F463199

General Info

Members Datasets Scaffolds Average Seq Length
556 236 554 182

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100612965|Ga0070665_1006129652
Length 197
Sequence VVKFNFFTFVVQNYSYNGVPMAILKFRIYFEEDDSVYRDVAIRHTQNFRELHDSILKAYEFDNKHKATFYRSNDHWQRGREITLEKYDKFYQAQPLLMDATMIGSEIKNPNQKFVYQYDFNKNWTFLVELINVSKEENPKLVYPAVVRTEGIGPSQYGTKGLLGEKFADVEEKYDLSQVGEGFGEKDEDAAEGAEEV

Samples

Sample ID Description Type Environment
1 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
2 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
161 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
162 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
166 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
223 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
224 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
225 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
229 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
232 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
233 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.32
Nodule 0
Rhizoplane 1.26
Rhizosphere 92.27
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001575 3300002459 Bacteria 4717
2 JGI25406J46586_10001257 3300003203 Bacteria 11899
3 rootL2_10258140 3300003322 Bacteria 1728
4 rootL2_10334334 3300003322 Bacteria 2182
5 Ga0065165_1007154 3300005262 Bacteria 5583
6 Ga0065714_10092279 3300005288 Unclassified 1883
7 Ga0065712_10004487 3300005290 Bacteria 4074
8 Ga0065712_10301762 3300005290 Bacteria 830
9 Ga0070658_10324112 3300005327 Bacteria 1316
10 Ga0070676_10021643 3300005328 Bacteria 3601
11 Ga0070676_10058522 3300005328 Bacteria 2284
12 Ga0070676_10156428 3300005328 Unclassified 1463
13 Ga0070683_100000369 3300005329 Bacteria 31172
14 Ga0070683_100193910 3300005329 Bacteria 1929
15 Ga0070690_100376879 3300005330 Bacteria 1036
16 Ga0070690_100673072 3300005330 Bacteria 792
17 Ga0070670_100010996 3300005331 Bacteria 7731
18 Ga0070670_100072920 3300005331 Bacteria 2949
19 Ga0070670_100192206 3300005331 Bacteria 1773
20 Ga0070670_100353513 3300005331 Bacteria 1291
21 Ga0070670_100659810 3300005331 Bacteria 939
22 Ga0070677_10134731 3300005333 Bacteria 1132
23 Ga0070677_10243721 3300005333 Bacteria 888
24 Ga0068869_100048337 3300005334 Bacteria 3075
25 Ga0068869_100064099 3300005334 Unclassified 2702
26 Ga0068869_100091335 3300005334 Bacteria 2290
27 Ga0068869_100118168 3300005334 Bacteria 2025
28 Ga0068869_100339703 3300005334 Unclassified 1222
29 Ga0068869_100729722 3300005334 Unclassified 847
30 Ga0070666_10001617 3300005335 Bacteria 13695
31 Ga0070666_10008505 3300005335 Bacteria 6374
32 Ga0070666_10159028 3300005335 Bacteria 1579
33 Ga0070666_10397366 3300005335 Bacteria 991
34 Ga0070680_100688757 3300005336 Bacteria 879
35 Ga0070682_100011786 3300005337 Bacteria 5001
36 Ga0070682_100736830 3300005337 Unclassified 794
37 Ga0068868_100006675 3300005338 Bacteria 8189
38 Ga0068868_100016880 3300005338 Bacteria 5431
39 Ga0068868_100018242 3300005338 Bacteria 5243
40 Ga0068868_100024235 3300005338 Bacteria 4602
41 Ga0068868_100059109 3300005338 Unclassified 3032
42 Ga0068868_100927980 3300005338 Bacteria 793
43 Ga0070660_100272866 3300005339 Bacteria 1383
44 Ga0070689_100003471 3300005340 Bacteria 10494
45 Ga0070689_100014706 3300005340 Bacteria 5691
46 Ga0070689_100053777 3300005340 Unclassified 3116
47 Ga0070689_100324112 3300005340 Bacteria 1287
48 Ga0070689_101145746 3300005340 Bacteria 696
49 Ga0070687_100228310 3300005343 Bacteria 1144
50 Ga0070661_100002729 3300005344 Bacteria 12103
51 Ga0070661_100003755 3300005344 Bacteria 10470
52 Ga0070661_100213081 3300005344 Unclassified 1479
53 Ga0070661_100637115 3300005344 Bacteria 864
54 Ga0070692_10273153 3300005345 Bacteria 1021
55 Ga0070668_100013739 3300005347 Bacteria 6048
56 Ga0070668_100022048 3300005347 Bacteria 4814
57 Ga0070668_100109884 3300005347 Bacteria 2194
58 Ga0070668_100139170 3300005347 Bacteria 1955
59 Ga0070668_100222751 3300005347 Bacteria 1556
60 Ga0070668_100322517 3300005347 Unclassified 1301
61 Ga0070668_100612326 3300005347 Bacteria 954
62 Ga0070668_100648630 3300005347 Bacteria 927
63 Ga0070669_100003999 3300005353 Bacteria 10653
64 Ga0070669_100106930 3300005353 Bacteria 2119
65 Ga0070669_100128298 3300005353 Bacteria 1943
66 Ga0070669_100568112 3300005353 Bacteria 947
67 Ga0070675_100014040 3300005354 Bacteria 6308
68 Ga0070675_100052633 3300005354 Bacteria 3348
69 Ga0070675_100226947 3300005354 Bacteria 1628
70 Ga0070671_100132135 3300005355 Bacteria 2102
71 Ga0070671_100568999 3300005355 Bacteria 978
72 Ga0070674_100043035 3300005356 Bacteria 3070
73 Ga0070674_101369363 3300005356 Bacteria 633
74 Ga0070673_100026833 3300005364 Bacteria 4260
75 Ga0070673_100077659 3300005364 Bacteria 2684
76 Ga0070673_100104377 3300005364 Bacteria 2340
77 Ga0070688_100006097 3300005365 Bacteria 6406
78 Ga0070688_100012285 3300005365 Bacteria 4793
79 Ga0070688_100041914 3300005365 Bacteria 2813
80 Ga0070659_100005516 3300005366 Bacteria 9086
81 Ga0070659_100491837 3300005366 Unclassified 1045
82 Ga0070667_100000492 3300005367 Bacteria 40164
83 Ga0070667_100032768 3300005367 Bacteria 4336
84 Ga0070667_100154961 3300005367 Bacteria 2015
85 Ga0070667_100296909 3300005367 Unclassified 1454
86 Ga0070667_100407931 3300005367 Unclassified 1237
87 Ga0070667_100734750 3300005367 Bacteria 914
88 Ga0070667_100975543 3300005367 Bacteria 790
89 Ga0070700_100179199 3300005441 Bacteria 1473
90 Ga0070663_100086111 3300005455 Bacteria 2320
91 Ga0070678_100006435 3300005456 Bacteria 6895
92 Ga0070678_100073843 3300005456 Bacteria 2561
93 Ga0070678_100109976 3300005456 Bacteria 2154
94 Ga0070662_100003002 3300005457 Bacteria 10492
95 Ga0070662_100017476 3300005457 Bacteria 4837
96 Ga0070662_100040148 3300005457 Bacteria 3331
97 Ga0070662_100187140 3300005457 Bacteria 1635
98 Ga0068867_100062935 3300005459 Bacteria 2758
99 Ga0068867_100070176 3300005459 Bacteria 2619
100 Ga0068867_100215220 3300005459 Bacteria 1545
101 Ga0068867_100687816 3300005459 Bacteria 901
102 Ga0070685_10377225 3300005466 Bacteria 976
103 Ga0070685_10643988 3300005466 Unclassified 767
104 Ga0070684_100009153 3300005535 Bacteria 7787
105 Ga0070684_100057258 3300005535 Bacteria 3403
106 Ga0070684_100100027 3300005535 Bacteria 2589
107 Ga0068853_100008084 3300005539 Bacteria 8440
108 Ga0068853_100013550 3300005539 Bacteria 6663
109 Ga0068853_100016523 3300005539 Bacteria 6076
110 Ga0068853_100058020 3300005539 Bacteria 3342
111 Ga0068853_100684779 3300005539 Bacteria 977
112 Ga0070672_100002526 3300005543 Bacteria 11648
113 Ga0070672_100054588 3300005543 Unclassified 3128
114 Ga0070672_100089934 3300005543 Bacteria 2475
115 Ga0070672_100316512 3300005543 Bacteria 1326
116 Ga0070672_100448565 3300005543 Unclassified 1111
117 Ga0070672_100514075 3300005543 Bacteria 1037
118 Ga0070672_100585143 3300005543 Bacteria 971
119 Ga0070686_100049218 3300005544 Bacteria 2673
120 Ga0070686_100277386 3300005544 Unclassified 1235
121 Ga0070695_100243757 3300005545 Bacteria 1305
122 Ga0070693_100190124 3300005547 Bacteria 1327
123 Ga0070693_100397306 3300005547 Unclassified 955
124 Ga0070665_100006195 3300005548 Bacteria 12241
125 Ga0070665_100211705 3300005548 Bacteria 1939
126 Ga0070665_100612965 3300005548 Bacteria 1101
127 Ga0068855_100142435 3300005563 Bacteria 2731
128 Ga0068855_100609091 3300005563 Unclassified 1177
129 Ga0068855_100961455 3300005563 Unclassified 899
130 Ga0070664_100010950 3300005564 Bacteria 7356
131 Ga0070664_100274181 3300005564 Bacteria 1520
132 Ga0068857_100001073 3300005577 Bacteria 21162
133 Ga0068857_100042792 3300005577 Bacteria 4018
134 Ga0068857_100048276 3300005577 Bacteria 3780
135 Ga0068857_100108124 3300005577 Bacteria 2499
136 Ga0068857_100231549 3300005577 Bacteria 1690
137 Ga0068854_100014556 3300005578 Bacteria 5190
138 Ga0068854_100205887 3300005578 Unclassified 1549
