F463229

General Info

Members Datasets Scaffolds Average Seq Length
556 293 1112 124

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10039518|Ga0316575_100395182
Length 149
Sequence LSGSSARISDTNRGKDKKGGLALARIAGVDLPRRKRIEVGLTYIYGIGPCISKRILQQLSINPDTKTDDLSEVEINSIRKLIDKDYKVEGELRTEVSMNIKRLMDLGSYRGLRHRKSLPVRGQRTSTNARTRKGPRRSAIKKKGGVKKK

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
10 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
81 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
91 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
92 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
93 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
119 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
120 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
121 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
139 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
140 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
141 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
142 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
143 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
144 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
145 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
146 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
147 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
148 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
149 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
153 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
154 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
157 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
158 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
217 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
218 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
219 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
220 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
221 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
222 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
223 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
227 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
228 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
229 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
263 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
264 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
265 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
266 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
267 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
268 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
269 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
270 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
271 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
272 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
273 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
274 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
275 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
276 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
277 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
278 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
279 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
280 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
281 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
282 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
283 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
284 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
285 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
286 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
287 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
288 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
289 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
290 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
291 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
292 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
293 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.45
Metatranscriptomes 26.8
Isolates 5.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 1.08
Rhizoplane 2.16
Rhizosphere 79.5
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10039518 3300031665 Bacteria 1862
2 SwRhRL2b_contig_2194807 2162886007 Bacteria 1205
3 2214800779 2209111006 Bacteria 2080
4 Ga0006759J45824_1055651 3300003163 Bacteria 528
5 Ga0006770J48903_1032151 3300003305 Bacteria 1125
6 rootH2_10088212 3300003320 Bacteria 1950
7 Ga0006562J51391_1003423 3300003578 Bacteria 13910
8 Ga0058860_10114316 3300004801 Bacteria 13584
9 Ga0065717_1001968 3300005276 Bacteria 4650
10 Ga0065716_1002480 3300005277 Bacteria 1749
11 Ga0065714_10025944 3300005288 Bacteria 1249
12 Ga0065714_10042876 3300005288 Bacteria 515
13 Ga0065704_10082398 3300005289 Bacteria 3606
14 Ga0065704_10102101 3300005289 Bacteria 2215
15 Ga0065715_10036832 3300005293 Bacteria 2618
16 Ga0065715_10041344 3300005293 Bacteria 823
17 Ga0065715_10068655 3300005293 Bacteria 502
18 Ga0065715_10163470 3300005293 Bacteria 1593
19 Ga0065715_11166518 3300005293 Bacteria 505
20 Ga0070670_100135400 3300005331 Bacteria 2129
21 Ga0070682_100014403 3300005337 Bacteria 4569
22 Ga0070682_100313456 3300005337 Bacteria 1156
