_10094484 3300005718 Bacteria 1636
123 Ga0068861_100004253 3300005719 Bacteria 9595
124 Ga0068861_100018977 3300005719 Bacteria 4905
125 Ga0068861_100200239 3300005719 Bacteria 1675
126 Ga0068870_10122642 3300005840 Bacteria 1499
127 Ga0068863_100002769 3300005841 Bacteria 17372
128 Ga0068858_100004497 3300005842 Bacteria 13660
129 Ga0068858_100010084 3300005842 Bacteria 8969
130 Ga0068858_100013709 3300005842 Bacteria 7650
131 Ga0068858_100033933 3300005842 Bacteria 4734
132 Ga0068858_100040363 3300005842 Bacteria 4328
133 Ga0068860_100015275 3300005843 Bacteria 7498
134 Ga0068860_100046193 3300005843 Bacteria 4152
135 Ga0068860_100228035 3300005843 Unclassified 1810
136 Ga0068862_100057358 3300005844 Bacteria 3340
137 Ga0068862_100114872 3300005844 Unclassified 2367
138 Ga0068862_100380435 3300005844 Bacteria 1316
139 Ga0081455_10098401 3300005937 Bacteria 2355
140 Ga0081538_10010658 3300005981 Bacteria 7522
141 Ga0081539_10000025 3300005985 Bacteria 340255
142 Ga0081539_10000134 3300005985 Bacteria 173625
143 Ga0081539_10004230 3300005985 Bacteria 16158
144 Ga0081539_10024851 3300005985 Bacteria 3873
145 Ga0070717_10000040 3300006028 Bacteria 113150
146 Ga0075366_10039191 3300006195 Bacteria 2801
147 Ga0097621_100008941 3300006237 Bacteria 7242
148 Ga0097621_100102308 3300006237 Bacteria 2412
149 Ga0097621_100191759 3300006237 Unclassified 1770
150 Ga0097621_100341933 3300006237 Unclassified 1329
151 Ga0068871_100009037 3300006358 Bacteria 7197
152 Ga0068871_100015159 3300006358 Bacteria 5762
153 Ga0068871_100173069 3300006358 Unclassified 1852
154 Ga0075428_100002473 3300006844 Bacteria 20060
155 Ga0075428_100214423 3300006844 Unclassified 2080
156 Ga0075430_100005588 3300006846 Bacteria 10624
157 Ga0075431_100008820 3300006847 Bacteria 10104
158 Ga0075431_100010853 3300006847 Bacteria 9164
159 Ga0075431_100020409 3300006847 Bacteria 6770
160 Ga0075431_100022802 3300006847 Bacteria 6399
161 Ga0075431_100230241 3300006847 Bacteria 1888
162 Ga0075433_10003019 3300006852 Bacteria 12931
163 Ga0075433_10013093 3300006852 Bacteria 6730
164 Ga0075433_10039808 3300006852 Bacteria 4066
165 Ga0075433_10042066 3300006852 Bacteria 3963
166 Ga0075433_10046150 3300006852 Bacteria 3788
167 Ga0075433_10084202 3300006852 Bacteria 2807
168 Ga0075433_10084907 3300006852 Bacteria 2795
169 Ga0075433_10131934 3300006852 Bacteria 2219
170 Ga0075433_10157323 3300006852 Bacteria 2022
171 Ga0075433_10186959 3300006852 Unclassified 1843
172 Ga0075433_10259195 3300006852 Bacteria 1542
173 Ga0075434_100000919 3300006871 Bacteria 23605
174 Ga0075434_100014285 3300006871 Bacteria 7588
175 Ga0075434_100020595 3300006871 Bacteria 6400
176 Ga0075434_100025674 3300006871 Bacteria 5765
177 Ga0075429_100003923 3300006880 Bacteria 12713
178 Ga0075429_100039817 3300006880 Bacteria 4090
179 Ga0068865_100056363 3300006881 Bacteria 2737
180 Ga0075436_100005042 3300006914 Bacteria 9082
181 Ga0075436_100008937 3300006914 Bacteria 6860
182 Ga0075436_100011065 3300006914 Bacteria 6190
183 Ga0097620_100066717 3300006931 Bacteria 3634
184 Ga0097620_100434566 3300006931 Unclassified 1409
185 Ga0097620_100447561 3300006931 Bacteria 1388
186 Ga0097620_100687134 3300006931 Bacteria 1114
187 Ga0075435_100000251 3300007076 Bacteria 33323
188 Ga0075435_100042735 3300007076 Unclassified 3626
189 Ga0075435_100078398 3300007076 Bacteria 2709
190 Ga0075435_100119707 3300007076 Bacteria 2196
191 Ga0075435_100153659 3300007076 Bacteria 1936
192 Ga0075435_100433924 3300007076 Bacteria 1132
193 Ga0105244_10009892 3300009036 Bacteria 5820
194 Ga0105240_10094500 3300009093 Bacteria 3646
195 Ga0105240_10170409 3300009093 Bacteria 2579
196 Ga0105240_10206776 3300009093 Bacteria 2297
197 Ga0111539_10005838 3300009094 Bacteria 15917
198 Ga0111539_10010233 3300009094 Bacteria 11819
199 Ga0111539_10015720 3300009094 Bacteria 9404
200 Ga0111539_10020569 3300009094 Bacteria 8128
201 Ga0111539_10201634 3300009094 Bacteria 2320
202 Ga0111539_10240386 3300009094 Bacteria 2108
203 Ga0111539_10250910 3300009094 Bacteria 2060
204 Ga0111539_10555561 3300009094 Bacteria 1337
205 Ga0105245_10000054 3300009098 Bacteria 124956
206 Ga0105245_10004601 3300009098 Bacteria 12182
207 Ga0105245_10037759 3300009098 Bacteria 4295
208 Ga0105247_10010498 3300009101 Bacteria 5598
209 Ga0105247_10130364 3300009101 Bacteria 1638
210 Ga0114129_10019030 3300009147 Bacteria 9782
211 Ga0114129_10020281 3300009147 Bacteria 9460
212 Ga0114129_10027398 3300009147 Bacteria 8067
213 Ga0114129_10049917 3300009147 Bacteria 5878