139 Ga0068854_100258554 3300005578 Bacteria 1393
140 Ga0068854_100558498 3300005578 Bacteria 972
141 Ga0068852_100067650 3300005616 Bacteria 3123
142 Ga0068859_100027856 3300005617 Bacteria 5666
143 Ga0068859_100047267 3300005617 Bacteria 4323
144 Ga0068859_100049111 3300005617 Unclassified 4238
145 Ga0068859_100167569 3300005617 Bacteria 2277
146 Ga0068859_100211162 3300005617 Bacteria 2027
147 Ga0068859_100258081 3300005617 Bacteria 1834
148 Ga0068859_100417024 3300005617 Bacteria 1439
149 Ga0068859_100434898 3300005617 Bacteria 1408
150 Ga0068859_100704028 3300005617 Bacteria 1101
151 Ga0068859_100808013 3300005617 Unclassified 1025
152 Ga0068864_100002625 3300005618 Bacteria 14840
153 Ga0068864_100088821 3300005618 Unclassified 2722
154 Ga0068864_100136705 3300005618 Bacteria 2207
155 Ga0068864_100309884 3300005618 Unclassified 1480
156 Ga0068866_10069681 3300005718 Bacteria 1853
157 Ga0068866_10353302 3300005718 Bacteria 935
158 Ga0068861_100003788 3300005719 Bacteria 10101
159 Ga0068861_100014462 3300005719 Bacteria 5540
160 Ga0068861_100015292 3300005719 Bacteria 5405
161 Ga0068851_10018455 3300005834 Bacteria 3360
162 Ga0068851_10167349 3300005834 Bacteria 1211
163 Ga0068851_10213655 3300005834 Bacteria 1081
164 Ga0068870_10031399 3300005840 Bacteria 2692
165 Ga0068870_10151420 3300005840 Bacteria 1367
166 Ga0068863_100041642 3300005841 Bacteria 4367
167 Ga0068863_100207573 3300005841 Bacteria 1886
168 Ga0068863_100757358 3300005841 Bacteria 967
169 Ga0068858_100009282 3300005842 Bacteria 9392
170 Ga0068858_100272403 3300005842 Bacteria 1611
171 Ga0068860_100015281 3300005843 Bacteria 7497
172 Ga0068860_100048432 3300005843 Bacteria 4051
173 Ga0068860_100102965 3300005843 Bacteria 2725
174 Ga0068860_100106476 3300005843 Bacteria 2678
175 Ga0068860_100454390 3300005843 Bacteria 1274
176 Ga0068862_100025761 3300005844 Bacteria 4939
177 Ga0068862_100173539 3300005844 Bacteria 1931
178 Ga0068862_100535839 3300005844 Bacteria 1116
179 Ga0068862_100737505 3300005844 Bacteria 957
180 Ga0081539_10039690 3300005985 Bacteria 2774
181 Ga0075366_10036958 3300006195 Bacteria 2880
182 Ga0097621_100050613 3300006237 Bacteria 3379
183 Ga0097621_100056954 3300006237 Bacteria 3194
184 Ga0097621_100128878 3300006237 Bacteria 2151
185 Ga0097621_100277107 3300006237 Bacteria 1476
186 Ga0068871_100054812 3300006358 Bacteria 3236
187 Ga0068871_100071779 3300006358 Bacteria 2849
188 Ga0068871_100401550 3300006358 Bacteria 1221
189 Ga0075428_100815199 3300006844 Bacteria 992
190 Ga0075434_100541707 3300006871 Bacteria 1184
191 Ga0068865_100019896 3300006881 Bacteria 4349
192 Ga0068865_100211217 3300006881 Bacteria 1512
193 Ga0068865_100213055 3300006881 Bacteria 1506
194 Ga0068865_100440485 3300006881 Bacteria 1075
195 Ga0068865_100893340 3300006881 Bacteria 772
196 Ga0097620_100027855 3300006931 Bacteria 5666
197 Ga0097620_100047273 3300006931 Bacteria 4323
198 Ga0097620_100049111 3300006931 Unclassified 4238
199 Ga0097620_100167570 3300006931 Bacteria 2277
200 Ga0097620_100211161 3300006931 Bacteria 2027
201 Ga0097620_100258069 3300006931 Bacteria 1834
202 Ga0097620_100417053 3300006931 Bacteria 1439
203 Ga0097620_100434884 3300006931 Bacteria 1408
204 Ga0097620_100704037 3300006931 Bacteria 1101
205 Ga0097620_100808025 3300006931 Unclassified 1025
206 Ga0105251_10189359 3300009011 Unclassified 927
207 Ga0105240_10081908 3300009093 Bacteria 3964
208 Ga0105240_10219871 3300009093 Bacteria 2213
209 Ga0111539_10006460 3300009094 Bacteria 15103
210 Ga0105245_10558359 3300009098 Bacteria 1167
211 Ga0105245_10917911 3300009098 Bacteria 918
212 Ga0105245_11131557 3300009098 Unclassified 830
213 Ga0105247_10002173 3300009101 Bacteria 13531
214 Ga0105247_10014543 3300009101 Bacteria 4720
215 Ga0105243_10099604 3300009148 Bacteria 2409
216 Ga0105241_10145168 3300009174 Bacteria 1936
217 Ga0105241_11012057 3300009174 Bacteria 778
218 Ga0105242_10063056 3300009176 Bacteria 3052
219 Ga0105242_10063902 3300009176 Bacteria 3032
220 Ga0105242_10149245 3300009176 Bacteria 2037
221 Ga0105242_10309291 3300009176 Bacteria 1445
222 Ga0105242_10992483 3300009176 Bacteria 847
223 Ga0105248_10180439 3300009177 Bacteria 2379
224 Ga0105248_10224207 3300009177 Bacteria 2116
225 Ga0105237_10352345 3300009545 Unclassified 1476
226 Ga0105237_10756803 3300009545 Bacteria 978
227 Ga0105237_10829760 3300009545 Bacteria 931
228 Ga0105249_10003013 3300009553 Bacteria 14529
229 Ga0105249_10018954 3300009553 Bacteria 6133
230 Ga0105249_10034498 3300009553 Bacteria 4586
231 Ga0105249_10114725 3300009553 Bacteria 2551
232 Ga0105249_10155077 3300009553 Unclassified 2208
233 Ga0105249_10547307 3300009553 Bacteria 1208
234 Ga0105249_10549048 3300009553 Bacteria 1206
235 Ga0105249_11172379 3300009553 Unclassified 839
236 Ga0105239_10004628 3300010375 Bacteria 16354
237 Ga0105239_10066520 3300010375 Bacteria 3959
238 Ga0105239_10102411 3300010375 Bacteria 3169
239 Ga0105239_10291577 3300010375 Bacteria 1837
240 Ga0105239_11680976 3300010375 Unclassified 735
241 Ga0105246_10006371 3300011119 Bacteria 7202
242 Ga0105246_10194931 3300011119 Bacteria 1571
243 Ga0105246_10413928 3300011119 Bacteria 1123
244 Ga0105246_10887405 3300011119 Unclassified 798
245 Ga0157373_10173758 3300013100 Bacteria 1516
246 Ga0157371_10316970 3300013102 Bacteria 1131
247 Ga0157370_10071730 3300013104 Bacteria 3268
248 Ga0157370_10245845 3300013104 Bacteria 1655
249 Ga0157374_10001825 3300013296 Bacteria 17957
250 Ga0157374_10029084 3300013296 Bacteria 4999
251 Ga0157374_10045526 3300013296 Unclassified 4061
252 Ga0157374_10104683 3300013296 Bacteria 2717
253 Ga0157378_10021845 3300013297 Bacteria 5627
254 Ga0157378_10069036 3300013297 Bacteria 3170
255 Ga0157378_10251605 3300013297 Bacteria 1692
256 Ga0157378_10363355 3300013297 Bacteria 1417
257 Ga0157378_10599184 3300013297 Bacteria 1113
258 Ga0163162_10001596 3300013306 Bacteria 21205
259 Ga0163162_10009349 3300013306 Bacteria 9532
260 Ga0163162_10035176 3300013306 Bacteria 4988
261 Ga0163162_10143071 3300013306 Unclassified 2506
262 Ga0163162_10223753 3300013306 Bacteria 2011
263 Ga0163162_10745026 3300013306 Unclassified 1099
264 Ga0163162_11132186 3300013306 Bacteria 887
265 Ga0157372_10119344 3300013307 Bacteria 3027
266 Ga0157372_10446020 3300013307 Bacteria 1508
267 Ga0157372_11030309 3300013307 Bacteria 953
268 Ga0157375_10011552 3300013308 Bacteria 7800
269 Ga0157375_10015758 3300013308 Bacteria 6772
270 Ga0157375_10030599 3300013308 Bacteria 5078
271 Ga0157375_10039446 3300013308 Bacteria 4546
272 Ga0157375_10555828 3300013308 Bacteria 1309
273 Ga0163163_10003350 3300014325 Bacteria 13597
274 Ga0163163_10092376 3300014325 Bacteria 3041
275 Ga0163163_10220080 3300014325 Bacteria 1947
276 Ga0163163_10352503 3300014325 Bacteria 1528
277 Ga0163163_11355899 3300014325 Unclassified 773
278 Ga0157380_10000293 3300014326 Bacteria 30049
279 Ga0157380_10522716 3300014326 Bacteria 1158
280 Ga0157377_10190114 3300014745 Bacteria 1297
281 Ga0157377_10196408 3300014745 Bacteria 1278
282 Ga0157379_10043267 3300014968 Bacteria 4021
283 Ga0157379_10471820 3300014968 Bacteria 1161
284 Ga0157376_10006718 3300014969 Bacteria 8144
285 Ga0157376_10108388 3300014969 Bacteria 2440
286 Ga0157376_10187414 3300014969 Bacteria 1895
287 Ga0157376_10318359 3300014969 Bacteria 1478
288 Ga0163161_10151252 3300017792 Bacteria 1764
289 Ga0163161_10224051 3300017792 Bacteria 1457
290 Ga0163161_10226495 3300017792 Bacteria 1449
291 Ga0209436_105234 3300025208 Bacteria 3018
292 Ga0209258_100251 3300025242 Bacteria 97368
293 Ga0209148_1000226 3300025254 Bacteria 92517
294 Ga0209257_1000511 3300025304 Bacteria 67499
295 Ga0207697_10121934 3300025315 Unclassified 1122
296 Ga0207656_10055284 3300025321 Bacteria 1727
297 Ga0207656_10142369 3300025321 Bacteria 1131
298 Ga0207682_10057084 3300025893 Bacteria 1627
299 Ga0207710_10009348 3300025900 Bacteria 4126