23 Ga0070682_101077147 3300005337 Bacteria 671
24 Ga0070682_101512104 3300005337 Bacteria 578
25 Ga0070692_10963833 3300005345 Bacteria 594
26 Ga0070659_101008212 3300005366 Bacteria 731
27 Ga0070667_100269037 3300005367 Bacteria 1528
28 Ga0070700_101201795 3300005441 Bacteria 633
29 Ga0070694_100043859 3300005444 Bacteria 2992
30 Ga0070685_10260034 3300005466 Bacteria 1154
31 Ga0070684_100076178 3300005535 Bacteria 2961
32 Ga0070693_100169224 3300005547 Bacteria 1398
33 Ga0070693_101062405 3300005547 Bacteria 616
34 Ga0070665_100178604 3300005548 Bacteria 2124
35 Ga0070665_101405649 3300005548 Bacteria 707
36 Ga0068855_100000266 3300005563 Bacteria 65127
37 Ga0068855_100585338 3300005563 Bacteria 1205
38 Ga0068856_100184992 3300005614 Bacteria 2097
39 Ga0068866_11328912 3300005718 Bacteria 523
40 Ga0068861_100150704 3300005719 Bacteria 1908
41 Ga0068870_10096798 3300005840 Bacteria 1660
42 Ga0068863_100605478 3300005841 Bacteria 1085
43 Ga0070716_100062251 3300006173 Bacteria 2163
44 Ga0075362_10012264 3300006177 Bacteria 3401
45 Ga0075366_10454452 3300006195 Bacteria 790
46 Ga0075366_10705138 3300006195 Bacteria 627
47 Ga0097621_100207019 3300006237 Bacteria 1705
48 Ga0097621_101038106 3300006237 Bacteria 768
49 Ga0075370_10246110 3300006353 Bacteria 1059
50 Ga0075428_101191413 3300006844 Bacteria 803
51 Ga0075429_100581559 3300006880 Bacteria 981
52 Ga0075436_100044416 3300006914 Bacteria 3064
53 Ga0099824_1003374 3300006942 Bacteria 23361
54 Ga0079104_1000280 3300006946 Bacteria 65859
55 Ga0099826_10000125 3300006948 Bacteria 34471
56 Ga0105251_10038077 3300009011 Bacteria 2357
57 Ga0105244_10000027 3300009036 Bacteria 207569
58 Ga0105250_10391215 3300009092 Bacteria 615
59 Ga0105240_10294524 3300009093 Bacteria 1859
60 Ga0111539_10052091 3300009094 Bacteria 4873
61 Ga0111539_10414510 3300009094 Bacteria 1569
62 Ga0111539_10610521 3300009094 Bacteria 1270
63 Ga0111539_11817012 3300009094 Bacteria 707
64 Ga0105238_10472531 3300009551 Bacteria 1252
65 Ga0157373_10001369 3300013100 Bacteria 18710
66 Ga0157371_10001678 3300013102 Bacteria 22612
67 Ga0157371_10492659 3300013102 Bacteria 904
68 Ga0157370_10073063 3300013104 Bacteria 3236
69 Ga0157370_10106885 3300013104 Bacteria 2618
70 Ga0157370_10218418 3300013104 Bacteria 1766
71 Ga0157370_10316188 3300013104 Bacteria 1441
72 Ga0157370_11190464 3300013104 Bacteria 688
73 Ga0157370_12059252 3300013104 Bacteria 512
74 Ga0157369_10000613 3300013105 Bacteria 46357
75 Ga0157378_11618085 3300013297 Bacteria 694
76 Ga0163162_10022452 3300013306 Bacteria 6216
77 Ga0157375_11032639 3300013308 Bacteria 960
78 Ga0163163_10624074 3300014325 Bacteria 1141
79 Ga0157380_11594516 3300014326 Bacteria 708
80 Ga0182008_10300387 3300014497 Bacteria 840
81 Ga0157376_10261956 3300014969 Bacteria 1620
82 Ga0182006_1009290 3300015261 Bacteria 4412
83 Ga0182006_1062134 3300015261 Bacteria 1406
84 Ga0182006_1242266 3300015261 Bacteria 592
85 Ga0163161_10000039 3300017792 Bacteria 148130
86 Ga0163161_10009312 3300017792 Bacteria 6794
87 Ga0163161_10317631 3300017792 Bacteria 1230
88 Ga0206356_11535795 3300020070 Bacteria 1012
89 Ga0206351_10991482 3300020077 Bacteria 3143
90 Ga0206352_10855877 3300020078 Bacteria 794
91 Ga0207655_1000038 3300025728 Bacteria 348340
92 Ga0207705_11074582 3300025909 Bacteria 620
93 Ga0207695_10512058 3300025913 Bacteria 1082
94 Ga0207690_10762923 3300025932 Bacteria 798
95 Ga0207704_10563187 3300025938 Bacteria 928
96 Ga0207665_10034201 3300025939 Bacteria 3373
97 Ga0207667_10002028 3300025949 Bacteria 25387
98 Ga0207667_11480608 3300025949 Bacteria 650
99 Ga0207640_10268750 3300025981 Bacteria 1333
100 Ga0207658_10283042 3300025986 Bacteria 1422
101 Ga0207658_10494531 3300025986 Bacteria 1089
102 Ga0207678_10265484 3300026067 Bacteria 1471
103 Ga0207708_10079820 3300026075 Bacteria 2514
104 Ga0207702_10965924 3300026078 Bacteria 845
105 Ga0207641_10489061 3300026088 Bacteria 1194
106 Ga0207641_10549673 3300026088 Bacteria 1126
107 Ga0207675_100142829 3300026118 Bacteria 2275
108 Ga0207675_101412797 3300026118 Bacteria 717
109 Ga0209281_1000337 3300027111 Bacteria 79938
110 Ga0209969_1034203 3300027360 Bacteria 781
111 Ga0209489_111364 3300027361 Bacteria 9138
112 Ga0209968_1030260 3300027526 Bacteria 904
113 Ga0209999_1008578 3300027543 Bacteria 1845
114 Ga0210002_1004025 3300027617 Bacteria 2181
115 Ga0209282_1014100 3300027666 Bacteria 5087
116 Ga0209974_10095230 3300027876 Bacteria 1036
117 Ga0207428_10295979 3300027907 Bacteria 1198
118 Ga0265337_1001901 3300028556 Bacteria 9942
119 Ga0265334_10026835 3300028573 Bacteria 2322
120 Ga0307515_10372371 3300028794 Bacteria 1064
121 Ga0316177_1046974 3300030731 Bacteria 993
122 Ga0316179_1001570 3300030734 Bacteria 581
123 Ga0316183_1071033 3300030742 Bacteria 879
124 Ga0316181_1007760 3300030744 Bacteria 1229
125 Ga0265332_10007637 3300031238 Bacteria 4886
126 Ga0265320_10001512 3300031240 Bacteria 16930
127 Ga0265339_10005033 3300031249 Bacteria 8891
128 Ga0265331_10111421 3300031250 Bacteria 1255
129 Ga0265316_10008237 3300031344 Bacteria 9701
130 Ga0307513_10502075 3300031456 Bacteria 930
131 Ga0307408_100015317 3300031548 Bacteria 5105
132 Ga0307508_10036327 3300031616 Bacteria 4436
133 Ga0316575_10000149 3300031665 Bacteria 17798
134 Ga0316575_10001226 3300031665 Bacteria 8137
135 Ga0316575_10004586 3300031665 Bacteria 4865