214 Ga0114129_10065650 3300009147 Bacteria 5064
215 Ga0114129_10086037 3300009147 Bacteria 4361
216 Ga0114129_10094906 3300009147 Bacteria 4131
217 Ga0114129_10161935 3300009147 Bacteria 3055
218 Ga0114129_10445769 3300009147 Unclassified 1698
219 Ga0114129_10557203 3300009147 Bacteria 1490
220 Ga0114129_10652720 3300009147 Bacteria 1358
221 Ga0114129_10753701 3300009147 Bacteria 1246
222 Ga0105243_10018202 3300009148 Bacteria 5320
223 Ga0105242_10013124 3300009176 Bacteria 6393
224 Ga0105242_10086074 3300009176 Bacteria 2637
225 Ga0105248_10009010 3300009177 Bacteria 10973
226 Ga0105248_10022346 3300009177 Bacteria 7016
227 Ga0105248_10304504 3300009177 Bacteria 1795
228 Ga0105238_10225385 3300009551 Bacteria 1851
229 Ga0105249_10289299 3300009553 Bacteria 1639
230 Ga0105249_10337539 3300009553 Unclassified 1523
231 Ga0105246_10098298 3300011119 Unclassified 2126
232 Ga0157373_10002140 3300013100 Bacteria 14945
233 Ga0157373_10169251 3300013100 Bacteria 1537
234 Ga0157371_10012168 3300013102 Bacteria 6590
235 Ga0157371_10210397 3300013102 Unclassified 1395
236 Ga0157370_10385186 3300013104 Unclassified 1291
237 Ga0157369_10036158 3300013105 Bacteria 5413
238 Ga0157369_10236465 3300013105 Bacteria 1909
239 Ga0157374_10000008 3300013296 Bacteria 588863
240 Ga0157374_10029262 3300013296 Bacteria 4985
241 Ga0163162_10012851 3300013306 Bacteria 8179
242 Ga0163162_10174710 3300013306 Bacteria 2273
243 Ga0157372_10002924 3300013307 Bacteria 18442
244 Ga0157372_10161841 3300013307 Unclassified 2587
245 Ga0157372_10357771 3300013307 Bacteria 1701
246 Ga0157375_10165393 3300013308 Bacteria 2356
247 Ga0157375_10622632 3300013308 Bacteria 1237
248 Ga0163163_10023059 3300014325 Bacteria 5902
249 Ga0163163_10047055 3300014325 Bacteria 4239
250 Ga0163163_10148854 3300014325 Bacteria 2385
251 Ga0157380_10025095 3300014326 Bacteria 4518
252 Ga0157380_10177367 3300014326 Bacteria 1869
253 Ga0157377_10000007 3300014745 Bacteria 402005
254 Ga0157379_10007571 3300014968 Bacteria 9403
255 Ga0157379_10054975 3300014968 Unclassified 3557
256 Ga0157376_10000015 3300014969 Bacteria 275370
257 Ga0157376_10006057 3300014969 Bacteria 8505
258 Ga0157376_10037406 3300014969 Bacteria 3940
259 Ga0157376_10089781 3300014969 Bacteria 2658
260 Ga0213873_10000319 3300021358 Bacteria 8181
261 Ga0213876_10000008 3300021384 Bacteria 506740
262 Ga0213876_10019835 3300021384 Bacteria 3551
263 Ga0213876_10034837 3300021384 Bacteria 2655
264 Ga0213875_10000001 3300021388 Bacteria 2793540
265 Ga0207697_10038533 3300025315 Bacteria 1960
266 Ga0207682_10039731 3300025893 Unclassified 1914
267 Ga0207642_10002113 3300025899 Bacteria 6145
268 Ga0207710_10095767 3300025900 Bacteria 1395
269 Ga0207680_10011747 3300025903 Bacteria 4436
270 Ga0207680_10058975 3300025903 Bacteria 2329
271 Ga0207680_10159784 3300025903 Unclassified 1510
272 Ga0207645_10000374 3300025907 Bacteria 37092
273 Ga0207643_10028262 3300025908 Bacteria 3114
274 Ga0207643_10067335 3300025908 Bacteria 2055
275 Ga0207705_10002864 3300025909 Bacteria 13206
276 Ga0207705_10088631 3300025909 Bacteria 2263
277 Ga0207707_10192742 3300025912 Bacteria 1778
278 Ga0207707_10259421 3300025912 Bacteria 1508
279 Ga0207695_10027295 3300025913 Bacteria 6360
280 Ga0207695_10179123 3300025913 Bacteria 2041
281 Ga0207695_10444224 3300025913 Bacteria 1180
282 Ga0207660_10027248 3300025917 Bacteria 3897
283 Ga0207660_10054085 3300025917 Bacteria 2864
284 Ga0207660_10065872 3300025917 Unclassified 2619
285 Ga0207660_10277117 3300025917 Bacteria 1330
286 Ga0207662_10022100 3300025918 Bacteria 3642
287 Ga0207662_10158220 3300025918 Bacteria 1446
288 Ga0207657_10000448 3300025919 Bacteria 43812
289 Ga0207657_10000873 3300025919 Bacteria 31812
290 Ga0207657_10169729 3300025919 Bacteria 1768
291 Ga0207652_10020863 3300025921 Bacteria 5400
292 Ga0207652_10241925 3300025921 Bacteria 1627
293 Ga0207646_10018292 3300025922 Bacteria 6539
294 Ga0207681_10012447 3300025923 Bacteria 5252
295 Ga0207681_10029978 3300025923 Bacteria 3542
296 Ga0207681_10069874 3300025923 Bacteria 2444
297 Ga0207681_10131096 3300025923 Bacteria 1854
298 Ga0207681_10145896 3300025923 Unclassified 1768
299 Ga0207694_10246865 3300025924 Bacteria 1460
300 Ga0207650_10014290 3300025925 Bacteria 5516
301 Ga0207650_10043805 3300025925 Unclassified 3287
302 Ga0207650_10051583 3300025925 Bacteria 3044
303 Ga0207650_10057554 3300025925 Bacteria 2891
304 Ga0207650_10304929 3300025925 Unclassified 1301
305 Ga0207659_10000001 3300025926 Bacteria 660958
306 Ga0207659_10000501 3300025926 Bacteria 23548