300 Ga0207688_10033799 3300025901 Bacteria 2829
301 Ga0207688_10692530 3300025901 Bacteria 644
302 Ga0207680_10024200 3300025903 Bacteria 3328
303 Ga0207680_10131781 3300025903 Bacteria 1648
304 Ga0207680_10187159 3300025903 Bacteria 1403
305 Ga0207645_10002879 3300025907 Bacteria 13311
306 Ga0207645_10037528 3300025907 Bacteria 3109
307 Ga0207645_10135570 3300025907 Unclassified 1603
308 Ga0207645_10167382 3300025907 Unclassified 1439
309 Ga0207643_10004330 3300025908 Bacteria 7632
310 Ga0207643_10069057 3300025908 Bacteria 2030
311 Ga0207643_10279008 3300025908 Bacteria 1036
312 Ga0207643_10421694 3300025908 Bacteria 846
313 Ga0207705_10133270 3300025909 Unclassified 1850
314 Ga0207705_10301810 3300025909 Bacteria 1228
315 Ga0207654_10290943 3300025911 Bacteria 1108
316 Ga0207671_10470923 3300025914 Unclassified 1001
317 Ga0207662_10284289 3300025918 Bacteria 1095
318 Ga0207649_10005554 3300025920 Bacteria 6821
319 Ga0207649_10054122 3300025920 Unclassified 2497
320 Ga0207681_10036739 3300025923 Bacteria 3233
321 Ga0207681_10084594 3300025923 Bacteria 2249
322 Ga0207681_10113307 3300025923 Bacteria 1977
323 Ga0207681_10142943 3300025923 Bacteria 1784
324 Ga0207681_10515518 3300025923 Bacteria 981
325 Ga0207650_10106885 3300025925 Bacteria 2161
326 Ga0207650_10162796 3300025925 Bacteria 1769
327 Ga0207650_10233479 3300025925 Bacteria 1484
328 Ga0207650_10443892 3300025925 Unclassified 1079
329 Ga0207650_10809459 3300025925 Bacteria 794
330 Ga0207659_10056253 3300025926 Bacteria 2817
331 Ga0207659_10071806 3300025926 Bacteria 2528
332 Ga0207659_10246587 3300025926 Bacteria 1447
333 Ga0207659_10249103 3300025926 Bacteria 1441
334 Ga0207659_10690341 3300025926 Unclassified 874
335 Ga0207687_10157042 3300025927 Bacteria 1741
336 Ga0207644_10044133 3300025931 Bacteria 3166
337 Ga0207644_10386664 3300025931 Bacteria 1142
338 Ga0207644_10410397 3300025931 Bacteria 1108
339 Ga0207644_10568443 3300025931 Bacteria 940
340 Ga0207690_10005267 3300025932 Bacteria 7622
341 Ga0207706_10016153 3300025933 Bacteria 6744
342 Ga0207706_10120592 3300025933 Unclassified 2306
343 Ga0207706_10241242 3300025933 Bacteria 1580
344 Ga0207706_10269997 3300025933 Bacteria 1484
345 Ga0207706_10393038 3300025933 Bacteria 1203
346 Ga0207706_10942799 3300025933 Unclassified 727
347 Ga0207686_10039551 3300025934 Bacteria 2862
348 Ga0207686_10119068 3300025934 Bacteria 1794
349 Ga0207686_10241371 3300025934 Bacteria 1315
350 Ga0207670_10003479 3300025936 Bacteria 8358
351 Ga0207670_10135463 3300025936 Bacteria 1810
352 Ga0207670_11231625 3300025936 Unclassified 634
353 Ga0207669_10076018 3300025937 Bacteria 2130
354 Ga0207669_10499385 3300025937 Bacteria 973
355 Ga0207704_10190721 3300025938 Bacteria 1491
356 Ga0207704_10580120 3300025938 Bacteria 915
357 Ga0207704_10589493 3300025938 Unclassified 909
358 Ga0207704_10853215 3300025938 Unclassified 763
359 Ga0207704_10894504 3300025938 Bacteria 746
360 Ga0207691_10000001 3300025940 Bacteria 220829
361 Ga0207691_10007459 3300025940 Bacteria 10530
362 Ga0207691_10010295 3300025940 Bacteria 8970
363 Ga0207691_10096425 3300025940 Bacteria 2644
364 Ga0207691_10102202 3300025940 Unclassified 2557
365 Ga0207691_10744733 3300025940 Bacteria 825
366 Ga0207711_10877476 3300025941 Bacteria 834
367 Ga0207689_10003798 3300025942 Bacteria 13769
368 Ga0207689_10011904 3300025942 Bacteria 7454
369 Ga0207689_10035662 3300025942 Bacteria 4131
370 Ga0207689_10079168 3300025942 Bacteria 2701
371 Ga0207689_10100471 3300025942 Bacteria 2376
372 Ga0207689_10121587 3300025942 Bacteria 2147
373 Ga0207689_10380115 3300025942 Bacteria 1176
374 Ga0207661_10001165 3300025944 Bacteria 17552
375 Ga0207661_10072726 3300025944 Unclassified 2813
376 Ga0207679_10000182 3300025945 Bacteria 51887
377 Ga0207679_10256836 3300025945 Bacteria 1488
378 Ga0207667_10083884 3300025949 Bacteria 3299
379 Ga0207667_10791229 3300025949 Unclassified 946
380 Ga0207651_10026873 3300025960 Unclassified 3605
381 Ga0207651_10059442 3300025960 Bacteria 2648
382 Ga0207651_10071275 3300025960 Bacteria 2462
383 Ga0207651_10212946 3300025960 Unclassified 1557
384 Ga0207712_10006255 3300025961 Bacteria 7506
385 Ga0207712_10088898 3300025961 Bacteria 2270
386 Ga0207668_10000540 3300025972 Bacteria 23750
387 Ga0207668_10255286 3300025972 Unclassified 1426
388 Ga0207668_10340793 3300025972 Bacteria 1250
389 Ga0207668_10379508 3300025972 Bacteria 1189
390 Ga0207668_11396568 3300025972 Unclassified 631
391 Ga0207640_10034437 3300025981 Bacteria 3161
392 Ga0207640_10330802 3300025981 Bacteria 1217
393 Ga0207658_10000946 3300025986 Bacteria 23945
394 Ga0207658_10058160 3300025986 Unclassified 2876
395 Ga0207658_10096240 3300025986 Bacteria 2308
396 Ga0207658_10345084 3300025986 Bacteria 1295
397 Ga0207658_10998788 3300025986 Bacteria 763
398 Ga0207677_10038522 3300026023 Unclassified 3135
399 Ga0207677_10048874 3300026023 Bacteria 2850
400 Ga0207677_10136989 3300026023 Bacteria 1868
401 Ga0207677_10236771 3300026023 Bacteria 1474
402 Ga0207677_10942519 3300026023 Bacteria 780
403 Ga0207703_10020309 3300026035 Bacteria 5194
404 Ga0207703_10148080 3300026035 Unclassified 2044
405 Ga0207703_10316288 3300026035 Bacteria 1428
406 Ga0207639_10007164 3300026041 Bacteria 7597
407 Ga0207639_10062337 3300026041 Bacteria 2883
408 Ga0207639_10084287 3300026041 Bacteria 2524
409 Ga0207639_10094719 3300026041 Bacteria 2398
410 Ga0207678_11456347 3300026067 Unclassified 605
411 Ga0207708_10186191 3300026075 Bacteria 1650
412 Ga0207641_10014758 3300026088 Bacteria 6405
413 Ga0207641_10875027 3300026088 Bacteria 891
414 Ga0207641_11505794 3300026088 Bacteria 674
415 Ga0207648_10009139 3300026089 Bacteria 9526
416 Ga0207648_10343375 3300026089 Bacteria 1345
417 Ga0207648_10374692 3300026089 Bacteria 1286
418 Ga0207676_10001871 3300026095 Bacteria 15411
419 Ga0207676_10012981 3300026095 Bacteria 5981
420 Ga0207676_10041649 3300026095 Bacteria 3527
421 Ga0207676_10057539 3300026095 Unclassified 3062
422 Ga0207676_11144352 3300026095 Bacteria 770
423 Ga0207674_10003912 3300026116 Bacteria 18125
424 Ga0207674_10018544 3300026116 Bacteria 7560
425 Ga0207674_10025779 3300026116 Bacteria 6262
426 Ga0207674_10253788 3300026116 Bacteria 1706
427 Ga0207674_10424774 3300026116 Bacteria 1284
428 Ga0207674_10712447 3300026116 Bacteria 969
429 Ga0207675_100003235 3300026118 Bacteria 15979
430 Ga0207675_100007524 3300026118 Bacteria 10291
431 Ga0207675_100012344 3300026118 Bacteria 7980
432 Ga0207675_100305901 3300026118 Unclassified 1549
433 Ga0207675_100498626 3300026118 Bacteria 1212
434 Ga0207675_101894285 3300026118 Unclassified 615
435 Ga0207683_10003728 3300026121 Bacteria 13219
436 Ga0207683_10050978 3300026121 Bacteria 3626
437 Ga0207698_10332809 3300026142 Bacteria 1427
438 Ga0207428_10068570 3300027907 Bacteria 2789
439 Ga0268266_10399817 3300028379 Unclassified 1299
440 Ga0268265_10202676 3300028380 Bacteria 1722
441 Ga0268265_10994787 3300028380 Unclassified 828
442 Ga0268264_10006865 3300028381 Bacteria 9557
443 Ga0268264_10036462 3300028381 Bacteria 4052
444 Ga0268264_10193474 3300028381 Bacteria 1856
445 Ga0268264_10277150 3300028381 Bacteria 1569
446 Ga0268264_10289445 3300028381 Bacteria 1538
447 Ga0307515_10002910 3300028794 Bacteria 36374
448 Ga0307513_10442930 3300031456 Bacteria 1025
449 Ga0307509_10031512 3300031507 Bacteria 5854
450 Ga0307509_10123587 3300031507 Bacteria 2560
451 Ga0307508_10003538 3300031616 Bacteria 15745
452 Ga0373954_0362625 3300035118 Bacteria 716
453 Ga0373947_0221174 3300035725 Unclassified 1245
454 Ga0373937_0238220 3300036401 Bacteria 1714
455 Ga0436360_0707485 3300039438 Bacteria 790
456 Ga0451845_0453646 3300041501 Bacteria 807
457 Ga0439441_045108 3300042001 Unclassified 894
458 Ga0439452_063555 3300042010 Unclassified 823
459 Ga0439457_012968 3300042014 Bacteria 1875
460 Ga0439462_0146345 3300042015 Bacteria 663