136 Ga0316575_10153189 3300031665 Bacteria 952
137 Ga0316575_10163129 3300031665 Bacteria 922
138 Ga0316575_10208125 3300031665 Bacteria 815
139 Ga0316575_10237569 3300031665 Bacteria 763
140 Ga0316579_10002340 3300031691 Bacteria 7159
141 Ga0316579_10024561 3300031691 Bacteria 2715
142 Ga0316579_10052226 3300031691 Bacteria 1914
143 Ga0316579_10073335 3300031691 Bacteria 1624
144 Ga0316579_10183841 3300031691 Bacteria 1011
145 Ga0265314_10000003 3300031711 Bacteria 1653386
146 Ga0265314_10008394 3300031711 Bacteria 8853
147 Ga0265314_10564153 3300031711 Bacteria 591
148 Ga0316576_10004459 3300031727 Bacteria 8400
149 Ga0316576_10102441 3300031727 Bacteria 2141
150 Ga0316576_10181947 3300031727 Bacteria 1585
151 Ga0316576_10217851 3300031727 Bacteria 1436
152 Ga0316576_10483275 3300031727 Bacteria 912
153 Ga0316576_10555152 3300031727 Bacteria 841
154 Ga0316576_10934201 3300031727 Bacteria 620
155 Ga0316578_10000551 3300031728 Bacteria 12895
156 Ga0316578_10018044 3300031728 Bacteria 3856
157 Ga0316578_10023200 3300031728 Bacteria 3471
158 Ga0316578_10031535 3300031728 Bacteria 3020
159 Ga0316578_10036494 3300031728 Bacteria 2828
160 Ga0316578_10045538 3300031728 Bacteria 2554
161 Ga0316578_10083874 3300031728 Bacteria 1898
162 Ga0316578_10276204 3300031728 Bacteria 1006
163 Ga0316578_10324371 3300031728 Bacteria 919
164 Ga0307516_10009446 3300031730 Bacteria 10868
165 Ga0307405_10000005 3300031731 Bacteria 376536
166 Ga0307405_10458504 3300031731 Bacteria 1012
167 Ga0316577_10012414 3300031733 Bacteria 4641
168 Ga0316577_10038851 3300031733 Bacteria 2663
169 Ga0316577_10039079 3300031733 Bacteria 2655
170 Ga0316577_10067164 3300031733 Bacteria 2001
171 Ga0316577_10087820 3300031733 Bacteria 1740
172 Ga0316577_10180186 3300031733 Bacteria 1193
173 Ga0316577_10407017 3300031733 Bacteria 773
174 Ga0307413_10001014 3300031824 Bacteria 10155
175 Ga0307413_10001307 3300031824 Bacteria 9311
176 Ga0307413_11018250 3300031824 Bacteria 711
177 Ga0307410_10000034 3300031852 Bacteria 48449
178 Ga0307406_10000004 3300031901 Bacteria 179772
179 Ga0307407_10000196 3300031903 Bacteria 18233
180 Ga0307412_10007950 3300031911 Bacteria 6045
181 Ga0307412_10014189 3300031911 Bacteria 4692
182 Ga0307416_100010892 3300032002 Bacteria 6031
183 Ga0307414_10000011 3300032004 Bacteria 338253
184 Ga0307414_10000673 3300032004 Bacteria 17502
185 Ga0307414_10019816 3300032004 Bacteria 4178
186 Ga0307414_10043096 3300032004 Bacteria 3071
187 Ga0307414_10125747 3300032004 Bacteria 1980
188 Ga0307414_10315779 3300032004 Bacteria 1328
189 Ga0307414_10402286 3300032004 Bacteria 1189
190 Ga0307411_10000004 3300032005 Bacteria 460327
191 Ga0307411_10189460 3300032005 Bacteria 1569
192 Ga0307411_10855941 3300032005 Bacteria 805
193 Ga0307415_100359982 3300032126 Bacteria 1228
194 Ga0316583_10004307 3300032133 Bacteria 5075
195 Ga0316583_10022138 3300032133 Bacteria 2277
196 Ga0316583_10087149 3300032133 Bacteria 1090
197 Ga0316583_10126206 3300032133 Unclassified 892
198 Ga0316585_10000257 3300032137 Bacteria 11433
199 Ga0316585_10078970 3300032137 Bacteria 1071
200 Ga0316580_10001569 3300032139 Bacteria 6027
201 Ga0316580_10164116 3300032139 Bacteria 682
202 Ga0316580_10219907 3300032139 Unclassified 586
203 Ga0316593_10000043 3300032168 Bacteria 13880
204 Ga0316593_10000056 3300032168 Bacteria 12817
205 Ga0316593_10000122 3300032168 Bacteria 10489
206 Ga0316593_10002146 3300032168 Bacteria 4599
207 Ga0316593_10002854 3300032168 Bacteria 4188
208 Ga0316593_10004277 3300032168 Bacteria 3652
209 Ga0316593_10005053 3300032168 Bacteria 3445
210 Ga0316593_10006583 3300032168 Bacteria 3144
211 Ga0316593_10006629 3300032168 Bacteria 3137
212 Ga0316593_10007530 3300032168 Bacteria 2994
213 Ga0316593_10007701 3300032168 Bacteria 2966
214 Ga0316593_10016226 3300032168 Bacteria 2254
215 Ga0316593_10023631 3300032168 Bacteria 1942
216 Ga0316593_10035501 3300032168 Bacteria 1640
217 Ga0316593_10035731 3300032168 Bacteria 1636
218 Ga0316593_10041560 3300032168 Bacteria 1530
219 Ga0316593_10043846 3300032168 Bacteria 1495
220 Ga0316593_10064721 3300032168 Bacteria 1256
221 Ga0316593_10122060 3300032168 Bacteria 936
222 Ga0316593_10206720 3300032168 Bacteria 727
223 Ga0316593_10253337 3300032168 Bacteria 659
224 Ga0316593_10271923 3300032168 Bacteria 637
225 Ga0316593_10277543 3300032168 Bacteria 631
226 Ga0316593_10285207 3300032168 Bacteria 623
227 Ga0316593_10394852 3300032168 Bacteria 534
228 Ga0316593_10421790 3300032168 Bacteria 518
229 Ga0307510_10030428 3300033180 Bacteria 6119
230 Ga0316592_1007152 3300033524 Bacteria 2172
231 Ga0316592_1007747 3300033524 Bacteria 2103
232 Ga0316592_1013208 3300033524 Bacteria 1700
233 Ga0316592_1052294 3300033524 Bacteria 913
234 Ga0316592_1064707 3300033524 Bacteria 823
235 Ga0316592_1072240 3300033524 Unclassified 781
236 Ga0316592_1082406 3300033524 Bacteria 732
237 Ga0316592_1093090 3300033524 Bacteria 690
238 Ga0316592_1113639 3300033524 Bacteria 627
239 Ga0316592_1149544 3300033524 Unclassified 550
240 Ga0316592_1174028 3300033524 Bacteria 513
241 Ga0316586_1009254 3300033527 Bacteria 1474
242 Ga0316586_1068067 3300033527 Bacteria 653
243 Ga0316588_1000859 3300033528 Bacteria 4615
244 Ga0316588_1001747 3300033528 Bacteria 3653
245 Ga0316588_1003151 3300033528 Bacteria 2970
246 Ga0316588_1006369 3300033528 Unclassified 2357