307 Ga0207659_10014754 3300025926 Bacteria 5049
308 Ga0207659_10077500 3300025926 Bacteria 2447
309 Ga0207659_10113831 3300025926 Unclassified 2061
310 Ga0207659_10162821 3300025926 Bacteria 1753
311 Ga0207659_10355764 3300025926 Unclassified 1216
312 Ga0207687_10000010 3300025927 Bacteria 403706
313 Ga0207687_10004950 3300025927 Bacteria 8839
314 Ga0207700_10046749 3300025928 Bacteria 3203
315 Ga0207644_10006198 3300025931 Bacteria 7799
316 Ga0207644_10065579 3300025931 Bacteria 2641
317 Ga0207686_10024941 3300025934 Bacteria 3471
318 Ga0207686_10368380 3300025934 Unclassified 1086
319 Ga0207670_10148264 3300025936 Unclassified 1738
320 Ga0207669_10066168 3300025937 Bacteria 2246
321 Ga0207704_10015711 3300025938 Bacteria 3867
322 Ga0207704_10159274 3300025938 Bacteria 1604
323 Ga0207665_10105315 3300025939 Unclassified 1975
324 Ga0207691_10095027 3300025940 Bacteria 2666
325 Ga0207691_10095422 3300025940 Bacteria 2660
326 Ga0207691_10122809 3300025940 Bacteria 2299
327 Ga0207691_10126960 3300025940 Bacteria 2256
328 Ga0207711_10007172 3300025941 Bacteria 9344
329 Ga0207711_10038864 3300025941 Bacteria 4046
330 Ga0207711_10059701 3300025941 Bacteria 3284
331 Ga0207711_10129876 3300025941 Bacteria 2258
332 Ga0207711_10218101 3300025941 Bacteria 1744
333 Ga0207711_10241390 3300025941 Unclassified 1657
334 Ga0207689_10004769 3300025942 Bacteria 12231
335 Ga0207689_10080630 3300025942 Bacteria 2675
336 Ga0207689_10356605 3300025942 Bacteria 1216
337 Ga0207661_10000002 3300025944 Bacteria 816104
338 Ga0207661_10073430 3300025944 Bacteria 2801
339 Ga0207661_10200358 3300025944 Bacteria 1755
340 Ga0207679_10002916 3300025945 Bacteria 10600
341 Ga0207679_10006997 3300025945 Bacteria 7152
342 Ga0207679_10064013 3300025945 Bacteria 2747
343 Ga0207667_10050413 3300025949 Bacteria 4392
344 Ga0207651_10026516 3300025960 Bacteria 3622
345 Ga0207651_10087177 3300025960 Unclassified 2271
346 Ga0207651_10114559 3300025960 Bacteria 2031
347 Ga0207668_10004761 3300025972 Bacteria 7988
348 Ga0207668_10045325 3300025972 Bacteria 2998
349 Ga0207640_10029343 3300025981 Bacteria 3376
350 Ga0207640_10085865 3300025981 Bacteria 2165
351 Ga0207640_10110825 3300025981 Bacteria 1945
352 Ga0207658_10098536 3300025986 Bacteria 2284
353 Ga0207677_10000535 3300026023 Bacteria 24000
354 Ga0207703_10031293 3300026035 Bacteria 4206
355 Ga0207703_10046889 3300026035 Bacteria 3483
356 Ga0207703_10054981 3300026035 Bacteria 3238
357 Ga0207703_10112311 3300026035 Bacteria 2327
358 Ga0207703_10122306 3300026035 Bacteria 2236
359 Ga0207703_10175370 3300026035 Bacteria 1889
360 Ga0207703_10250543 3300026035 Bacteria 1596
361 Ga0207703_10402376 3300026035 Bacteria 1271
362 Ga0207639_10000005 3300026041 Bacteria 579948
363 Ga0207708_10002808 3300026075 Bacteria 12801
364 Ga0207708_10009868 3300026075 Bacteria 7088
365 Ga0207708_10059624 3300026075 Bacteria 2913
366 Ga0207708_10070555 3300026075 Bacteria 2675
367 Ga0207708_10226378 3300026075 Bacteria 1500
368 Ga0207702_10343443 3300026078 Bacteria 1426
369 Ga0207641_10003428 3300026088 Bacteria 14048
370 Ga0207648_10006736 3300026089 Bacteria 11394
371 Ga0207648_10056961 3300026089 Bacteria 3410
372 Ga0207648_10156389 3300026089 Bacteria 2012
373 Ga0207648_10191629 3300026089 Bacteria 1812
374 Ga0207648_10338054 3300026089 Bacteria 1355
375 Ga0207676_10008856 3300026095 Bacteria 7161
376 Ga0207676_10127003 3300026095 Bacteria 2161
377 Ga0207676_10267293 3300026095 Bacteria 1547
378 Ga0207674_10018014 3300026116 Bacteria 7693
379 Ga0207675_100014564 3300026118 Bacteria 7329
380 Ga0207675_100128982 3300026118 Bacteria 2397
381 Ga0207683_10020448 3300026121 Bacteria 5661
382 Ga0207683_10220082 3300026121 Bacteria 1730
383 Ga0207698_10001196 3300026142 Bacteria 15119
384 Ga0209974_10022194 3300027876 Bacteria 2102
385 Ga0207428_10000089 3300027907 Bacteria 127333
386 Ga0207428_10002849 3300027907 Bacteria 17164
387 Ga0207428_10022376 3300027907 Bacteria 5336
388 Ga0207428_10023217 3300027907 Bacteria 5218
389 Ga0207428_10023335 3300027907 Bacteria 5204
390 Ga0268266_10006901 3300028379 Bacteria 10335
391 Ga0268266_10039596 3300028379 Bacteria 4015
392 Ga0268266_10462578 3300028379 Bacteria 1207
393 Ga0268265_10019678 3300028380 Bacteria 4699
394 Ga0268265_10038601 3300028380 Unclassified 3513
395 Ga0268265_10260340 3300028380 Bacteria 1542
396 Ga0268264_10047593 3300028381 Bacteria 3565
397 Ga0268264_10159132 3300028381 Bacteria 2032
398 Ga0268264_10181493 3300028381 Unclassified 1912
399 Ga0268264_10407985 3300028381 Bacteria 1307