461 Ga0450894_023793 3300042131 Unclassified 834
462 Ga0450898_002159 3300042134 Bacteria 2721
463 Ga0439434_0212055 3300042435 Bacteria 655
464 Ga0451577_0323641 3300042876 Bacteria 1398
465 Ga0466969_0000366 3300044656 Bacteria 24782
466 Ga0453683_0254242 3300044673 Bacteria 1120
467 Ga0466966_0001023 3300044684 Bacteria 17865
468 Ga0466961_0445252 3300044693 Bacteria 784
469 Ga0466964_0016931 3300044706 Bacteria 2787
470 Ga0453684_0034344 3300044712 Bacteria 7041
471 Ga0453684_0517427 3300044712 Unclassified 1319
472 Ga0466968_0024928 3300044735 Bacteria 2446
473 Ga0466960_0133024 3300044901 Bacteria 1315
474 Ga0466959_0000111 3300045049 Bacteria 52637
475 Ga0495638_0050477 3300046460 Bacteria 2598
476 Ga0495650_0033383 3300046471 Bacteria 2291
477 Ga0495633_0000242 3300046558 Bacteria 66147
478 Ga0495668_0001051 3300046616 Bacteria 29297
479 Ga0495611_0091626 3300046648 Bacteria 1405
480 Ga0495670_0024182 3300046691 Bacteria 3002
481 Ga0495672_0050222 3300047320 Bacteria 2464
482 Ga0495686_0052654 3300047472 Bacteria 2552
483 Ga0495686_0474197 3300047472 Bacteria 662
484 Ga0496104_0326696 3300048907 Bacteria 1447
485 Ga0496104_0383603 3300048907 Bacteria 1318
486 Ga0496108_0314838 3300048911 Bacteria 1364
487 Ga0496109_0243939 3300048912 Bacteria 1691
488 Ga0496110_0215208 3300048913 Bacteria 1747
489 Ga0496110_0230069 3300048913 Bacteria 1686
490 Ga0496112_1015854 3300048915 Unclassified 749
491 Ga0496121_0000007 3300048924 Bacteria 942516
492 Ga0496126_0021576 3300048929 Bacteria 6288
493 Ga0501032_0004165 3300049569 Bacteria 10952
494 Ga0501034_0000373 3300049571 Bacteria 76337
495 Ga0501034_0092927 3300049571 Bacteria 3013
496 Ga0501034_0099932 3300049571 Bacteria 2895
497 Ga0501034_0407731 3300049571 Bacteria 1281
498 Ga0501036_0016096 3300049572 Bacteria 6249
499 Ga0501036_0369326 3300049572 Bacteria 1197
500 Ga0501037_0020497 3300049573 Bacteria 4882
501 Ga0501037_0069714 3300049573 Bacteria 2559
502 Ga0501038_0020550 3300049574 Bacteria 5934
503 Ga0501039_0015555 3300049575 Bacteria 5822
504 Ga0501043_0007078 3300049579 Bacteria 8927
505 Ga0501043_0026871 3300049579 Bacteria 4516
506 Ga0501046_0005802 3300049580 Bacteria 11015
507 Ga0501046_0030272 3300049580 Bacteria 4394
508 Ga0501047_0014553 3300049581 Bacteria 7484
509 Ga0501047_0201544 3300049581 Bacteria 1851
510 Ga0501048_0011618 3300049582 Bacteria 6567
511 Ga0501048_0509340 3300049582 Bacteria 863
512 Ga0501067_0084336 3300049583 Bacteria 1762
513 Ga0501068_0179115 3300049584 Bacteria 1340
514 Ga0501069_0023747 3300049585 Bacteria 3342
515 Ga0501070_0076209 3300049586 Bacteria 2776
516 Ga0501070_0892038 3300049586 Bacteria 694
517 Ga0501071_0068318 3300049587 Bacteria 2586
518 Ga0501072_0123212 3300049588 Bacteria 2065
519 Ga0501072_0358323 3300049588 Bacteria 1158
520 Ga0501073_0018591 3300049589 Bacteria 5023
521 Ga0501073_0064443 3300049589 Bacteria 2555
522 Ga0501074_0001404 3300049590 Bacteria 16033
523 Ga0501080_0030186 3300049742 Bacteria 5049
524 Ga0501080_0201404 3300049742 Bacteria 1828
525 Ga0501083_0004497 3300049744 Bacteria 9847
526 Ga0501083_0015408 3300049744 Bacteria 5353
527 Ga0501035_0020933 3300049822 Bacteria 6010
528 Ga0501035_0311542 3300049822 Bacteria 1324
529 Ga0501044_0007780 3300049823 Bacteria 11782
530 Ga0501044_0091194 3300049823 Bacteria 3074
531 Ga0501044_0124738 3300049823 Bacteria 2573
532 nmdc:mga0k408_226929_c1 3300050493 Bacteria 1115
533 nmdc:mga08y16_11589_c1 3300050511 Bacteria 9265
534 nmdc:mga0n895_531248_c1 3300050512 Bacteria 1183
535 Ga0500644_0000008 3300053088 Bacteria 130338
536 Ga0500646_0007946 3300053090 Bacteria 2712
537 Ga0500583_0161978 3300053092 Bacteria 1114
538 Ga0500651_0218317 3300053093 Bacteria 1119
539 Ga0500660_179313 3300053100 Bacteria 768
540 Ga0500569_000588 3300053109 Bacteria 6150
541 Ga0500607_202673 3300053121 Bacteria 850
542 Ga0500658_0001983 3300053134 Bacteria 8001
543 Ga0500559_0022204 3300053136 Bacteria 2692
544 Ga0500568_0001675 3300053139 Bacteria 13865
545 Ga0500577_0059191 3300053142 Bacteria 1467
546 Ga0500590_021434 3300053148 Bacteria 3354
547 Ga0500622_0000960 3300053156 Bacteria 24468
548 Ga0500627_0076650 3300053158 Bacteria 1487
549 Ga0500633_0154510 3300053160 Bacteria 860
550 Ga0500611_000023 3300053727 Bacteria 102347
551 Ga0501084_0142936 3300054114 Bacteria 2015
552 Ga0500661_008113 3300055283 Bacteria 1931
553 Ga0501082_0107731 3300060353 Bacteria 2411
554 Ga0501082_0146984 3300060353 Bacteria 2046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005262 Ga0065165_1007154 Ga0065165_10071544 150
2 3300010375 Ga0105239_10291577 Ga0105239_102915772 150
3 3300025208 Ga0209436_105234 Ga0209436_1052343 150
4 3300025242 Ga0209258_100251 Ga0209258_10025110 150
5 3300025254 Ga0209148_1000226 Ga0209148_100022669 150
6 3300025304 Ga0209257_1000511 Ga0209257_100051168 150
7 3300048929 Ga0496126_0021576 Ga0496126_0021576_1287_1862 150
8 3300053088 Ga0500644_0000008 Ga0500644_0000008_96422_96997 150
9 3300053090 Ga0500646_0007946 Ga0500646_0007946_1919_2494 150
10 3300053092 Ga0500583_0161978 Ga0500583_0161978_60_635 150
11 3300053100 Ga0500660_179313 Ga0500660_179313_56_631 150
12 3300053109 Ga0500569_000588 Ga0500569_000588_3895_4470 150
13 3300053134 Ga0500658_0001983 Ga0500658_0001983_4733_5308 150
14 3300053136 Ga0500559_0022204 Ga0500559_0022204_114_689 150
15 3300053142 Ga0500577_0059191 Ga0500577_0059191_330_905 150
16 3300053148 Ga0500590_021434 Ga0500590_021434_1906_2481 150
17 3300053156 Ga0500622_0000960 Ga0500622_0000960_8060_8641 150
18 3300053160 Ga0500633_0154510 Ga0500633_0154510_238_813 150
19 3300055283 Ga0500661_008113 Ga0500661_008113_801_1379 150
20 3300048924 Ga0496121_0000007 Ga0496121_0000007_204775_205353 151
21 3300053121 Ga0500607_202673 Ga0500607_202673_73_651 151
22 3300053158 Ga0500627_0076650 Ga0500627_0076650_56_634 151
23 3300046616 Ga0495668_0001051 Ga0495668_0001051_8026_8604 153
24 3300005548 Ga0070665_100211705 Ga0070665_1002117052 155
25 3300025925 Ga0207650_10443892 Ga0207650_104438921 155
26 3300031507 Ga0307509_10123587 Ga0307509_101235872 155
27 3300041501 Ga0451845_0453646 Ga0451845_0453646_54_632 155
28 3300028794 Ga0307515_10002910 Ga0307515_100029102 156
29 3300031456 Ga0307513_10442930 Ga0307513_104429302 156
30 3300005842 Ga0068858_100272403 Ga0068858_1002724031 157
31 3300009545 Ga0105237_10829760 Ga0105237_108297602 157
32 3300010375 Ga0105239_10102411 Ga0105239_101024112 157
33 3300003203 JGI25406J46586_10001257 JGI25406J46586_1000125713 158
34 3300003322 rootL2_10334334 rootL2_103343342 158
35 3300005539 Ga0068853_100058020 Ga0068853_1000580202 158
36 3300026041 Ga0207639_10094719 Ga0207639_100947192 158
37 3300049588 Ga0501072_0123212 Ga0501072_0123212_143_715 158
38 3300005327 Ga0070658_10324112 Ga0070658_103241122 159
39 3300005333 Ga0070677_10243721 Ga0070677_102437212 159
40 3300005367 Ga0070667_100032768 Ga0070667_1000327683 159
41 3300005617 Ga0068859_100027856 Ga0068859_1000278564 159
42 3300005843 Ga0068860_100015281 Ga0068860_1000152814 159
43 3300006931 Ga0097620_100027855 Ga0097620_1000278553 159
44 3300013104 Ga0157370_10245845 Ga0157370_102458452 159
45 3300013297 Ga0157378_10069036 Ga0157378_100690362 159
46 3300025909 Ga0207705_10133270 Ga0207705_101332701 159
47 3300025909 Ga0207705_10301810 Ga0207705_103018102 159
48 3300025986 Ga0207658_10096240 Ga0207658_100962402 159
49 3300026118 Ga0207675_101894285 Ga0207675_1018942851 159
50 3300028381 Ga0268264_10289445 Ga0268264_102894451 159
51 3300031616 Ga0307508_10003538 Ga0307508_1000353815 159
52 3300046558 Ga0495633_0000242 Ga0495633_0000242_9846_10427 159
53 3300053093 Ga0500651_0218317 Ga0500651_0218317_269_850 159
54 3300005543 Ga0070672_100585143 Ga0070672_1005851432 160
55 3300013307 Ga0157372_10446020 Ga0157372_104460202 161
56 3300026116 Ga0207674_10712447 Ga0207674_107124472 161
57 3300042435 Ga0439434_0212055 Ga0439434_0212055_23_589 161