247 Ga0316588_1020308 3300033528 Bacteria 1503
248 Ga0316588_1020631 3300033528 Bacteria 1493
249 Ga0316588_1021213 3300033528 Bacteria 1477
250 Ga0316588_1026533 3300033528 Bacteria 1342
251 Ga0316588_1049262 3300033528 Bacteria 1020
252 Ga0316588_1056196 3300033528 Bacteria 958
253 Ga0316588_1060942 3300033528 Bacteria 921
254 Ga0316588_1092385 3300033528 Bacteria 754
255 Ga0316588_1130515 3300033528 Bacteria 639
256 Ga0316588_1135850 3300033528 Bacteria 627
257 Ga0316588_1135863 3300033528 Bacteria 627
258 Ga0316588_1146595 3300033528 Unclassified 605
259 Ga0316587_1001245 3300033529 Bacteria 3069
260 Ga0316587_1015125 3300033529 Bacteria 1278
261 Ga0316587_1016011 3300033529 Bacteria 1248
262 Ga0316587_1043626 3300033529 Bacteria 813
263 Ga0316587_1053265 3300033529 Bacteria 744
264 Ga0316587_1053922 3300033529 Bacteria 739
265 Ga0316596_1000192 3300033541 Bacteria 8874
266 Ga0316596_1002183 3300033541 Bacteria 4145
267 Ga0316596_1002659 3300033541 Bacteria 3836
268 Ga0316596_1004036 3300033541 Bacteria 3258
269 Ga0316596_1004099 3300033541 Bacteria 3239
270 Ga0316596_1004371 3300033541 Bacteria 3164
271 Ga0316596_1004901 3300033541 Bacteria 3027
272 Ga0316596_1008012 3300033541 Bacteria 2506
273 Ga0316596_1014240 3300033541 Bacteria 1970
274 Ga0316596_1014588 3300033541 Bacteria 1950
275 Ga0316596_1015153 3300033541 Bacteria 1919
276 Ga0316596_1017794 3300033541 Bacteria 1791
277 Ga0316596_1020030 3300033541 Bacteria 1700
278 Ga0316596_1022113 3300033541 Unclassified 1623
279 Ga0316596_1025419 3300033541 Bacteria 1523
280 Ga0316596_1032416 3300033541 Bacteria 1359
281 Ga0316596_1039234 3300033541 Bacteria 1242
282 Ga0316596_1048342 3300033541 Bacteria 1124
283 Ga0316596_1067865 3300033541 Bacteria 954
284 Ga0316596_1074927 3300033541 Bacteria 907
285 Ga0316596_1077007 3300033541 Bacteria 895
286 Ga0316596_1091092 3300033541 Bacteria 822
287 Ga0316596_1096682 3300033541 Unclassified 797
288 Ga0316596_1120423 3300033541 Bacteria 714
289 Ga0316596_1168651 3300033541 Unclassified 604
290 Ga0316596_1206162 3300033541 Bacteria 548
291 Ga0373936_0091793 3300035113 Bacteria 1274
292 Ga0373945_0399143 3300035116 Bacteria 602
293 Ga0373955_0364387 3300035172 Bacteria 876
294 Ga0316574_0000750 3300035398 Bacteria 13959
295 Ga0316574_0000856 3300035398 Bacteria 13374
296 Ga0316574_0002922 3300035398 Bacteria 8695
297 Ga0316574_0019371 3300035398 Bacteria 4012
298 Ga0316574_0059478 3300035398 Bacteria 2397
299 Ga0316574_0161585 3300035398 Bacteria 1442
300 Ga0316574_0618378 3300035398 Bacteria 668
301 Ga0373935_0267123 3300035692 Bacteria 1201
302 Ga0373927_0262653 3300035695 Bacteria 1135
303 Ga0373937_0413547 3300036401 Bacteria 1280
304 Ga0373937_1612981 3300036401 Bacteria 596
305 Ga0316582_0006527 3300036647 Bacteria 6134
306 Ga0316582_0015300 3300036647 Bacteria 4382
307 Ga0316582_0023472 3300036647 Bacteria 3678
308 Ga0316582_0026898 3300036647 Bacteria 3468
309 Ga0316582_0067307 3300036647 Bacteria 2310
310 Ga0316582_0092797 3300036647 Bacteria 1990
311 Ga0316582_0186537 3300036647 Bacteria 1412
312 Ga0316582_0187204 3300036647 Bacteria 1409
313 Ga0316582_0351306 3300036647 Bacteria 1014
314 Ga0316582_0529583 3300036647 Bacteria 812
315 Ga0316582_0677811 3300036647 Bacteria 709
316 Ga0316582_0797892 3300036647 Bacteria 647
317 Ga0316582_0832147 3300036647 Bacteria 632
318 Ga0316584_0001013 3300036712 Bacteria 16221
319 Ga0316584_0001647 3300036712 Bacteria 13630
320 Ga0316584_0009321 3300036712 Bacteria 6809
321 Ga0316584_0034182 3300036712 Bacteria 3769
322 Ga0316584_0054560 3300036712 Bacteria 2991
323 Ga0316584_0193838 3300036712 Bacteria 1501
324 Ga0316584_0213477 3300036712 Bacteria 1420
325 Ga0316584_0297685 3300036712 Bacteria 1169
326 Ga0316584_0441487 3300036712 Bacteria 922
327 Ga0316584_0455823 3300036712 Bacteria 904
328 Ga0316584_0475142 3300036712 Bacteria 881
329 Ga0316584_0556354 3300036712 Bacteria 800
330 Ga0316584_0562901 3300036712 Unclassified 794
331 Ga0316584_0743775 3300036712 Bacteria 669
332 Ga0316584_0747639 3300036712 Bacteria 667
333 Ga0373925_0036996 3300037068 Bacteria 3602
334 Ga0373925_1064320 3300037068 Unclassified 666
335 Ga0316581_0002103 3300037588 Bacteria 4685
336 Ga0316581_0004683 3300037588 Bacteria 3509
337 Ga0400484_12384 3300038725 Bacteria 5081
338 Ga0400484_44344 3300038725 Bacteria 4672
339 Ga0400490_18978 3300038726 Bacteria 41932
340 Ga0400490_19520 3300038726 Bacteria 4897
341 Ga0400490_20958 3300038726 Bacteria 2883
342 Ga0400490_43141 3300038726 Bacteria 1353
343 Ga0400490_44309 3300038726 Bacteria 1787
344 Ga0400490_48796 3300038726 Bacteria 1056
345 Ga0400491_26970 3300038727 Bacteria 2755
346 Ga0400491_29253 3300038727 Bacteria 8022
347 Ga0400485_07355 3300038735 Bacteria 3551
348 Ga0400485_08047 3300038735 Bacteria 20055
349 Ga0400485_08672 3300038735 Bacteria 18258
350 Ga0400485_19339 3300038735 Bacteria 2888
351 Ga0400488_34896 3300038741 Bacteria 1063
352 Ga0400488_39523 3300038741 Bacteria 3954
353 Ga0400488_57582 3300038741 Bacteria 1769
354 Ga0400488_58717 3300038741 Bacteria 2359
355 Ga0400486_05152 3300038742 Bacteria 15610
356 Ga0400486_09544 3300038742 Bacteria 18982
357 Ga0400486_17114 3300038742 Bacteria 18189
358 Ga0400486_17728 3300038742 Bacteria 12468
359 Ga0400486_32047 3300038742 Bacteria 23991
360 Ga0400483_000987 3300039062 Bacteria 2757
361 Ga0400483_006020 3300039062 Bacteria 1317