400 Ga0265760_10000515 3300031090 Bacteria 10810
401 Ga0307408_100023919 3300031548 Bacteria 4165
402 Ga0307405_10000638 3300031731 Bacteria 13469
403 Ga0307413_10039569 3300031824 Bacteria 2743
404 Ga0307413_10075946 3300031824 Bacteria 2134
405 Ga0307410_10002043 3300031852 Bacteria 9530
406 Ga0307410_10029925 3300031852 Unclassified 3474
407 Ga0307410_10272175 3300031852 Bacteria 1325
408 Ga0307407_10009101 3300031903 Bacteria 4606
409 Ga0307407_10036200 3300031903 Unclassified 2718
410 Ga0307412_10026032 3300031911 Bacteria 3631
411 Ga0307412_10135888 3300031911 Bacteria 1794
412 Ga0307409_100044083 3300031995 Bacteria 3356
413 Ga0307409_100401857 3300031995 Unclassified 1309
414 Ga0307416_100003391 3300032002 Bacteria 9341
415 Ga0307416_100024534 3300032002 Bacteria 4404
416 Ga0307416_100037410 3300032002 Bacteria 3734
417 Ga0307416_100155991 3300032002 Unclassified 2102
418 Ga0307416_100178746 3300032002 Bacteria 1986
419 Ga0307414_10111079 3300032004 Bacteria 2087
420 Ga0307411_10024327 3300032005 Bacteria 3608
421 Ga0307411_10124511 3300032005 Unclassified 1872
422 Ga0307411_10208665 3300032005 Unclassified 1506
423 Ga0307415_100060572 3300032126 Bacteria 2616
424 Ga0307415_100112777 3300032126 Bacteria 2021
425 Ga0307415_100456128 3300032126 Bacteria 1106
426 Ga0307415_100512180 3300032126 Bacteria 1051
427 Ga0373940_0007577 3300035088 Bacteria 2454
428 Ga0373932_0037285 3300035112 Unclassified 1385
429 Ga0373941_0077808 3300035115 Bacteria 1114
430 Ga0373945_0130149 3300035116 Bacteria 1008
431 Ga0373935_0115940 3300035692 Bacteria 1784
432 Ga0373937_0002907 3300036401 Bacteria 14312
433 Ga0373937_0157234 3300036401 Bacteria 2131
434 Ga0373937_0437620 3300036401 Unclassified 1241
435 Ga0373937_0480746 3300036401 Bacteria 1180
436 Ga0436364_0273345 3300037853 Bacteria 2794207
437 Ga0436365_1080031 3300039437 Bacteria 28088
438 Ga0436365_1215398 3300039437 Bacteria 5449
439 Ga0436365_1280046 3300039437 Bacteria 1546
440 Ga0436363_0941283 3300039450 Bacteria 1352
441 Ga0436362_0165744 3300039453 Bacteria 16232
442 Ga0439433_0005046 3300041999 Bacteria 2832
443 Ga0439435_0001748 3300042436 Bacteria 4124
444 Ga0439435_0019471 3300042436 Bacteria 1740
445 Ga0439464_0019886 3300042439 Bacteria 1835
446 Ga0453683_0161898 3300044673 Bacteria 1416
447 Ga0453684_0044446 3300044712 Bacteria 5943
448 Ga0451576_0003034 3300045051 Bacteria 23689
449 Ga0451576_0013194 3300045051 Bacteria 9246
450 Ga0451576_0055479 3300045051 Bacteria 4145
451 Ga0451576_0059680 3300045051 Bacteria 3981
452 Ga0451576_0097826 3300045051 Unclassified 3052
453 Ga0466967_0025553 3300045976 Bacteria 4873
454 Ga0495603_0029292 3300046455 Bacteria 3320
455 Ga0495603_0071069 3300046455 Bacteria 2046
456 Ga0495603_0080026 3300046455 Bacteria 1915
457 Ga0495629_0118916 3300046459 Bacteria 1841
458 Ga0495580_0000035 3300046472 Bacteria 73832
459 Ga0495582_0211081 3300046473 Bacteria 1110
460 Ga0495594_0005780 3300046499 Bacteria 6352
461 Ga0495594_0069517 3300046499 Bacteria 1956
462 Ga0495618_0093025 3300046514 Bacteria 1928
463 Ga0495643_0009281 3300046522 Bacteria 6126
464 Ga0495640_0194102 3300046533 Unclassified 1290
465 Ga0495621_0025420 3300046539 Bacteria 1989
466 Ga0495659_0062976 3300046664 Unclassified 1374
467 Ga0495647_0113090 3300046681 Bacteria 1135
468 Ga0495658_0009981 3300046683 Bacteria 4738
469 Ga0495658_0059834 3300046683 Unclassified 2183
470 Ga0495670_0098171 3300046691 Bacteria 1506
471 Ga0495676_0005978 3300047321 Bacteria 11182
472 Ga0495602_0034474 3300048088 Bacteria 4735
473 Ga0496101_0163135 3300048904 Bacteria 1710
474 Ga0496102_0011305 3300048905 Bacteria 7690
475 Ga0496104_0021436 3300048907 Bacteria 5932
476 Ga0496104_0532303 3300048907 Bacteria 1086
477 Ga0496106_0102108 3300048909 Bacteria 2225
478 Ga0496108_0414305 3300048911 Bacteria 1177
479 Ga0496109_0502638 3300048912 Bacteria 1144
480 Ga0496112_0007050 3300048915 Bacteria 9928
481 Ga0496112_0119210 3300048915 Bacteria 2609
482 Ga0496113_0054180 3300048916 Unclassified 3001
483 Ga0496113_0361238 3300048916 Bacteria 1165
484 Ga0496114_0197061 3300048917 Bacteria 1763
485 Ga0496114_0275174 3300048917 Unclassified 1484
486 Ga0501048_0231775 3300049582 Bacteria 1310
487 Ga0501067_0022338 3300049583 Bacteria 3501
488 Ga0501068_0083192 3300049584 Bacteria 1967
489 Ga0501072_0121696 3300049588 Bacteria 2079
490 Ga0501074_0092074 3300049590 Bacteria 2171
491 Ga0501075_0050714 3300049591 Bacteria 3120
492 Ga0501080_0022378 3300049742 Bacteria 5856
493 Ga0501045_0183962 3300049824 Bacteria 1557