58 3300044673 Ga0453683_0254242 Ga0453683_0254242_213_779 161
59 3300005843 Ga0068860_100048432 Ga0068860_1000484323 162
60 3300014325 Ga0163163_11355899 Ga0163163_113558991 162
61 3300028381 Ga0268264_10036462 Ga0268264_100364623 162
62 3300044656 Ga0466969_0000366 Ga0466969_0000366_19928_20494 162
63 3300044684 Ga0466966_0001023 Ga0466966_0001023_11153_11719 162
64 3300044693 Ga0466961_0445252 Ga0466961_0445252_43_609 162
65 3300044706 Ga0466964_0016931 Ga0466964_0016931_378_944 162
66 3300044735 Ga0466968_0024928 Ga0466968_0024928_1530_2096 162
67 3300045049 Ga0466959_0000111 Ga0466959_0000111_35059_35625 162
68 3300003322 rootL2_10258140 rootL2_102581402 163
69 3300005290 Ga0065712_10004487 Ga0065712_100044872 163
70 3300005330 Ga0070690_100376879 Ga0070690_1003768792 163
71 3300005330 Ga0070690_100673072 Ga0070690_1006730721 163
72 3300005331 Ga0070670_100010996 Ga0070670_1000109962 163
73 3300005334 Ga0068869_100048337 Ga0068869_1000483373 163
74 3300005336 Ga0070680_100688757 Ga0070680_1006887572 163
75 3300005340 Ga0070689_100003471 Ga0070689_1000034712 163
76 3300005344 Ga0070661_100213081 Ga0070661_1002130812 163
77 3300005347 Ga0070668_100109884 Ga0070668_1001098842 163
78 3300005353 Ga0070669_100003999 Ga0070669_1000039996 163
79 3300005354 Ga0070675_100014040 Ga0070675_1000140406 163
80 3300005364 Ga0070673_100077659 Ga0070673_1000776592 163
81 3300005365 Ga0070688_100006097 Ga0070688_1000060976 163
82 3300005441 Ga0070700_100179199 Ga0070700_1001791992 163
83 3300005543 Ga0070672_100089934 Ga0070672_1000899344 163
84 3300005564 Ga0070664_100274181 Ga0070664_1002741812 163
85 3300005577 Ga0068857_100042792 Ga0068857_1000427924 163
86 3300005617 Ga0068859_100434898 Ga0068859_1004348982 163
87 3300005719 Ga0068861_100015292 Ga0068861_1000152926 163
88 3300005840 Ga0068870_10151420 Ga0068870_101514202 163
89 3300005844 Ga0068862_100025761 Ga0068862_1000257612 163
90 3300006931 Ga0097620_100434884 Ga0097620_1004348842 163
91 3300009094 Ga0111539_10006460 Ga0111539_1000646010 163
92 3300009553 Ga0105249_10018954 Ga0105249_100189544 163
93 3300013306 Ga0163162_11132186 Ga0163162_111321862 163
94 3300013308 Ga0157375_10015758 Ga0157375_100157587 163
95 3300014326 Ga0157380_10000293 Ga0157380_100002933 163
96 3300025908 Ga0207643_10069057 Ga0207643_100690572 163
97 3300025918 Ga0207662_10284289 Ga0207662_102842892 163
98 3300025923 Ga0207681_10036739 Ga0207681_100367392 163
99 3300025925 Ga0207650_10106885 Ga0207650_101068852 163
100 3300025926 Ga0207659_10071806 Ga0207659_100718063 163
101 3300025933 Ga0207706_10269997 Ga0207706_102699972 163
102 3300025936 Ga0207670_10135463 Ga0207670_101354632 163
103 3300025938 Ga0207704_10580120 Ga0207704_105801202 163
104 3300025940 Ga0207691_10096425 Ga0207691_100964252 163
105 3300025960 Ga0207651_10059442 Ga0207651_100594422 163
106 3300025972 Ga0207668_10340793 Ga0207668_103407932 163
107 3300026075 Ga0207708_10186191 Ga0207708_101861913 163
108 3300026116 Ga0207674_10018544 Ga0207674_100185445 163
109 3300026118 Ga0207675_100007524 Ga0207675_1000075248 163
110 3300026118 Ga0207675_100305901 Ga0207675_1003059012 163
111 3300027907 Ga0207428_10068570 Ga0207428_100685702 163
112 3300028380 Ga0268265_10994787 Ga0268265_109947871 163
113 3300049571 Ga0501034_0407731 Ga0501034_0407731_159_722 163
114 3300050511 nmdc:mga08y16_11589_c1 nmdc:mga08y16_11589_c1_2085_2654 163
115 3300026041 Ga0207639_10084287 Ga0207639_100842872 164
116 3300039438 Ga0436360_0707485 Ga0436360_0707485_32_616 164
117 3300049571 Ga0501034_0000373 Ga0501034_0000373_10972_11550 164
118 3300049571 Ga0501034_0099932 Ga0501034_0099932_1374_1937 164
119 3300049572 Ga0501036_0369326 Ga0501036_0369326_162_725 164
120 3300049573 Ga0501037_0069714 Ga0501037_0069714_956_1519 164
121 3300049575 Ga0501039_0015555 Ga0501039_0015555_4332_4895 164
122 3300049579 Ga0501043_0026871 Ga0501043_0026871_701_1264 164
123 3300049742 Ga0501080_0201404 Ga0501080_0201404_191_754 164
124 3300049822 Ga0501035_0311542 Ga0501035_0311542_488_1051 164
125 3300049823 Ga0501044_0124738 Ga0501044_0124738_400_963 164
126 3300005466 Ga0070685_10643988 Ga0070685_106439881 165
127 3300026067 Ga0207678_11456347 Ga0207678_114563471 165
128 3300026089 Ga0207648_10374692 Ga0207648_103746922 165
129 3300005328 Ga0070676_10156428 Ga0070676_101564282 166
130 3300005331 Ga0070670_100072920 Ga0070670_1000729202 166
131 3300005333 Ga0070677_10134731 Ga0070677_101347312 166
132 3300005334 Ga0068869_100064099 Ga0068869_1000640993 166
133 3300005335 Ga0070666_10159028 Ga0070666_101590282 166
134 3300005338 Ga0068868_100006675 Ga0068868_1000066756 166
135 3300005340 Ga0070689_101145746 Ga0070689_1011457461 166
136 3300005347 Ga0070668_100222751 Ga0070668_1002227512 166
137 3300005353 Ga0070669_100106930 Ga0070669_1001069302 166
138 3300005356 Ga0070674_100043035 Ga0070674_1000430353 166
139 3300005364 Ga0070673_100026833 Ga0070673_1000268334 166
140 3300005367 Ga0070667_100975543 Ga0070667_1009755431 166
141 3300005455 Ga0070663_100086111 Ga0070663_1000861112 166
142 3300005456 Ga0070678_100109976 Ga0070678_1001099762 166
143 3300005459 Ga0068867_100215220 Ga0068867_1002152202 166
144 3300005466 Ga0070685_10377225 Ga0070685_103772252 166
145 3300005539 Ga0068853_100008084 Ga0068853_1000080845 166
146 3300005543 Ga0070672_100316512 Ga0070672_1003165122 166
147 3300005548 Ga0070665_100612965 Ga0070665_1006129652 166
148 3300005578 Ga0068854_100558498 Ga0068854_1005584982 166
149 3300005617 Ga0068859_100211162 Ga0068859_1002111622 166
150 3300005718 Ga0068866_10069681 Ga0068866_100696812 166
151 3300005718 Ga0068866_10353302 Ga0068866_103533022 166
152 3300005840 Ga0068870_10031399 Ga0068870_100313992 166
153 3300005843 Ga0068860_100454390 Ga0068860_1004543902 166
154 3300005844 Ga0068862_100737505 Ga0068862_1007375052 166
155 3300006237 Ga0097621_100128878 Ga0097621_1001288782 166
156 3300006358 Ga0068871_100071779 Ga0068871_1000717792 166
157 3300006881 Ga0068865_100213055 Ga0068865_1002130552 166
158 3300006931 Ga0097620_100211161 Ga0097620_1002111612 166
159 3300009098 Ga0105245_10558359 Ga0105245_105583592 166
160 3300009174 Ga0105241_11012057 Ga0105241_110120571 166
161 3300009176 Ga0105242_10063056 Ga0105242_100630562 166
162 3300009553 Ga0105249_10547307 Ga0105249_105473072 166
163 3300011119 Ga0105246_10006371 Ga0105246_100063712 166
164 3300013297 Ga0157378_10363355 Ga0157378_103633552 166
165 3300017792 Ga0163161_10151252 Ga0163161_101512522 166
166 3300025893 Ga0207682_10057084 Ga0207682_100570841 166
167 3300025901 Ga0207688_10033799 Ga0207688_100337993 166
168 3300025907 Ga0207645_10002879 Ga0207645_100028795 166
169 3300025908 Ga0207643_10004330 Ga0207643_100043302 166
170 3300025923 Ga0207681_10113307 Ga0207681_101133072 166
171 3300025925 Ga0207650_10162796 Ga0207650_101627962 166
172 3300025931 Ga0207644_10568443 Ga0207644_105684431 166
173 3300025934 Ga0207686_10119068 Ga0207686_101190682 166
174 3300025934 Ga0207686_10241371 Ga0207686_102413712 166
175 3300025937 Ga0207669_10076018 Ga0207669_100760182 166
176 3300025940 Ga0207691_10010295 Ga0207691_100102958 166
177 3300025942 Ga0207689_10003798 Ga0207689_100037989 166
178 3300025942 Ga0207689_10380115 Ga0207689_103801152 166
179 3300026023 Ga0207677_10236771 Ga0207677_102367712 166
180 3300026116 Ga0207674_10424774 Ga0207674_104247742 166
181 3300026118 Ga0207675_100498626 Ga0207675_1004986262 166
182 3300026121 Ga0207683_10003728 Ga0207683_100037287 166
183 3300005331 Ga0070670_100659810 Ga0070670_1006598102 167
184 3300005841 Ga0068863_100757358 Ga0068863_1007573582 167
185 3300009093 Ga0105240_10081908 Ga0105240_100819082 167
186 3300010375 Ga0105239_10004628 Ga0105239_1000462810 167
187 3300011119 Ga0105246_10194931 Ga0105246_101949312 167
188 3300025925 Ga0207650_10809459 Ga0207650_108094592 167
189 3300025942 Ga0207689_10079168 Ga0207689_100791683 167