362 Ga0400483_023928 3300039062 Bacteria 5426
363 Ga0400483_042851 3300039062 Bacteria 14723
364 Ga0400483_077376 3300039062 Bacteria 8060
365 Ga0400483_127715 3300039062 Bacteria 2344
366 Ga0400483_170096 3300039062 Bacteria 1400
367 Ga0400483_198250 3300039062 Bacteria 18872
368 Ga0400483_228134 3300039062 Bacteria 119181
369 Ga0400483_231578 3300039062 Bacteria 1989
370 Ga0400483_278711 3300039062 Bacteria 5840
371 Ga0400483_281776 3300039062 Bacteria 7321
372 Ga0400483_283849 3300039062 Bacteria 3132
373 Ga0400489_41472 3300039093 Bacteria 14759
374 Ga0400489_66216 3300039093 Bacteria 19270
375 Ga0400489_74615 3300039093 Bacteria 23866
376 Ga0400489_78871 3300039093 Bacteria 1773
377 Ga0400487_03008 3300039110 Bacteria 21586
378 Ga0439447_002479 3300041407 Bacteria 6716
379 Ga0451787_789122 3300041441 Bacteria 643
380 Ga0451789_0960489 3300041443 Bacteria 740
381 Ga0451789_1350685 3300041443 Bacteria 531
382 Ga0451791_0489072 3300041451 Bacteria 1708
383 Ga0451797_1408326 3300041453 Bacteria 597
384 Ga0451795_1044940 3300041456 Bacteria 2963
385 Ga0451804_1059666 3300041463 Bacteria 1135
386 Ga0451807_0815463 3300041486 Bacteria 625
387 Ga0451807_2557317 3300041486 Bacteria 513
388 Ga0451835_0820626 3300041492 Bacteria 1224
389 Ga0451837_1056715 3300041494 Bacteria 8321
390 Ga0451837_1067335 3300041494 Bacteria 913
391 Ga0451841_0293830 3300041498 Bacteria 1508
392 Ga0451849_0167691 3300041505 Bacteria 1753
393 Ga0451855_1626854 3300041511 Bacteria 818
394 Ga0451853_1266368 3300041512 Bacteria 15952
395 Ga0439445_0010667 3300042004 Bacteria 2179
396 Ga0439445_0023087 3300042004 Bacteria 1573
397 Ga0439445_0036329 3300042004 Bacteria 1296
398 Ga0439462_0072003 3300042015 Bacteria 939
399 Ga0453683_0016045 3300044673 Bacteria 4840
400 Ga0453684_0287491 3300044712 Bacteria 1873
401 Ga0466971_0061064 3300044719 Bacteria 1704
402 Ga0466960_0032952 3300044901 Bacteria 2404
403 Ga0451576_0087476 3300045051 Bacteria 3241
404 Ga0495629_0227354 3300046459 Bacteria 1286
405 Ga0495641_0369011 3300046461 Bacteria 650
406 Ga0495606_0029837 3300046507 Bacteria 3822
407 Ga0495616_0108615 3300046513 Bacteria 1291
408 Ga0495637_0302890 3300046520 Bacteria 567
409 Ga0495643_0000294 3300046522 Bacteria 70329
410 Ga0495625_0001933 3300046660 Bacteria 23424
411 Ga0495635_0477578 3300046663 Bacteria 822
412 Ga0495581_0055694 3300047315 Bacteria 2282
413 Ga0495680_0042938 3300047322 Bacteria 3584
414 Ga0496104_0957742 3300048907 Bacteria 760
415 Ga0496104_1122216 3300048907 Bacteria 690
416 Ga0496112_0553523 3300048915 Bacteria 1084
417 Ga0496116_0000024 3300048919 Bacteria 471420
418 Ga0496121_0183138 3300048924 Bacteria 1509
419 Ga0496124_0114008 3300048927 Bacteria 2171
420 Ga0496125_0000018 3300048928 Bacteria 482390
421 Ga0496126_0042425 3300048929 Bacteria 4201
422 Ga0501306_023205 3300049127 Bacteria 880
423 Ga0501308_017823 3300049128 Bacteria 863
424 Ga0501308_030746 3300049128 Bacteria 719
425 Ga0501308_048743 3300049128 Bacteria 615
426 Ga0501308_049029 3300049128 Bacteria 614
427 Ga0501309_003714 3300049129 Bacteria 1744
428 Ga0501309_062175 3300049129 Bacteria 602
429 Ga0501309_079744 3300049129 Bacteria 548
430 Ga0501310_000149 3300049130 Bacteria 6887
431 Ga0501310_004978 3300049130 Bacteria 1353
432 Ga0501304_030933 3300049160 Bacteria 569
433 Ga0501305_013720 3300049161 Bacteria 1124
434 Ga0501305_114416 3300049161 Bacteria 513
435 Ga0501307_073219 3300049162 Bacteria 549
436 Ga0501311_036860 3300049527 Bacteria 728
437 Ga0501312_026996 3300049528 Bacteria 883
438 Ga0501313_016480 3300049529 Bacteria 888
439 Ga0501314_000001 3300049530 Bacteria 13837
440 Ga0501315_012969 3300049531 Bacteria 1038
441 Ga0501317_021128 3300049533 Bacteria 882
442 Ga0501317_043954 3300049533 Bacteria 691
443 Ga0501318_070968 3300049534 Bacteria 550
444 Ga0501319_000002 3300049535 Bacteria 13675
445 Ga0501319_002658 3300049535 Bacteria 1147
446 Ga0501320_000034 3300049536 Bacteria 6599
447 Ga0501320_011798 3300049536 Bacteria 910
448 Ga0501320_062180 3300049536 Bacteria 527
449 Ga0501321_003707 3300049537 Bacteria 1418
450 Ga0501321_008244 3300049537 Bacteria 1101
451 Ga0501322_000883 3300049538 Bacteria 1552
452 Ga0501323_000002 3300049539 Bacteria 14311
453 Ga0501323_000262 3300049539 Bacteria 3548
454 Ga0501324_000002 3300049540 Bacteria 14212
455 Ga0501324_003406 3300049540 Bacteria 1219
456 Ga0501325_000056 3300049541 Bacteria 3420
457 Ga0501326_00020 3300049542 Bacteria 5374
458 Ga0501326_08365 3300049542 Bacteria 601
459 Ga0501334_09915 3300049550 Bacteria 682
460 Ga0501337_000031 3300049553 Bacteria 5086
461 Ga0501338_00373 3300049554 Bacteria 1952
462 Ga0501034_0608328 3300049571 Bacteria 998
463 Ga0501034_0623976 3300049571 Bacteria 982
464 Ga0501047_0084224 3300049581 Bacteria 3056
465 Ga0501068_0429905 3300049584 Bacteria 853
466 Ga0501068_0696199 3300049584 Bacteria 664
467 Ga0501071_0056652 3300049587 Bacteria 2832
468 Ga0501071_0103016 3300049587 Bacteria 2105
469 Ga0501073_0014090 3300049589 Bacteria 5809
470 Ga0501198_084902 3300049649 Bacteria 619
471 Ga0501206_009610 3300049653 Bacteria 1288
472 Ga0501224_004359 3300049664 Bacteria 2011
473 Ga0501238_000015 3300049671 Bacteria 31964
474 Ga0501238_039361 3300049671 Bacteria 694
475 Ga0501243_049477 3300049675 Bacteria 755
476 Ga0501249_049003 3300049679 Bacteria 967