494 nmdc:mga05p37_175136_c1 3300050507 Bacteria 2614
495 nmdc:mga05p37_191277_c1 3300050507 Bacteria 2484
496 nmdc:mga05p37_34176_c1 3300050507 Bacteria 6226
497 nmdc:mga05p37_388057_c1 3300050507 Unclassified 1634
498 nmdc:mga05p37_403767_c1 3300050507 Bacteria 1595
499 nmdc:mga05p37_55783_c1 3300050507 Bacteria 4864
500 nmdc:mga05p37_56549_c1 3300050507 Bacteria 4831
501 nmdc:mga05p37_687502_c1 3300050507 Bacteria 1139
502 nmdc:mga05p37_92750_c1 3300050507 Bacteria 3721
503 nmdc:mga05p37_94739_c1 3300050507 Unclassified 3678
504 nmdc:mga05p37_9829_c1 3300050507 Bacteria 11354
505 nmdc:mga09592_1848_c1 3300050508 Bacteria 17028
506 nmdc:mga09592_256962_c1 3300050508 Bacteria 1514
507 nmdc:mga09592_387807_c1 3300050508 Bacteria 1208
508 nmdc:mga09592_44366_c1 3300050508 Bacteria 3742
509 nmdc:mga0qj67_114003_c1 3300050509 Bacteria 2183
510 nmdc:mga0qj67_201394_c1 3300050509 Unclassified 1618
511 nmdc:mga0qj67_33028_c1 3300050509 Bacteria 4037
512 nmdc:mga06r32_182636_c1 3300050510 Unclassified 2084
513 nmdc:mga06r32_208509_c1 3300050510 Bacteria 1942
514 nmdc:mga06r32_217007_c1 3300050510 Unclassified 1901
515 nmdc:mga06r32_219172_c1 3300050510 Bacteria 1891
516 nmdc:mga06r32_25358_c1 3300050510 Bacteria 5516
517 nmdc:mga08y16_164568_c1 3300050511 Bacteria 2304
518 nmdc:mga08y16_24468_c1 3300050511 Bacteria 6373
519 nmdc:mga08y16_33260_c1 3300050511 Bacteria 5416
520 nmdc:mga08y16_4299_c1 3300050511 Bacteria 14875
521 nmdc:mga08y16_46778_c1 3300050511 Unclassified 4529
522 nmdc:mga08y16_534187_c1 3300050511 Bacteria 1188
523 nmdc:mga08y16_88810_c1 3300050511 Bacteria 3221
524 nmdc:mga0n895_1110_c1 3300050512 Bacteria 19640
525 nmdc:mga0n895_13860_c1 3300050512 Bacteria 7297
526 nmdc:mga0n895_179822_c1 3300050512 Bacteria 2146
527 nmdc:mga0n895_187485_c1 3300050512 Bacteria 2099
528 nmdc:mga0n895_24838_c1 3300050512 Bacteria 5654
529 nmdc:mga0n895_347362_c1 3300050512 Unclassified 1502
530 nmdc:mga0n895_41975_c1 3300050512 Bacteria 4449
531 nmdc:mga0n895_700209_c1 3300050512 Bacteria 1009
532 nmdc:mga0n895_71643_c1 3300050512 Unclassified 3437
533 nmdc:mga0rr50_232732_c1 3300050513 Unclassified 1525
534 nmdc:mga0rr50_27465_c1 3300050513 Bacteria 3985
535 nmdc:mga0rr50_392077_c1 3300050513 Bacteria 1172
536 nmdc:mga0rr50_43_c1 3300050513 Bacteria 80287
537 nmdc:mga0rr50_57529_c1 3300050513 Unclassified 2909
538 nmdc:mga0rr50_9563_c1 3300050513 Bacteria 6102
539 nmdc:mga08x19_136039_c1 3300050514 Bacteria 1657
540 nmdc:mga08x19_16885_c1 3300050514 Bacteria 4459
541 nmdc:mga08x19_182_c1 3300050514 Bacteria 50671
542 nmdc:mga0a205_1412_c1 3300050515 Bacteria 20378
543 nmdc:mga0a205_145715_c1 3300050515 Bacteria 2268
544 nmdc:mga0a205_171616_c1 3300050515 Bacteria 2065
545 nmdc:mga0a205_214520_c1 3300050515 Unclassified 1812
546 nmdc:mga0a205_24130_c2 3300050515 Bacteria 4692
547 nmdc:mga0a205_3073_c1 3300050515 Bacteria 14819
548 nmdc:mga0a205_41941_c1 3300050515 Bacteria 4409
549 nmdc:mga0a205_66539_c1 3300050515 Bacteria 3482
550 Ga0495619_0217809 3300053085 Unclassified 1322
551 Ga0590071_000184 3300059421 Bacteria 18178
552 Ga0590071_002604 3300059421 Bacteria 4536
553 Ga0590075_000460 3300059424 Bacteria 10984
554 Ga0590075_037211 3300059424 Bacteria 1240
555 Ga0590077_001320 3300059426 Bacteria 5858
556 Ga0501082_0206571 3300060353 Bacteria 1709
557 JGI25406J46586_10002916
558 JGI25406J46586_10000465
559 Ga0065712_10088196
560 Ga0065715_10122464
561 Ga0065715_10159937
562 Ga0065707_10033284
563 Ga0070658_10014820
564 Ga0070683_100226953
565 Ga0070690_100108324
566 Ga0070670_100004018
567 Ga0070670_100023331
568 Ga0070670_100027449
569 Ga0070670_100032262
570 Ga0070670_100039674
571 Ga0070670_100125465
572 Ga0070670_100126280
573 Ga0070670_100353328
574 Ga0068869_100001962
575 Ga0068869_100339624
576 Ga0070680_100035854
577 Ga0070680_100070890
578 Ga0070680_100105144
579 Ga0070682_100109049
580 Ga0068868_100000316
581 Ga0068868_100282581
582 Ga0070660_100013950
583 Ga0070660_100168956
584 Ga0070689_100223358
585 Ga0070689_100514566
586 Ga0070661_100067498
587 Ga0070661_100109886
588 Ga0070668_100077444
589 Ga0070668_100156062
590 Ga0070669_100011002
591 Ga0070669_100075465
592 Ga0070669_100107640
593 Ga0070669_100115866
594 Ga0070669_100421102
595 Ga0070675_100000014
596 Ga0070675_100000442
597 Ga0070675_100012826
598 Ga0070675_100024303
599 Ga0070675_100110080
600 Ga0070675_100210376
601 Ga0070671_100001353
602 Ga0070671_100083507
603 Ga0070674_100074707
604 Ga0070673_100023165
605 Ga0070673_100051183
606 Ga0070673_100296623