190 3300026088 Ga0207641_10875027 Ga0207641_108750271 167
191 3300031507 Ga0307509_10031512 Ga0307509_100315123 167
192 3300049571 Ga0501034_0092927 Ga0501034_0092927_1144_1713 167
193 3300049580 Ga0501046_0030272 Ga0501046_0030272_1409_1978 167
194 3300049581 Ga0501047_0201544 Ga0501047_0201544_622_1191 167
195 3300049582 Ga0501048_0509340 Ga0501048_0509340_255_824 167
196 3300049585 Ga0501069_0023747 Ga0501069_0023747_1009_1578 167
197 3300049586 Ga0501070_0076209 Ga0501070_0076209_964_1533 167
198 3300049587 Ga0501071_0068318 Ga0501071_0068318_1080_1649 167
199 3300049588 Ga0501072_0358323 Ga0501072_0358323_237_806 167
200 3300049589 Ga0501073_0064443 Ga0501073_0064443_905_1474 167
201 3300049744 Ga0501083_0015408 Ga0501083_0015408_3325_3894 167
202 3300049823 Ga0501044_0091194 Ga0501044_0091194_807_1376 167
203 3300060353 Ga0501082_0146984 Ga0501082_0146984_807_1376 167
204 3300005617 Ga0068859_100808013 Ga0068859_1008080132 168
205 3300006931 Ga0097620_100808025 Ga0097620_1008080251 168
206 3300005985 Ga0081539_10039690 Ga0081539_100396902 169
207 3300006195 Ga0075366_10036958 Ga0075366_100369582 169
208 3300014325 Ga0163163_10352503 Ga0163163_103525032 169
209 3300042010 Ga0439452_063555 Ga0439452_063555_202_771 169
210 3300047472 Ga0495686_0052654 Ga0495686_0052654_895_1467 169
211 3300050493 nmdc:mga0k408_226929_c1 nmdc:mga0k408_226929_c1_28_597 169
212 3300025901 Ga0207688_10692530 Ga0207688_106925301 170
213 3300005334 Ga0068869_100091335 Ga0068869_1000913352 171
214 3300005347 Ga0070668_100022048 Ga0070668_1000220484 171
215 3300005353 Ga0070669_100568112 Ga0070669_1005681122 171
216 3300005367 Ga0070667_100734750 Ga0070667_1007347501 171
217 3300005459 Ga0068867_100687816 Ga0068867_1006878162 171
218 3300005539 Ga0068853_100684779 Ga0068853_1006847791 171
219 3300005578 Ga0068854_100258554 Ga0068854_1002585543 171
220 3300005719 Ga0068861_100014462 Ga0068861_1000144623 171
221 3300005844 Ga0068862_100535839 Ga0068862_1005358392 171
222 3300025942 Ga0207689_10121587 Ga0207689_101215872 171
223 3300025972 Ga0207668_10379508 Ga0207668_103795082 171
224 3300025981 Ga0207640_10330802 Ga0207640_103308022 171
225 3300026118 Ga0207675_100012344 Ga0207675_1000123446 171
226 3300005543 Ga0070672_100054588 Ga0070672_1000545882 173
227 3300025926 Ga0207659_10246587 Ga0207659_102465872 173
228 3300025940 Ga0207691_10007459 Ga0207691_100074597 173
229 3300014326 Ga0157380_10522716 Ga0157380_105227162 175
230 3300005290 Ga0065712_10301762 Ga0065712_103017622 176
231 3300005328 Ga0070676_10021643 Ga0070676_100216432 176
232 3300005328 Ga0070676_10058522 Ga0070676_100585223 176
233 3300005329 Ga0070683_100000369 Ga0070683_10000036927 176
234 3300005329 Ga0070683_100193910 Ga0070683_1001939102 176
235 3300005334 Ga0068869_100118168 Ga0068869_1001181682 176
236 3300005334 Ga0068869_100339703 Ga0068869_1003397032 176
237 3300005334 Ga0068869_100729722 Ga0068869_1007297222 176
238 3300005335 Ga0070666_10001617 Ga0070666_100016172 176
239 3300005335 Ga0070666_10008505 Ga0070666_100085055 176
240 3300005335 Ga0070666_10397366 Ga0070666_103973662 176
241 3300005337 Ga0070682_100011786 Ga0070682_1000117863 176
242 3300005337 Ga0070682_100736830 Ga0070682_1007368301 176
243 3300005338 Ga0068868_100016880 Ga0068868_1000168805 176
244 3300005338 Ga0068868_100018242 Ga0068868_1000182422 176
245 3300005338 Ga0068868_100024235 Ga0068868_1000242353 176
246 3300005338 Ga0068868_100059109 Ga0068868_1000591093 176
247 3300005338 Ga0068868_100927980 Ga0068868_1009279801 176
248 3300005339 Ga0070660_100272866 Ga0070660_1002728662 176
249 3300005340 Ga0070689_100014706 Ga0070689_1000147062 176
250 3300005340 Ga0070689_100053777 Ga0070689_1000537773 176
251 3300005343 Ga0070687_100228310 Ga0070687_1002283102 176
252 3300005344 Ga0070661_100002729 Ga0070661_1000027295 176
253 3300005344 Ga0070661_100003755 Ga0070661_1000037558 176
254 3300005344 Ga0070661_100637115 Ga0070661_1006371151 176
255 3300005345 Ga0070692_10273153 Ga0070692_102731532 176
256 3300005347 Ga0070668_100013739 Ga0070668_1000137395 176
257 3300005347 Ga0070668_100322517 Ga0070668_1003225172 176
258 3300005347 Ga0070668_100612326 Ga0070668_1006123261 176
259 3300005347 Ga0070668_100648630 Ga0070668_1006486301 176
260 3300005354 Ga0070675_100052633 Ga0070675_1000526333 176
261 3300005355 Ga0070671_100132135 Ga0070671_1001321352 176
262 3300005355 Ga0070671_100568999 Ga0070671_1005689992 176
263 3300005364 Ga0070673_100104377 Ga0070673_1001043773 176
264 3300005365 Ga0070688_100012285 Ga0070688_1000122852 176
265 3300005365 Ga0070688_100041914 Ga0070688_1000419142 176
266 3300005366 Ga0070659_100005516 Ga0070659_1000055168 176
267 3300005366 Ga0070659_100491837 Ga0070659_1004918372 176
268 3300005367 Ga0070667_100000492 Ga0070667_1000004923 176
269 3300005367 Ga0070667_100154961 Ga0070667_1001549612 176
270 3300005367 Ga0070667_100407931 Ga0070667_1004079312 176
271 3300005456 Ga0070678_100006435 Ga0070678_1000064352 176
272 3300005456 Ga0070678_100073843 Ga0070678_1000738431 176
273 3300005457 Ga0070662_100003002 Ga0070662_1000030025 176
274 3300005457 Ga0070662_100017476 Ga0070662_1000174761 176
275 3300005457 Ga0070662_100040148 Ga0070662_1000401482 176
276 3300005457 Ga0070662_100187140 Ga0070662_1001871402 176
277 3300005459 Ga0068867_100062935 Ga0068867_1000629352 176
278 3300005535 Ga0070684_100009153 Ga0070684_1000091535 176
279 3300005535 Ga0070684_100057258 Ga0070684_1000572582 176
280 3300005539 Ga0068853_100013550 Ga0068853_1000135502 176
281 3300005539 Ga0068853_100016523 Ga0068853_1000165236 176
282 3300005543 Ga0070672_100002526 Ga0070672_10000252612 176
283 3300005543 Ga0070672_100448565 Ga0070672_1004485652 176
284 3300005544 Ga0070686_100049218 Ga0070686_1000492182 176
285 3300005544 Ga0070686_100277386 Ga0070686_1002773862 176
286 3300005545 Ga0070695_100243757 Ga0070695_1002437571 176
287 3300005547 Ga0070693_100190124 Ga0070693_1001901242 176
288 3300005547 Ga0070693_100397306 Ga0070693_1003973061 176
289 3300005548 Ga0070665_100006195 Ga0070665_1000061952 176
290 3300005563 Ga0068855_100142435 Ga0068855_1001424352 176
291 3300005563 Ga0068855_100609091 Ga0068855_1006090912 176
292 3300005564 Ga0070664_100010950 Ga0070664_1000109503 176
293 3300005577 Ga0068857_100001073 Ga0068857_10000107320 176
294 3300005577 Ga0068857_100048276 Ga0068857_1000482764 176
295 3300005577 Ga0068857_100108124 Ga0068857_1001081242 176
296 3300005577 Ga0068857_100231549 Ga0068857_1002315492 176
297 3300005578 Ga0068854_100014556 Ga0068854_1000145565 176
298 3300005578 Ga0068854_100205887 Ga0068854_1002058872 176
299 3300005616 Ga0068852_100067650 Ga0068852_1000676502 176
300 3300005617 Ga0068859_100047267 Ga0068859_1000472675 176
301 3300005617 Ga0068859_100049111 Ga0068859_1000491111 176
302 3300005617 Ga0068859_100167569 Ga0068859_1001675692 176
303 3300005617 Ga0068859_100417024 Ga0068859_1004170241 176
304 3300005617 Ga0068859_100704028 Ga0068859_1007040281 176
305 3300005618 Ga0068864_100002625 Ga0068864_1000026252 176
306 3300005618 Ga0068864_100088821 Ga0068864_1000888212 176
307 3300005618 Ga0068864_100309884 Ga0068864_1003098842 176
308 3300005834 Ga0068851_10018455 Ga0068851_100184553 176
309 3300005834 Ga0068851_10167349 Ga0068851_101673492 176
310 3300005841 Ga0068863_100041642 Ga0068863_1000416423 176
311 3300005841 Ga0068863_100207573 Ga0068863_1002075732 176
312 3300005842 Ga0068858_100009282 Ga0068858_1000092827 176
313 3300005843 Ga0068860_100102965 Ga0068860_1001029652 176
314 3300006237 Ga0097621_100050613 Ga0097621_1000506133 176
315 3300006237 Ga0097621_100056954 Ga0097621_1000569543 176
316 3300006237 Ga0097621_100277107 Ga0097621_1002771072 176
317 3300006358 Ga0068871_100054812 Ga0068871_1000548121 176
318 3300006358 Ga0068871_100401550 Ga0068871_1004015502 176
319 3300006871 Ga0075434_100541707 Ga0075434_1005417072 176