477 Ga0501257_101886 3300049686 Bacteria 755
478 Ga0501225_0055346 3300049705 Bacteria 1110
479 Ga0501080_0465292 3300049742 Bacteria 1132
480 Ga0501080_0465697 3300049742 Bacteria 1132
481 Ga0501083_0140231 3300049744 Bacteria 1583
482 Ga0501241_003188 3300049758 Bacteria 3112
483 Ga0501264_003780 3300049761 Bacteria 1375
484 Ga0501266_000002 3300049763 Bacteria 459947
485 Ga0501280_000239 3300049776 Bacteria 13899
486 Ga0501035_0018430 3300049822 Bacteria 6432
487 Ga0501044_0271959 3300049823 Bacteria 1630
488 nmdc:mga03683_92426_c1 3300050489 Bacteria 1321
489 nmdc:mga0k408_3991_c1 3300050493 Bacteria 7823
490 nmdc:mga06z11_535695_c1 3300050494 Bacteria 710
491 nmdc:mga07m45_279368_c1 3300050496 Bacteria 971
492 nmdc:mga09592_513237_c1 3300050508 Bacteria 1031
493 nmdc:mga08y16_1326928_c1 3300050511 Bacteria 685
494 nmdc:mga08y16_410335_c1 3300050511 Bacteria 1385
495 nmdc:mga08y16_74608_c1 3300050511 Bacteria 3535
496 Ga0500646_0004786 3300053090 Bacteria 3426
497 Ga0500646_0014057 3300053090 Bacteria 2076
498 Ga0500641_0000168 3300053096 Bacteria 24462
499 Ga0500641_0005947 3300053096 Bacteria 4321
500 Ga0500555_036277 3300053103 Bacteria 1383
501 Ga0500594_0276513 3300053118 Bacteria 561
502 Ga0500658_0000002 3300053134 Bacteria 548440
503 Ga0500589_068495 3300053147 Bacteria 1611
504 Ga0500622_0185057 3300053156 Bacteria 959
505 Ga0500627_0268068 3300053158 Bacteria 752
506 Ga0501084_0044143 3300054114 Bacteria 3731
507 Ga0501084_1115176 3300054114 Bacteria 662
508 Ga0590071_123555 3300059421 Bacteria 662
509 Ga0590077_007344 3300059426 Bacteria 2254
510 Ga0587084_017085 3300059477 Bacteria 1044
511 Ga0587070_001039 3300059491 Bacteria 2697
512 Ga0587092_136762 3300059512 Bacteria 536
513 Ga0587098_014745 3300059604 Bacteria 925
514 Ga0587125_001517 3300059607 Bacteria 1697
515 Ga0587101_081945 3300059623 Bacteria 613
516 Ga0587109_001894 3300059624 Bacteria 2557
517 Ga0587062_000268 3300059639 Bacteria 3294
518 Ga0587068_006892 3300059641 Bacteria 1606
519 Ga0587068_022134 3300059641 Bacteria 1051
520 Ga0587072_000911 3300059643 Bacteria 3390
521 Ga0587108_001667 3300059653 Bacteria 1398
522 Ga0587108_027930 3300059653 Bacteria 566
523 Ga0587124_000839 3300059660 Bacteria 1842
524 Ga0587111_0000650 3300060346 Bacteria 3551
525 2513232386 2513020052 Bacteria 5120511
526 2520879551 2519899754 Bacteria 5336938
527 2644009212 2643221600 Bacteria 5530138
528 2644373949 2643221667 Bacteria 5627472
529 2644643919 2643221716 Bacteria 4986332
530 2644681814 2643221725 Bacteria 5087956
531 2738733049 2738541279 Bacteria 6149495
532 2738765587 2738541285 Bacteria 6150075
533 2739214630 2738543007 Bacteria 6149845
534 2740002855 2739367857 Bacteria 5433684
535 2740007672 2739367858 Bacteria 5432813
536 2802655277 2802428842 Bacteria 4926114
537 2817413530 2816332280 Bacteria 5109718
538 2857617067 2857613821 Bacteria 4917088
539 2857619736 2857618242 Bacteria 5635925
540 2881364120 2881359912 Bacteria 4935907
541 2903898679 2903895155 Bacteria 5258610
542 2904422381 2904419702 Bacteria 5166287
543 2904558513 2904555929 Bacteria 5218588
544 2919194239 2919191525 Bacteria 5765973
545 2919511844 2919509842 Bacteria 4104664
546 2919684597 2919683626 Bacteria 5534354
547 2929150586 2929150217 Bacteria 5462483
548 2958461983 2958458903 Bacteria 5301041
549 2958514516 2958512119 Bacteria 4528530
550 2965321940 2965320100 Bacteria 3975600
551 2977272058 2977268062 Bacteria 5243061
552 8036739247 8036736890 Bacteria 2944828
553 8054311447 8054307821 Bacteria 5212224
554 8055423565 8055419101 Bacteria 5289643
555 8055595081 8055592153 Bacteria 5961247
556 8056443500 8056440228 Bacteria 4946504
557 Ga0316575_10039518
558 SwRhRL2b_contig_2194807
559 2214800779
560 Ga0006759J45824_1055651
561 Ga0006770J48903_1032151
562 rootH2_10088212
563 Ga0006562J51391_1003423
564 Ga0058860_10114316
565 Ga0065717_1001968
566 Ga0065716_1002480
567 Ga0065714_10025944
568 Ga0065714_10042876
569 Ga0065704_10082398
570 Ga0065704_10102101
571 Ga0065715_10036832
572 Ga0065715_10041344
573 Ga0065715_10068655
574 Ga0065715_10163470
575 Ga0065715_11166518
576 Ga0070670_100135400
577 Ga0070682_100014403
578 Ga0070682_100313456
579 Ga0070682_101077147
580 Ga0070682_101512104
581 Ga0070692_10963833
582 Ga0070659_101008212
583 Ga0070667_100269037
584 Ga0070700_101201795
585 Ga0070694_100043859
586 Ga0070685_10260034
587 Ga0070684_100076178
588 Ga0070693_100169224
589 Ga0070693_101062405
590 Ga0070665_100178604
591 Ga0070665_101405649
592 Ga0068855_100000266
593 Ga0068855_100585338
594 Ga0068856_100184992
595 Ga0068866_11328912
596 Ga0068861_100150704
597 Ga0068870_10096798
598 Ga0068863_100605478
599 Ga0070716_100062251
600 Ga0075362_10012264
601 Ga0075366_10454452
602 Ga0075366_10705138
603 Ga0097621_100207019
604 Ga0097621_101038106
605 Ga0075370_10246110
606 Ga0075428_101191413
607 Ga0075429_100581559
608 Ga0075436_100044416
609 Ga0099824_1003374
610 Ga0079104_1000280
611 Ga0099826_10000125
612 Ga0105251_10038077
613 Ga0105244_10000027
614 Ga0105250_10391215
615 Ga0105240_10294524
616 Ga0111539_10052091
617 Ga0111539_10414510
618 Ga0111539_10610521
619 Ga0111539_11817012
620 Ga0105238_10472531
621 Ga0157373_10001369
622 Ga0157371_10001678
623 Ga0157371_10492659
624 Ga0157370_10073063
625 Ga0157370_10106885
626 Ga0157370_10218418
627 Ga0157370_10316188
628 Ga0157370_11190464