607 Ga0070688_100006547
608 Ga0070659_100275925
609 Ga0070659_100282500
610 Ga0070714_100010499
611 Ga0070713_100059506
612 Ga0070713_100420674
613 Ga0070701_10020548
614 Ga0070701_10109268
615 Ga0070700_100003978
616 Ga0070700_100396207
617 Ga0070694_100007700
618 Ga0070694_100129977
619 Ga0070708_100117092
620 Ga0070708_100139222
621 Ga0070708_100283345
622 Ga0070678_100180355
623 Ga0070678_100352367
624 Ga0070662_100133236
625 Ga0070681_10046171
626 Ga0070681_10166650
627 Ga0068867_100042961
628 Ga0068867_100323069
629 Ga0070685_10064882
630 Ga0070706_100180037
631 Ga0070707_100037290
632 Ga0070707_100133904
633 Ga0070707_100179301
634 Ga0070707_100319821
635 Ga0070698_100001654
636 Ga0070698_100017547
637 Ga0070698_100106789
638 Ga0070698_100158772
639 Ga0070699_100000558
640 Ga0070699_100001909
641 Ga0070699_100091222
642 Ga0070699_100137944
643 Ga0070679_100004319
644 Ga0070679_100240080
645 Ga0070679_100298478
646 Ga0070684_100010485
647 Ga0070684_100109630
648 Ga0070697_100173822
649 Ga0070672_100005374
650 Ga0070686_100008329
651 Ga0070686_100077074
652 Ga0070686_100236057
653 Ga0070695_100008733
654 Ga0070695_100021399
655 Ga0070696_100015554
656 Ga0070696_100017843
657 Ga0070696_100076177
658 Ga0070665_100012904
659 Ga0070704_100041380
660 Ga0070704_100147270
661 Ga0068855_100051623
662 Ga0068855_100314599
663 Ga0070664_100008947
664 Ga0070664_100011086
665 Ga0070664_100027878
666 Ga0070664_100040581
667 Ga0070664_100080794
668 Ga0070664_100333324
669 Ga0068857_100011541
670 Ga0068854_100099806
671 Ga0068856_100466749
672 Ga0068859_100066715
673 Ga0068859_100434494
674 Ga0068859_100687154
675 Ga0068864_100002331
676 Ga0068864_100058206
677 Ga0068864_100085084
678 Ga0068866_10094484
679 Ga0068861_100004253
680 Ga0068861_100018977
681 Ga0068861_100200239
682 Ga0068870_10122642
683 Ga0068863_100002769
684 Ga0068858_100004497
685 Ga0068858_100010084
686 Ga0068858_100013709
687 Ga0068858_100033933
688 Ga0068858_100040363
689 Ga0068860_100015275
690 Ga0068860_100046193
691 Ga0068860_100228035
692 Ga0068862_100057358
693 Ga0068862_100114872
694 Ga0068862_100380435
695 Ga0081455_10098401
696 Ga0081538_10010658
697 Ga0081539_10000025
698 Ga0081539_10000134
699 Ga0081539_10004230
700 Ga0081539_10024851
701 Ga0070717_10000040
702 Ga0075366_10039191
703 Ga0097621_100008941
704 Ga0097621_100102308
705 Ga0097621_100191759
706 Ga0097621_100341933
707 Ga0068871_100009037
708 Ga0068871_100015159
709 Ga0068871_100173069
710 Ga0075428_100002473
711 Ga0075428_100214423
712 Ga0075430_100005588
713 Ga0075431_100008820
714 Ga0075431_100010853
715 Ga0075431_100020409
716 Ga0075431_100022802
717 Ga0075431_100230241
718 Ga0075433_10003019
719 Ga0075433_10013093
720 Ga0075433_10039808
721 Ga0075433_10042066
722 Ga0075433_10046150
723 Ga0075433_10084202
724 Ga0075433_10084907
725 Ga0075433_10131934
726 Ga0075433_10157323
727 Ga0075433_10186959
728 Ga0075433_10259195
729 Ga0075434_100000919
730 Ga0075434_100014285
731 Ga0075434_100020595
732 Ga0075434_100025674
733 Ga0075429_100003923
734 Ga0075429_100039817
735 Ga0068865_100056363
736 Ga0075436_100005042
737 Ga0075436_100008937
738 Ga0075436_100011065
739 Ga0097620_100066717
740 Ga0097620_100434566
741 Ga0097620_100447561
742 Ga0097620_100687134
743 Ga0075435_100000251
744 Ga0075435_100042735
745 Ga0075435_100078398
746 Ga0075435_100119707
747 Ga0075435_100153659
748 Ga0075435_100433924
749 Ga0105244_10009892
750 Ga0105240_10094500
751 Ga0105240_10170409
752 Ga0105240_10206776
753 Ga0111539_10005838
754 Ga0111539_10010233
755 Ga0111539_10015720
756 Ga0111539_10020569
757 Ga0111539_10201634
758 Ga0111539_10240386
759 Ga0111539_10250910
760 Ga0111539_10555561
761 Ga0105245_10000054
762 Ga0105245_10004601
763 Ga0105245_10037759
764 Ga0105247_10010498
765 Ga0105247_10130364
766 Ga0114129_10019030
767 Ga0114129_10020281
768 Ga0114129_10027398
769 Ga0114129_10049917
770 Ga0114129_10065650
771 Ga0114129_10086037
772 Ga0114129_10094906
773 Ga0114129_10161935
774 Ga0114129_10445769
775 Ga0114129_10557203
776 Ga0114129_10652720
777 Ga0114129_10753701
778 Ga0105243_10018202
779 Ga0105242_10013124
780 Ga0105242_10086074
781 Ga0105248_10009010
782 Ga0105248_10022346
783 Ga0105248_10304504
784 Ga0105238_10225385
785 Ga0105249_10289299
786 Ga0105249_10337539
787 Ga0105246_10098298
788 Ga0157373_10002140
789 Ga0157373_10169251
790 Ga0157371_10012168
791 Ga0157371_10210397
792 Ga0157370_10385186
793 Ga0157369_10036158
794 Ga0157369_10236465
795 Ga0157374_10000008
796 Ga0157374_10029262
797 Ga0163162_10012851
798 Ga0163162_10174710