320 3300006881 Ga0068865_100019896 Ga0068865_1000198963 176
321 3300006881 Ga0068865_100211217 Ga0068865_1002112172 176
322 3300006881 Ga0068865_100440485 Ga0068865_1004404852 176
323 3300006931 Ga0097620_100047273 Ga0097620_1000472735 176
324 3300006931 Ga0097620_100049111 Ga0097620_1000491111 176
325 3300006931 Ga0097620_100167570 Ga0097620_1001675702 176
326 3300006931 Ga0097620_100417053 Ga0097620_1004170531 176
327 3300006931 Ga0097620_100704037 Ga0097620_1007040371 176
328 3300009011 Ga0105251_10189359 Ga0105251_101893592 176
329 3300009093 Ga0105240_10219871 Ga0105240_102198712 176
330 3300009098 Ga0105245_10917911 Ga0105245_109179112 176
331 3300009098 Ga0105245_11131557 Ga0105245_111315572 176
332 3300009101 Ga0105247_10014543 Ga0105247_100145432 176
333 3300009174 Ga0105241_10145168 Ga0105241_101451682 176
334 3300009176 Ga0105242_10063902 Ga0105242_100639023 176
335 3300009176 Ga0105242_10149245 Ga0105242_101492452 176
336 3300009176 Ga0105242_10309291 Ga0105242_103092912 176
337 3300009177 Ga0105248_10180439 Ga0105248_101804393 176
338 3300009177 Ga0105248_10224207 Ga0105248_102242073 176
339 3300009545 Ga0105237_10352345 Ga0105237_103523452 176
340 3300009545 Ga0105237_10756803 Ga0105237_107568032 176
341 3300009553 Ga0105249_10155077 Ga0105249_101550772 176
342 3300009553 Ga0105249_10549048 Ga0105249_105490482 176
343 3300009553 Ga0105249_11172379 Ga0105249_111723791 176
344 3300010375 Ga0105239_10066520 Ga0105239_100665204 176
345 3300010375 Ga0105239_11680976 Ga0105239_116809762 176
346 3300011119 Ga0105246_10413928 Ga0105246_104139282 176
347 3300013100 Ga0157373_10173758 Ga0157373_101737582 176
348 3300013102 Ga0157371_10316970 Ga0157371_103169702 176
349 3300013296 Ga0157374_10001825 Ga0157374_1000182520 176
350 3300013296 Ga0157374_10029084 Ga0157374_100290844 176
351 3300013296 Ga0157374_10045526 Ga0157374_100455264 176
352 3300013296 Ga0157374_10104683 Ga0157374_101046832 176
353 3300013297 Ga0157378_10021845 Ga0157378_100218452 176
354 3300013297 Ga0157378_10251605 Ga0157378_102516052 176
355 3300013297 Ga0157378_10599184 Ga0157378_105991842 176
356 3300013306 Ga0163162_10001596 Ga0163162_1000159618 176
357 3300013306 Ga0163162_10009349 Ga0163162_100093496 176
358 3300013306 Ga0163162_10035176 Ga0163162_100351766 176
359 3300013306 Ga0163162_10143071 Ga0163162_101430713 176
360 3300013306 Ga0163162_10223753 Ga0163162_102237532 176
361 3300013306 Ga0163162_10745026 Ga0163162_107450262 176
362 3300013307 Ga0157372_11030309 Ga0157372_110303092 176
363 3300013308 Ga0157375_10011552 Ga0157375_100115527 176
364 3300013308 Ga0157375_10030599 Ga0157375_100305995 176
365 3300013308 Ga0157375_10039446 Ga0157375_100394463 176
366 3300013308 Ga0157375_10555828 Ga0157375_105558282 176
367 3300014325 Ga0163163_10003350 Ga0163163_1000335010 176
368 3300014325 Ga0163163_10092376 Ga0163163_100923762 176
369 3300014745 Ga0157377_10190114 Ga0157377_101901142 176
370 3300014745 Ga0157377_10196408 Ga0157377_101964081 176
371 3300014968 Ga0157379_10043267 Ga0157379_100432672 176
372 3300014968 Ga0157379_10471820 Ga0157379_104718202 176
373 3300014969 Ga0157376_10006718 Ga0157376_100067182 176
374 3300014969 Ga0157376_10108388 Ga0157376_101083882 176
375 3300014969 Ga0157376_10187414 Ga0157376_101874142 176
376 3300017792 Ga0163161_10224051 Ga0163161_102240512 176
377 3300017792 Ga0163161_10226495 Ga0163161_102264952 176
378 3300025315 Ga0207697_10121934 Ga0207697_101219341 176
379 3300025321 Ga0207656_10055284 Ga0207656_100552842 176
380 3300025903 Ga0207680_10024200 Ga0207680_100242003 176
381 3300025903 Ga0207680_10187159 Ga0207680_101871592 176
382 3300025907 Ga0207645_10037528 Ga0207645_100375282 176
383 3300025907 Ga0207645_10167382 Ga0207645_101673822 176
384 3300025908 Ga0207643_10279008 Ga0207643_102790081 176
385 3300025911 Ga0207654_10290943 Ga0207654_102909432 176
386 3300025914 Ga0207671_10470923 Ga0207671_104709232 176
387 3300025920 Ga0207649_10005554 Ga0207649_100055543 176
388 3300025920 Ga0207649_10054122 Ga0207649_100541222 176
389 3300025923 Ga0207681_10515518 Ga0207681_105155181 176
390 3300025926 Ga0207659_10056253 Ga0207659_100562534 176
391 3300025926 Ga0207659_10249103 Ga0207659_102491032 176
392 3300025927 Ga0207687_10157042 Ga0207687_101570421 176
393 3300025931 Ga0207644_10044133 Ga0207644_100441331 176
394 3300025931 Ga0207644_10386664 Ga0207644_103866642 176
395 3300025931 Ga0207644_10410397 Ga0207644_104103971 176
396 3300025932 Ga0207690_10005267 Ga0207690_100052676 176
397 3300025933 Ga0207706_10016153 Ga0207706_100161535 176
398 3300025933 Ga0207706_10120592 Ga0207706_101205922 176
399 3300025933 Ga0207706_10241242 Ga0207706_102412422 176
400 3300025933 Ga0207706_10393038 Ga0207706_103930381 176
401 3300025933 Ga0207706_10942799 Ga0207706_109427991 176
402 3300025934 Ga0207686_10039551 Ga0207686_100395511 176
403 3300025936 Ga0207670_10003479 Ga0207670_100034794 176
404 3300025936 Ga0207670_11231625 Ga0207670_112316251 176
405 3300025938 Ga0207704_10589493 Ga0207704_105894932 176
406 3300025938 Ga0207704_10853215 Ga0207704_108532151 176
407 3300025938 Ga0207704_10894504 Ga0207704_108945041 176
408 3300025940 Ga0207691_10000001 Ga0207691_1000000112 176
409 3300025940 Ga0207691_10102202 Ga0207691_101022022 176
410 3300025940 Ga0207691_10744733 Ga0207691_107447332 176
411 3300025941 Ga0207711_10877476 Ga0207711_108774762 176
412 3300025942 Ga0207689_10011904 Ga0207689_100119045 176
413 3300025942 Ga0207689_10035662 Ga0207689_100356621 176
414 3300025944 Ga0207661_10001165 Ga0207661_1000116515 176
415 3300025944 Ga0207661_10072726 Ga0207661_100727263 176
416 3300025945 Ga0207679_10000182 Ga0207679_1000018229 176
417 3300025945 Ga0207679_10256836 Ga0207679_102568363 176
418 3300025949 Ga0207667_10083884 Ga0207667_100838842 176
419 3300025949 Ga0207667_10791229 Ga0207667_107912292 176
420 3300025960 Ga0207651_10026873 Ga0207651_100268734 176
421 3300025960 Ga0207651_10071275 Ga0207651_100712752 176
422 3300025960 Ga0207651_10212946 Ga0207651_102129462 176
423 3300025972 Ga0207668_10000540 Ga0207668_1000054022 176
424 3300025972 Ga0207668_11396568 Ga0207668_113965681 176
425 3300025981 Ga0207640_10034437 Ga0207640_100344374 176
426 3300025986 Ga0207658_10000946 Ga0207658_1000094620 176
427 3300025986 Ga0207658_10058160 Ga0207658_100581602 176
428 3300025986 Ga0207658_10345084 Ga0207658_103450842 176
429 3300026023 Ga0207677_10038522 Ga0207677_100385222 176
430 3300026023 Ga0207677_10048874 Ga0207677_100488743 176
431 3300026023 Ga0207677_10136989 Ga0207677_101369892 176
432 3300026023 Ga0207677_10942519 Ga0207677_109425191 176
433 3300026035 Ga0207703_10020309 Ga0207703_100203095 176
434 3300026035 Ga0207703_10148080 Ga0207703_101480802 176
435 3300026041 Ga0207639_10007164 Ga0207639_100071645 176
436 3300026088 Ga0207641_10014758 Ga0207641_100147582 176
437 3300026089 Ga0207648_10343375 Ga0207648_103433752 176
438 3300026095 Ga0207676_10001871 Ga0207676_100018716 176
439 3300026095 Ga0207676_10057539 Ga0207676_100575393 176
440 3300026095 Ga0207676_11144352 Ga0207676_111443521 176
441 3300026116 Ga0207674_10003912 Ga0207674_1000391213 176
442 3300026116 Ga0207674_10025779 Ga0207674_100257794 176
443 3300026116 Ga0207674_10253788 Ga0207674_102537882 176
444 3300026121 Ga0207683_10050978 Ga0207683_100509781 176
445 3300026142 Ga0207698_10332809 Ga0207698_103328092 176
446 3300028379 Ga0268266_10399817 Ga0268266_103998172 176
447 3300028381 Ga0268264_10006865 Ga0268264_100068652 176
448 3300028381 Ga0268264_10277150 Ga0268264_102771502 176
449 3300035118 Ga0373954_0362625 Ga0373954_0362625_119_685 176
450 3300036401 Ga0373937_0238220 Ga0373937_0238220_749_1315 176
451 3300044901 Ga0466960_0133024 Ga0466960_0133024_731_1291 176
452 3300046691 Ga0495670_0024182 Ga0495670_0024182_828_1394 176
453 3300047472 Ga0495686_0474197 Ga0495686_0474197_81_644 176
454 3300048907 Ga0496104_0326696 Ga0496104_0326696_858_1430 176