629 Ga0157370_12059252
630 Ga0157369_10000613
631 Ga0157378_11618085
632 Ga0163162_10022452
633 Ga0157375_11032639
634 Ga0163163_10624074
635 Ga0157380_11594516
636 Ga0182008_10300387
637 Ga0157376_10261956
638 Ga0182006_1009290
639 Ga0182006_1062134
640 Ga0182006_1242266
641 Ga0163161_10000039
642 Ga0163161_10009312
643 Ga0163161_10317631
644 Ga0206356_11535795
645 Ga0206351_10991482
646 Ga0206352_10855877
647 Ga0207655_1000038
648 Ga0207705_11074582
649 Ga0207695_10512058
650 Ga0207690_10762923
651 Ga0207704_10563187
652 Ga0207665_10034201
653 Ga0207667_10002028
654 Ga0207667_11480608
655 Ga0207640_10268750
656 Ga0207658_10283042
657 Ga0207658_10494531
658 Ga0207678_10265484
659 Ga0207708_10079820
660 Ga0207702_10965924
661 Ga0207641_10489061
662 Ga0207641_10549673
663 Ga0207675_100142829
664 Ga0207675_101412797
665 Ga0209281_1000337
666 Ga0209969_1034203
667 Ga0209489_111364
668 Ga0209968_1030260
669 Ga0209999_1008578
670 Ga0210002_1004025
671 Ga0209282_1014100
672 Ga0209974_10095230
673 Ga0207428_10295979
674 Ga0265337_1001901
675 Ga0265334_10026835
676 Ga0307515_10372371
677 Ga0316177_1046974
678 Ga0316179_1001570
679 Ga0316183_1071033
680 Ga0316181_1007760
681 Ga0265332_10007637
682 Ga0265320_10001512
683 Ga0265339_10005033
684 Ga0265331_10111421
685 Ga0265316_10008237
686 Ga0307513_10502075
687 Ga0307408_100015317
688 Ga0307508_10036327
689 Ga0316575_10000149
690 Ga0316575_10001226
691 Ga0316575_10004586
692 Ga0316575_10153189
693 Ga0316575_10163129
694 Ga0316575_10208125
695 Ga0316575_10237569
696 Ga0316579_10002340
697 Ga0316579_10024561
698 Ga0316579_10052226
699 Ga0316579_10073335
700 Ga0316579_10183841
701 Ga0265314_10000003
702 Ga0265314_10008394
703 Ga0265314_10564153
704 Ga0316576_10004459
705 Ga0316576_10102441
706 Ga0316576_10181947
707 Ga0316576_10217851
708 Ga0316576_10483275
709 Ga0316576_10555152
710 Ga0316576_10934201
711 Ga0316578_10000551
712 Ga0316578_10018044
713 Ga0316578_10023200
714 Ga0316578_10031535
715 Ga0316578_10036494
716 Ga0316578_10045538
717 Ga0316578_10083874
718 Ga0316578_10276204
719 Ga0316578_10324371
720 Ga0307516_10009446
721 Ga0307405_10000005
722 Ga0307405_10458504
723 Ga0316577_10012414
724 Ga0316577_10038851
725 Ga0316577_10039079
726 Ga0316577_10067164
727 Ga0316577_10087820
728 Ga0316577_10180186
729 Ga0316577_10407017
730 Ga0307413_10001014
731 Ga0307413_10001307
732 Ga0307413_11018250
733 Ga0307410_10000034
734 Ga0307406_10000004
735 Ga0307407_10000196
736 Ga0307412_10007950
737 Ga0307412_10014189
738 Ga0307416_100010892
739 Ga0307414_10000011
740 Ga0307414_10000673
741 Ga0307414_10019816
742 Ga0307414_10043096
743 Ga0307414_10125747
744 Ga0307414_10315779
745 Ga0307414_10402286
746 Ga0307411_10000004
747 Ga0307411_10189460
748 Ga0307411_10855941
749 Ga0307415_100359982
750 Ga0316583_10004307
751 Ga0316583_10022138
752 Ga0316583_10087149
753 Ga0316583_10126206
754 Ga0316585_10000257
755 Ga0316585_10078970
756 Ga0316580_10001569
757 Ga0316580_10164116
758 Ga0316580_10219907
759 Ga0316593_10000043
760 Ga0316593_10000056
761 Ga0316593_10000122
762 Ga0316593_10002146
763 Ga0316593_10002854
764 Ga0316593_10004277
765 Ga0316593_10005053
766 Ga0316593_10006583
767 Ga0316593_10006629
768 Ga0316593_10007530
769 Ga0316593_10007701
770 Ga0316593_10016226
771 Ga0316593_10023631
772 Ga0316593_10035501
773 Ga0316593_10035731
774 Ga0316593_10041560
775 Ga0316593_10043846
776 Ga0316593_10064721
777 Ga0316593_10122060
778 Ga0316593_10206720
779 Ga0316593_10253337
780 Ga0316593_10271923
781 Ga0316593_10277543
782 Ga0316593_10285207
783 Ga0316593_10394852
784 Ga0316593_10421790
785 Ga0307510_10030428
786 Ga0316592_1007152
787 Ga0316592_1007747
788 Ga0316592_1013208
789 Ga0316592_1052294
790 Ga0316592_1064707
791 Ga0316592_1072240
792 Ga0316592_1082406
793 Ga0316592_1093090
794 Ga0316592_1113639
795 Ga0316592_1149544
796 Ga0316592_1174028
797 Ga0316586_1009254
798 Ga0316586_1068067
799 Ga0316588_1000859
800 Ga0316588_1001747
801 Ga0316588_1003151
802 Ga0316588_1006369
803 Ga0316588_1020308
804 Ga0316588_1020631
805 Ga0316588_1021213
806 Ga0316588_1026533
807 Ga0316588_1049262
808 Ga0316588_1056196
809 Ga0316588_1060942
810 Ga0316588_1092385
811 Ga0316588_1130515
812 Ga0316588_1135850
813 Ga0316588_1135863
814 Ga0316588_1146595
815 Ga0316587_1001245
816 Ga0316587_1015125
817 Ga0316587_1016011
818 Ga0316587_1043626
819 Ga0316587_1053265
820 Ga0316587_1053922
821 Ga0316596_1000192
822 Ga0316596_1002183
823 Ga0316596_1002659
824 Ga0316596_1004036
825 Ga0316596_1004099
826 Ga0316596_1004371
827 Ga0316596_1004901
828 Ga0316596_1008012
829 Ga0316596_1014240
830 Ga0316596_1014588
831 Ga0316596_1015153
832 Ga0316596_1017794
833 Ga0316596_1020030
834 Ga0316596_1022113
835 Ga0316596_1025419
836 Ga0316596_1032416
837 Ga0316596_1039234
838 Ga0316596_1048342
839 Ga0316596_1067865
840 Ga0316596_1074927
841 Ga0316596_1077007
842 Ga0316596_1091092
843 Ga0316596_1096682
844 Ga0316596_1120423
845 Ga0316596_1168651
846 Ga0316596_1206162
847 Ga0373936_0091793
848 Ga0373945_0399143
849 Ga0373955_0364387
850 Ga0316574_0000750
851 Ga0316574_0000856
852 Ga0316574_0002922
853 Ga0316574_0019371
854 Ga0316574_0059478
855 Ga0316574_0161585
856 Ga0316574_0618378
857 Ga0373935_0267123
858 Ga0373927_0262653
859 Ga0373937_0413547
860 Ga0373937_1612981
861 Ga0316582_0006527
862 Ga0316582_0015300
863 Ga0316582_0023472
864 Ga0316582_0026898