799 Ga0157372_10002924
800 Ga0157372_10161841
801 Ga0157372_10357771
802 Ga0157375_10165393
803 Ga0157375_10622632
804 Ga0163163_10023059
805 Ga0163163_10047055
806 Ga0163163_10148854
807 Ga0157380_10025095
808 Ga0157380_10177367
809 Ga0157377_10000007
810 Ga0157379_10007571
811 Ga0157379_10054975
812 Ga0157376_10000015
813 Ga0157376_10006057
814 Ga0157376_10037406
815 Ga0157376_10089781
816 Ga0213873_10000319
817 Ga0213876_10000008
818 Ga0213876_10019835
819 Ga0213876_10034837
820 Ga0213875_10000001
821 Ga0207697_10038533
822 Ga0207682_10039731
823 Ga0207642_10002113
824 Ga0207710_10095767
825 Ga0207680_10011747
826 Ga0207680_10058975
827 Ga0207680_10159784
828 Ga0207645_10000374
829 Ga0207643_10028262
830 Ga0207643_10067335
831 Ga0207705_10002864
832 Ga0207705_10088631
833 Ga0207707_10192742
834 Ga0207707_10259421
835 Ga0207695_10027295
836 Ga0207695_10179123
837 Ga0207695_10444224
838 Ga0207660_10027248
839 Ga0207660_10054085
840 Ga0207660_10065872
841 Ga0207660_10277117
842 Ga0207662_10022100
843 Ga0207662_10158220
844 Ga0207657_10000448
845 Ga0207657_10000873
846 Ga0207657_10169729
847 Ga0207652_10020863
848 Ga0207652_10241925
849 Ga0207646_10018292
850 Ga0207681_10012447
851 Ga0207681_10029978
852 Ga0207681_10069874
853 Ga0207681_10131096
854 Ga0207681_10145896
855 Ga0207694_10246865
856 Ga0207650_10014290
857 Ga0207650_10043805
858 Ga0207650_10051583
859 Ga0207650_10057554
860 Ga0207650_10304929
861 Ga0207659_10000001
862 Ga0207659_10000501
863 Ga0207659_10014754
864 Ga0207659_10077500
865 Ga0207659_10113831
866 Ga0207659_10162821
867 Ga0207659_10355764
868 Ga0207687_10000010
869 Ga0207687_10004950
870 Ga0207700_10046749
871 Ga0207644_10006198
872 Ga0207644_10065579
873 Ga0207686_10024941
874 Ga0207686_10368380
875 Ga0207670_10148264
876 Ga0207669_10066168
877 Ga0207704_10015711
878 Ga0207704_10159274
879 Ga0207665_10105315
880 Ga0207691_10095027
881 Ga0207691_10095422
882 Ga0207691_10122809
883 Ga0207691_10126960
884 Ga0207711_10007172
885 Ga0207711_10038864
886 Ga0207711_10059701
887 Ga0207711_10129876
888 Ga0207711_10218101
889 Ga0207711_10241390
890 Ga0207689_10004769
891 Ga0207689_10080630
892 Ga0207689_10356605
893 Ga0207661_10000002
894 Ga0207661_10073430
895 Ga0207661_10200358
896 Ga0207679_10002916
897 Ga0207679_10006997
898 Ga0207679_10064013
899 Ga0207667_10050413
900 Ga0207651_10026516
901 Ga0207651_10087177
902 Ga0207651_10114559
903 Ga0207668_10004761
904 Ga0207668_10045325
905 Ga0207640_10029343
906 Ga0207640_10085865
907 Ga0207640_10110825
908 Ga0207658_10098536
909 Ga0207677_10000535
910 Ga0207703_10031293
911 Ga0207703_10046889
912 Ga0207703_10054981
913 Ga0207703_10112311
914 Ga0207703_10122306
915 Ga0207703_10175370
916 Ga0207703_10250543
917 Ga0207703_10402376
918 Ga0207639_10000005
919 Ga0207708_10002808
920 Ga0207708_10009868
921 Ga0207708_10059624
922 Ga0207708_10070555
923 Ga0207708_10226378
924 Ga0207702_10343443
925 Ga0207641_10003428
926 Ga0207648_10006736
927 Ga0207648_10056961
928 Ga0207648_10156389
929 Ga0207648_10191629
930 Ga0207648_10338054
931 Ga0207676_10008856
932 Ga0207676_10127003
933 Ga0207676_10267293
934 Ga0207674_10018014
935 Ga0207675_100014564
936 Ga0207675_100128982
937 Ga0207683_10020448
938 Ga0207683_10220082
939 Ga0207698_10001196
940 Ga0209974_10022194
941 Ga0207428_10000089
942 Ga0207428_10002849
943 Ga0207428_10022376
944 Ga0207428_10023217
945 Ga0207428_10023335
946 Ga0268266_10006901
947 Ga0268266_10039596
948 Ga0268266_10462578
949 Ga0268265_10019678
950 Ga0268265_10038601
951 Ga0268265_10260340
952 Ga0268264_10047593
953 Ga0268264_10159132
954 Ga0268264_10181493
955 Ga0268264_10407985
956 Ga0265760_10000515
957 Ga0307408_100023919
958 Ga0307405_10000638
959 Ga0307413_10039569
960 Ga0307413_10075946
961 Ga0307410_10002043
962 Ga0307410_10029925
963 Ga0307410_10272175
964 Ga0307407_10009101
965 Ga0307407_10036200
966 Ga0307412_10026032
967 Ga0307412_10135888
968 Ga0307409_100044083
969 Ga0307409_100401857
970 Ga0307416_100003391
971 Ga0307416_100024534
972 Ga0307416_100037410
973 Ga0307416_100155991
974 Ga0307416_100178746
975 Ga0307414_10111079
976 Ga0307411_10024327
977 Ga0307411_10124511
978 Ga0307411_10208665
979 Ga0307415_100060572
980 Ga0307415_100112777
981 Ga0307415_100456128
982 Ga0307415_100512180
983 Ga0373940_0007577
984 Ga0373932_0037285
985 Ga0373941_0077808
986 Ga0373945_0130149
987 Ga0373935_0115940
988 Ga0373937_0002907
989 Ga0373937_0157234
990 Ga0373937_0437620
991 Ga0373937_0480746
992 Ga0436364_0273345
993 Ga0436365_1080031
994 Ga0436365_1215398