455 3300048907 Ga0496104_0383603 Ga0496104_0383603_496_1068 176
456 3300048911 Ga0496108_0314838 Ga0496108_0314838_537_1109 176
457 3300048912 Ga0496109_0243939 Ga0496109_0243939_205_771 176
458 3300048913 Ga0496110_0215208 Ga0496110_0215208_466_1038 176
459 3300048913 Ga0496110_0230069 Ga0496110_0230069_1127_1672 176
460 3300048915 Ga0496112_1015854 Ga0496112_1015854_60_632 176
461 3300049569 Ga0501032_0004165 Ga0501032_0004165_1661_2233 176
462 3300049572 Ga0501036_0016096 Ga0501036_0016096_3576_4148 176
463 3300049573 Ga0501037_0020497 Ga0501037_0020497_2237_2809 176
464 3300049574 Ga0501038_0020550 Ga0501038_0020550_800_1372 176
465 3300049579 Ga0501043_0007078 Ga0501043_0007078_3302_3874 176
466 3300049580 Ga0501046_0005802 Ga0501046_0005802_7015_7587 176
467 3300049581 Ga0501047_0014553 Ga0501047_0014553_3155_3727 176
468 3300049582 Ga0501048_0011618 Ga0501048_0011618_5777_6349 176
469 3300049583 Ga0501067_0084336 Ga0501067_0084336_606_1178 176
470 3300049584 Ga0501068_0179115 Ga0501068_0179115_273_845 176
471 3300049586 Ga0501070_0892038 Ga0501070_0892038_47_619 176
472 3300049589 Ga0501073_0018591 Ga0501073_0018591_3611_4183 176
473 3300049590 Ga0501074_0001404 Ga0501074_0001404_9828_10400 176
474 3300049742 Ga0501080_0030186 Ga0501080_0030186_1514_2086 176
475 3300049744 Ga0501083_0004497 Ga0501083_0004497_2798_3370 176
476 3300049822 Ga0501035_0020933 Ga0501035_0020933_3869_4441 176
477 3300049823 Ga0501044_0007780 Ga0501044_0007780_1536_2108 176
478 3300050512 nmdc:mga0n895_531248_c1 nmdc:mga0n895_531248_c1_244_819 176
479 3300054114 Ga0501084_0142936 Ga0501084_0142936_1298_1870 176
480 3300060353 Ga0501082_0107731 Ga0501082_0107731_1100_1672 176
481 3300005347 Ga0070668_100139170 Ga0070668_1001391701 177
482 3300005354 Ga0070675_100226947 Ga0070675_1002269471 177
483 3300005459 Ga0068867_100070176 Ga0068867_1000701763 177
484 3300009148 Ga0105243_10099604 Ga0105243_100996042 177
485 3300013104 Ga0157370_10071730 Ga0157370_100717302 177
486 3300025907 Ga0207645_10135570 Ga0207645_101355702 177
487 3300025926 Ga0207659_10690341 Ga0207659_106903411 177
488 3300025938 Ga0207704_10190721 Ga0207704_101907212 177
489 3300025942 Ga0207689_10100471 Ga0207689_101004712 177
490 3300025972 Ga0207668_10255286 Ga0207668_102552862 177
491 3300026088 Ga0207641_11505794 Ga0207641_115057941 177
492 3300026089 Ga0207648_10009139 Ga0207648_100091397 177
493 3300035725 Ga0373947_0221174 Ga0373947_0221174_108_683 177
494 3300044712 Ga0453684_0517427 Ga0453684_0517427_484_1044 177
495 3300046460 Ga0495638_0050477 Ga0495638_0050477_964_1530 177
496 3300046471 Ga0495650_0033383 Ga0495650_0033383_533_1111 177
497 3300053727 Ga0500611_000023 Ga0500611_000023_63443_64009 177
498 3300005331 Ga0070670_100353513 Ga0070670_1003535131 178
499 3300005340 Ga0070689_100324112 Ga0070689_1003241121 178
500 3300005353 Ga0070669_100128298 Ga0070669_1001282981 178
501 3300005617 Ga0068859_100258081 Ga0068859_1002580812 178
502 3300005719 Ga0068861_100003788 Ga0068861_1000037886 178
503 3300006931 Ga0097620_100258069 Ga0097620_1002580692 178
504 3300009176 Ga0105242_10992483 Ga0105242_109924831 178
505 3300014969 Ga0157376_10318359 Ga0157376_103183592 178
506 3300025923 Ga0207681_10084594 Ga0207681_100845942 178
507 3300026118 Ga0207675_100003235 Ga0207675_1000032356 178
508 3300042001 Ga0439441_045108 Ga0439441_045108_182_751 178
509 3300042131 Ga0450894_023793 Ga0450894_023793_245_814 178
510 3300042134 Ga0450898_002159 Ga0450898_002159_1701_2270 178
511 3300046648 Ga0495611_0091626 Ga0495611_0091626_359_928 178
512 3300005288 Ga0065714_10092279 Ga0065714_100922792 179
513 3300005356 Ga0070674_101369363 Ga0070674_1013693631 179
514 3300005535 Ga0070684_100100027 Ga0070684_1001000272 179
515 3300005834 Ga0068851_10213655 Ga0068851_102136551 179
516 3300006844 Ga0075428_100815199 Ga0075428_1008151991 179
517 3300006881 Ga0068865_100893340 Ga0068865_1008933401 179
518 3300025321 Ga0207656_10142369 Ga0207656_101423691 179
519 3300025903 Ga0207680_10131781 Ga0207680_101317811 179
520 3300025937 Ga0207669_10499385 Ga0207669_104993852 179
521 3300026041 Ga0207639_10062337 Ga0207639_100623372 179
522 3300042014 Ga0439457_012968 Ga0439457_012968_1026_1595 179
523 3300042015 Ga0439462_0146345 Ga0439462_0146345_40_609 179
524 3300042876 Ga0451577_0323641 Ga0451577_0323641_801_1376 179
525 3300044712 Ga0453684_0034344 Ga0453684_0034344_2847_3422 179
526 3300047320 Ga0495672_0050222 Ga0495672_0050222_1296_1868 179
527 3300053139 Ga0500568_0001675 Ga0500568_0001675_10097_10669 179
528 3300005367 Ga0070667_100296909 Ga0070667_1002969092 180
529 3300005543 Ga0070672_100514075 Ga0070672_1005140752 180
530 3300005563 Ga0068855_100961455 Ga0068855_1009614551 180
531 3300005618 Ga0068864_100136705 Ga0068864_1001367052 180
532 3300005844 Ga0068862_100173539 Ga0068862_1001735392 180
533 3300009101 Ga0105247_10002173 Ga0105247_100021735 180
534 3300009553 Ga0105249_10003013 Ga0105249_100030133 180
535 3300009553 Ga0105249_10034498 Ga0105249_100344984 180
536 3300011119 Ga0105246_10887405 Ga0105246_108874052 180
537 3300013307 Ga0157372_10119344 Ga0157372_101193441 180
538 3300014325 Ga0163163_10220080 Ga0163163_102200802 180
539 3300025900 Ga0207710_10009348 Ga0207710_100093484 180
540 3300025923 Ga0207681_10142943 Ga0207681_101429432 180
541 3300025961 Ga0207712_10088898 Ga0207712_100888983 180
542 3300025986 Ga0207658_10998788 Ga0207658_109987881 180
543 3300026035 Ga0207703_10316288 Ga0207703_103162882 180
544 3300026095 Ga0207676_10012981 Ga0207676_100129812 180
545 3300028380 Ga0268265_10202676 Ga0268265_102026761 180
546 iso_pu_bacteria 2821136567 2821137830 180
547 iso_pu_bacteria 2904467357 2904467419 180
548 3300002459 JGI24751J29686_10001575 JGI24751J29686_100015753 182
549 3300005331 Ga0070670_100192206 Ga0070670_1001922062 182
550 3300005843 Ga0068860_100106476 Ga0068860_1001064763 182
551 3300009553 Ga0105249_10114725 Ga0105249_101147252 182
552 3300025908 Ga0207643_10421694 Ga0207643_104216942 182
553 3300025925 Ga0207650_10233479 Ga0207650_102334792 182
554 3300025961 Ga0207712_10006255 Ga0207712_100062559 182
555 3300026095 Ga0207676_10041649 Ga0207676_100416495 182
556 3300028381 Ga0268264_10193474 Ga0268264_101934742 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07929

PRiA4_ORF3

Plasmid pRiA4b ORF-3-like protein

22

161

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pv1-assembly1.cif.gz_B crystal structure of the usp15 dusp-ubl domains 0.7065 15 96
5vsz-assembly1.cif.gz_A structure of the ubl domain of sacsin mutant l78m 0.6764 8 85
5c6d-assembly1.cif.gz_A crystal structure of usp7 in complex with uhrf1 0.6752 13 80
5fwi-assembly1.cif.gz_C structure of usp7 catalytic domain and three ubl-domains 0.669 13 80
5c56-assembly1.cif.gz_A crystal structure of usp7/hausp in complex with icp0 0.6685 13 80
ID Description Score Start End Superfamily
af_Q4DC28_9_103_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7496 12 44 3.10.20.90
af_Q54K81_84_162_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7246 12 45 3.10.20.90
4memA02 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.6744 11 96 3.10.20.90
2i1sA00 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;MM3350-like 0.6616 7 144 3.10.290.30
af_Q6K1E7_287_370_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.656 12 88 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A4Q3WA00-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9291 7 111
AF-A0A2E1C056-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9131 7 125
AF-A0A519UBL2-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9075 6 97
AF-A0A4Q5QV42-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.8938 2 136
AF-A0A520TRV6-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.8919 2 126

Feature Viewer

pLDDT pTM Quality
80.28 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map