865 Ga0316582_0067307
866 Ga0316582_0092797
867 Ga0316582_0186537
868 Ga0316582_0187204
869 Ga0316582_0351306
870 Ga0316582_0529583
871 Ga0316582_0677811
872 Ga0316582_0797892
873 Ga0316582_0832147
874 Ga0316584_0001013
875 Ga0316584_0001647
876 Ga0316584_0009321
877 Ga0316584_0034182
878 Ga0316584_0054560
879 Ga0316584_0193838
880 Ga0316584_0213477
881 Ga0316584_0297685
882 Ga0316584_0441487
883 Ga0316584_0455823
884 Ga0316584_0475142
885 Ga0316584_0556354
886 Ga0316584_0562901
887 Ga0316584_0743775
888 Ga0316584_0747639
889 Ga0373925_0036996
890 Ga0373925_1064320
891 Ga0316581_0002103
892 Ga0316581_0004683
893 Ga0400484_12384
894 Ga0400484_44344
895 Ga0400490_18978
896 Ga0400490_19520
897 Ga0400490_20958
898 Ga0400490_43141
899 Ga0400490_44309
900 Ga0400490_48796
901 Ga0400491_26970
902 Ga0400491_29253
903 Ga0400485_07355
904 Ga0400485_08047
905 Ga0400485_08672
906 Ga0400485_19339
907 Ga0400488_34896
908 Ga0400488_39523
909 Ga0400488_57582
910 Ga0400488_58717
911 Ga0400486_05152
912 Ga0400486_09544
913 Ga0400486_17114
914 Ga0400486_17728
915 Ga0400486_32047
916 Ga0400483_000987
917 Ga0400483_006020
918 Ga0400483_023928
919 Ga0400483_042851
920 Ga0400483_077376
921 Ga0400483_127715
922 Ga0400483_170096
923 Ga0400483_198250
924 Ga0400483_228134
925 Ga0400483_231578
926 Ga0400483_278711
927 Ga0400483_281776
928 Ga0400483_283849
929 Ga0400489_41472
930 Ga0400489_66216
931 Ga0400489_74615
932 Ga0400489_78871
933 Ga0400487_03008
934 Ga0439447_002479
935 Ga0451787_789122
936 Ga0451789_0960489
937 Ga0451789_1350685
938 Ga0451791_0489072
939 Ga0451797_1408326
940 Ga0451795_1044940
941 Ga0451804_1059666
942 Ga0451807_0815463
943 Ga0451807_2557317
944 Ga0451835_0820626
945 Ga0451837_1056715
946 Ga0451837_1067335
947 Ga0451841_0293830
948 Ga0451849_0167691
949 Ga0451855_1626854
950 Ga0451853_1266368
951 Ga0439445_0010667
952 Ga0439445_0023087
953 Ga0439445_0036329
954 Ga0439462_0072003
955 Ga0453683_0016045
956 Ga0453684_0287491
957 Ga0466971_0061064
958 Ga0466960_0032952
959 Ga0451576_0087476
960 Ga0495629_0227354
961 Ga0495641_0369011
962 Ga0495606_0029837
963 Ga0495616_0108615
964 Ga0495637_0302890
965 Ga0495643_0000294
966 Ga0495625_0001933
967 Ga0495635_0477578
968 Ga0495581_0055694
969 Ga0495680_0042938
970 Ga0496104_0957742
971 Ga0496104_1122216
972 Ga0496112_0553523
973 Ga0496116_0000024
974 Ga0496121_0183138
975 Ga0496124_0114008
976 Ga0496125_0000018
977 Ga0496126_0042425
978 Ga0501306_023205
979 Ga0501308_017823
980 Ga0501308_030746
981 Ga0501308_048743
982 Ga0501308_049029
983 Ga0501309_003714
984 Ga0501309_062175
985 Ga0501309_079744
986 Ga0501310_000149
987 Ga0501310_004978
988 Ga0501304_030933
989 Ga0501305_013720
990 Ga0501305_114416
991 Ga0501307_073219
992 Ga0501311_036860
993 Ga0501312_026996
994 Ga0501313_016480
995 Ga0501314_000001
996 Ga0501315_012969
997 Ga0501317_021128
998 Ga0501317_043954
999 Ga0501318_070968
1000 Ga0501319_000002
1001 Ga0501319_002658
1002 Ga0501320_000034
1003 Ga0501320_011798
1004 Ga0501320_062180
1005 Ga0501321_003707
1006 Ga0501321_008244
1007 Ga0501322_000883
1008 Ga0501323_000002
1009 Ga0501323_000262
1010 Ga0501324_000002
1011 Ga0501324_003406
1012 Ga0501325_000056
1013 Ga0501326_00020
1014 Ga0501326_08365
1015 Ga0501334_09915
1016 Ga0501337_000031
1017 Ga0501338_00373
1018 Ga0501034_0608328
1019 Ga0501034_0623976
1020 Ga0501047_0084224
1021 Ga0501068_0429905
1022 Ga0501068_0696199
1023 Ga0501071_0056652
1024 Ga0501071_0103016
1025 Ga0501073_0014090
1026 Ga0501198_084902
1027 Ga0501206_009610
1028 Ga0501224_004359
1029 Ga0501238_000015
1030 Ga0501238_039361
1031 Ga0501243_049477
1032 Ga0501249_049003
1033 Ga0501257_101886
1034 Ga0501225_0055346
1035 Ga0501080_0465292
1036 Ga0501080_0465697
1037 Ga0501083_0140231
1038 Ga0501241_003188
1039 Ga0501264_003780
1040 Ga0501266_000002
1041 Ga0501280_000239
1042 Ga0501035_0018430
1043 Ga0501044_0271959
1044 nmdc:mga03683_92426_c1
1045 nmdc:mga0k408_3991_c1
1046 nmdc:mga06z11_535695_c1
1047 nmdc:mga07m45_279368_c1
1048 nmdc:mga09592_513237_c1
1049 nmdc:mga08y16_1326928_c1
1050 nmdc:mga08y16_410335_c1
1051 nmdc:mga08y16_74608_c1
1052 Ga0500646_0004786
1053 Ga0500646_0014057
1054 Ga0500641_0000168
1055 Ga0500641_0005947
1056 Ga0500555_036277
1057 Ga0500594_0276513
1058 Ga0500658_0000002
1059 Ga0500589_068495
1060 Ga0500622_0185057
1061 Ga0500627_0268068
1062 Ga0501084_0044143
1063 Ga0501084_1115176
1064 Ga0590071_123555
1065 Ga0590077_007344
1066 Ga0587084_017085
1067 Ga0587070_001039
1068 Ga0587092_136762
1069 Ga0587098_014745
1070 Ga0587125_001517
1071 Ga0587101_081945
1072 Ga0587109_001894
1073 Ga0587062_000268
1074 Ga0587068_006892
1075 Ga0587068_022134
1076 Ga0587072_000911
1077 Ga0587108_001667
1078 Ga0587108_027930
1079 Ga0587124_000839
1080 Ga0587111_0000650
1081 2513232386
1082 2520879551
1083 2644009212
1084 2644373949
1085 2644643919
1086 2644681814
1087 2738733049
1088 2738765587
1089 2739214630
1090 2740002855
1091 2740007672
1092 2802655277
1093 2817413530
1094 2857617067
1095 2857619736
1096 2881364120
1097 2903898679
1098 2904422381
1099 2904558513
1100 2919194239
1101 2919511844
1102 2919684597
1103 2929150586
1104 2958461983
1105 2958514516
1106 2965321940
1107 2977272058
1108 8036739247
1109 8054311447
1110 8055423565
1111 8055595081
1112 8056443500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

25

131

0.99

Map