995 Ga0436365_1280046
996 Ga0436363_0941283
997 Ga0436362_0165744
998 Ga0439433_0005046
999 Ga0439435_0001748
1000 Ga0439435_0019471
1001 Ga0439464_0019886
1002 Ga0453683_0161898
1003 Ga0453684_0044446
1004 Ga0451576_0003034
1005 Ga0451576_0013194
1006 Ga0451576_0055479
1007 Ga0451576_0059680
1008 Ga0451576_0097826
1009 Ga0466967_0025553
1010 Ga0495603_0029292
1011 Ga0495603_0071069
1012 Ga0495603_0080026
1013 Ga0495629_0118916
1014 Ga0495580_0000035
1015 Ga0495582_0211081
1016 Ga0495594_0005780
1017 Ga0495594_0069517
1018 Ga0495618_0093025
1019 Ga0495643_0009281
1020 Ga0495640_0194102
1021 Ga0495621_0025420
1022 Ga0495659_0062976
1023 Ga0495647_0113090
1024 Ga0495658_0009981
1025 Ga0495658_0059834
1026 Ga0495670_0098171
1027 Ga0495676_0005978
1028 Ga0495602_0034474
1029 Ga0496101_0163135
1030 Ga0496102_0011305
1031 Ga0496104_0021436
1032 Ga0496104_0532303
1033 Ga0496106_0102108
1034 Ga0496108_0414305
1035 Ga0496109_0502638
1036 Ga0496112_0007050
1037 Ga0496112_0119210
1038 Ga0496113_0054180
1039 Ga0496113_0361238
1040 Ga0496114_0197061
1041 Ga0496114_0275174
1042 Ga0501048_0231775
1043 Ga0501067_0022338
1044 Ga0501068_0083192
1045 Ga0501072_0121696
1046 Ga0501074_0092074
1047 Ga0501075_0050714
1048 Ga0501080_0022378
1049 Ga0501045_0183962
1050 nmdc:mga05p37_175136_c1
1051 nmdc:mga05p37_191277_c1
1052 nmdc:mga05p37_34176_c1
1053 nmdc:mga05p37_388057_c1
1054 nmdc:mga05p37_403767_c1
1055 nmdc:mga05p37_55783_c1
1056 nmdc:mga05p37_56549_c1
1057 nmdc:mga05p37_687502_c1
1058 nmdc:mga05p37_92750_c1
1059 nmdc:mga05p37_94739_c1
1060 nmdc:mga05p37_9829_c1
1061 nmdc:mga09592_1848_c1
1062 nmdc:mga09592_256962_c1
1063 nmdc:mga09592_387807_c1
1064 nmdc:mga09592_44366_c1
1065 nmdc:mga0qj67_114003_c1
1066 nmdc:mga0qj67_201394_c1
1067 nmdc:mga0qj67_33028_c1
1068 nmdc:mga06r32_182636_c1
1069 nmdc:mga06r32_208509_c1
1070 nmdc:mga06r32_217007_c1
1071 nmdc:mga06r32_219172_c1
1072 nmdc:mga06r32_25358_c1
1073 nmdc:mga08y16_164568_c1
1074 nmdc:mga08y16_24468_c1
1075 nmdc:mga08y16_33260_c1
1076 nmdc:mga08y16_4299_c1
1077 nmdc:mga08y16_46778_c1
1078 nmdc:mga08y16_534187_c1
1079 nmdc:mga08y16_88810_c1
1080 nmdc:mga0n895_1110_c1
1081 nmdc:mga0n895_13860_c1
1082 nmdc:mga0n895_179822_c1
1083 nmdc:mga0n895_187485_c1
1084 nmdc:mga0n895_24838_c1
1085 nmdc:mga0n895_347362_c1
1086 nmdc:mga0n895_41975_c1
1087 nmdc:mga0n895_700209_c1
1088 nmdc:mga0n895_71643_c1
1089 nmdc:mga0rr50_232732_c1
1090 nmdc:mga0rr50_27465_c1
1091 nmdc:mga0rr50_392077_c1
1092 nmdc:mga0rr50_43_c1
1093 nmdc:mga0rr50_57529_c1
1094 nmdc:mga0rr50_9563_c1
1095 nmdc:mga08x19_136039_c1
1096 nmdc:mga08x19_16885_c1
1097 nmdc:mga08x19_182_c1
1098 nmdc:mga0a205_1412_c1
1099 nmdc:mga0a205_145715_c1
1100 nmdc:mga0a205_171616_c1
1101 nmdc:mga0a205_214520_c1
1102 nmdc:mga0a205_24130_c2
1103 nmdc:mga0a205_3073_c1
1104 nmdc:mga0a205_41941_c1
1105 nmdc:mga0a205_66539_c1
1106 Ga0495619_0217809
1107 Ga0590071_000184
1108 Ga0590071_002604
1109 Ga0590075_000460
1110 Ga0590075_037211
1111 Ga0590077_001320
1112 Ga0501082_0206571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21686

LigD_Prim-Pol

LigD, primase-polymerase domain

41

295

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.9488 9 306
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.9385 13 298
2iry-assembly1.cif.gz_A crystal structure of the polymerase domain from mycobacterium tuberculosis ligase d with dgtp and manganese. 0.9333 27 300
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.9244 9 306
2far-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese 0.9106 25 311
ID Description Score Start End Superfamily
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9535 41 311 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9325 32 311 3.90.920.10
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9238 141 275 3.30.70.3300
af_P9WNV3_16_301_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9139 32 310 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9104 32 311 3.90.920.10
ID Description Score Start End GO Terms
AF-A0A2V7CZR3-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.9921 8 310 GO:0005524
GO:0046872
AF-A0A534TSH9-F1-model_v4 Tetratricopeptide repeat protein 0.9913 9 314 GO:0003677
GO:0005524
GO:0006355
GO:0046872
AF-A0A7W1QL58-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.991 140 307 GO:0005524
GO:0046872
AF-A0A534QMP0-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.9909 7 201 GO:0005524
GO:0046872
AF-A0A2V6ZBR0-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.9908 8 310 GO:0005524
GO:0046872

Map