F463258

General Info

Members Datasets Scaffolds Average Seq Length
556 297 1112 224

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0139165|Ga0501076_0139165_1009_1839
Length 266
Sequence VAVRGLSGDESSVRDDGIAATTGRRGVSGHTLGSASAIRPAFYALAPGGWRDYVTLLHPPYTAWHLSYVVIGAALAPRFDVVRLGAALSAFALAVGIGAHALDELNGRPLRTRIPRRVLVSLAAVVGSVTAEPWLGAFVGAGAFVVVAYNLELAGGRFHTDTWFALSWGGFPLLTTYFACAGEIRLEGVLGAAFATALSLGQRRLSTQVRDARRRVVAASGTVERLDGTVEPLTRERLTAPAEDALRALALAVAXXXCALVAARVA

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
142 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
188 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
189 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 2687453737 Frankia sp. BMG5.36 Isolate Nodule
297 2895880812 Frankia sp. BMG5.11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.18
Rhizoplane 7.73
Rhizosphere 90.29
Stem 0
Stem Tuber 0
Unclassified 12.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0139165 3300049592 Bacteria 1972
2 JGI24744J21845_10000505 3300002077 Bacteria 6953
3 rootH1_10246067 3300003323 Bacteria 1221
4 JGI25407J50210_10010825 3300003373 Bacteria 2325
5 Ga0070666_10058013 3300005335 Bacteria 2617
6 Ga0070666_10195199 3300005335 Unclassified 1423
7 Ga0070680_100025939 3300005336 Bacteria 4687
8 Ga0070680_100250493 3300005336 Bacteria 1497
9 Ga0070682_100003625 3300005337 Bacteria 8562
10 Ga0070682_100110764 3300005337 Bacteria 1829
11 Ga0068868_100033268 3300005338 Bacteria 3973
12 Ga0070660_100008595 3300005339 Bacteria 7148
13 Ga0070689_100107935 3300005340 Bacteria 2211
14 Ga0070687_100101250 3300005343 Bacteria 1613
15 Ga0070692_10003201 3300005345 Bacteria 6585
16 Ga0070668_100011757 3300005347 Bacteria 6518
17 Ga0070671_100059114 3300005355 Unclassified 3190
18 Ga0070674_100001495 3300005356 Bacteria 12454
19 Ga0070674_100043861 3300005356 Bacteria 3045
20 Ga0070673_100212573 3300005364 Bacteria 1671
21 Ga0070688_100008128 3300005365 Bacteria 5685
22 Ga0070659_100016084 3300005366 Bacteria 5613
23 Ga0070703_10094102 3300005406 Unclassified 1044
24 Ga0070709_10010649 3300005434 Bacteria 5100
25 Ga0070709_10017142 3300005434 Bacteria 4147
26 Ga0070714_100010073 3300005435 Bacteria 7457
27 Ga0070714_100037087 3300005435 Bacteria 4094
28 Ga0070714_100174360 3300005435 Bacteria 1953
29 Ga0070713_100006856 3300005436 Bacteria 7940
30 Ga0070713_100036262 3300005436 Bacteria 3978
31 Ga0070710_10008348 3300005437 Bacteria 5040
32 Ga0070701_10000635 3300005438 Bacteria 12309
33 Ga0070711_100021217 3300005439 Bacteria 4195
34 Ga0070711_100037382 3300005439 Bacteria 3258
35 Ga0070711_100239665 3300005439 Bacteria 1418
36 Ga0070705_100052223 3300005440 Bacteria 2387
37 Ga0070700_100007743 3300005441 Bacteria 5817
38 Ga0070694_100532331 3300005444 Bacteria 939
39 Ga0070708_100009274 3300005445 Bacteria 7931
40 Ga0070708_100009362 3300005445 Bacteria 7896
41 Ga0070708_100012134 3300005445 Bacteria 7024
42 Ga0070708_100142553 3300005445 Unclassified 2223
43 Ga0070663_100016371 3300005455 Bacteria 4814
44 Ga0070678_100001440 3300005456 Bacteria 12678
45 Ga0070678_100088258 3300005456 Bacteria 2370
46 Ga0070662_100119892 3300005457 Bacteria 2015
47 Ga0068867_100002296 3300005459 Bacteria 13445
48 Ga0070685_10001240 3300005466 Bacteria 13557
49 Ga0070706_100006302 3300005467 Bacteria 11210
50 Ga0070706_100143396 3300005467 Bacteria 2230
51 Ga0070707_100007620 3300005468 Bacteria 10054
52 Ga0070698_100049611 3300005471 Unclassified 4282
53 Ga0070698_100122209 3300005471 Bacteria 2563
54 Ga0070679_100065204 3300005530 Bacteria 3630
55 Ga0070697_100230163 3300005536 Unclassified 1581
56 Ga0070697_100433548 3300005536 Unclassified 1143
57 Ga0068853_100013374 3300005539 Bacteria 6698
58 Ga0070672_100010742 3300005543 Bacteria 6361
59 Ga0070686_100000541 3300005544 Bacteria 22572
60 Ga0070686_100433948 3300005544 Bacteria 1006
61 Ga0070695_100000485 3300005545 Bacteria 20704
62 Ga0070695_100158783 3300005545 Bacteria 1585
63 Ga0070696_100014166 3300005546 Bacteria 5351
64 Ga0070696_100169382 3300005546 Unclassified 1614
65 Ga0070693_100103864 3300005547 Archaea 1736
66 Ga0070665_100009491 3300005548 Bacteria 9842
67 Ga0070704_100060580 3300005549 Bacteria 2704
68 Ga0070704_100161541 3300005549 Bacteria 1772
69 Ga0068855_100060362 3300005563 Bacteria 4435
70 Ga0068854_100069944 3300005578 Bacteria 2564
71 Ga0068856_100002949 3300005614 Bacteria 17441
72 Ga0068856_100245195 3300005614 Bacteria 1807
73 Ga0070702_100017737 3300005615 Bacteria 3679
74 Ga0068866_10002211 3300005718 Bacteria 8080
75 Ga0068861_100060398 3300005719 Bacteria 2905
76 Ga0068858_100112938 3300005842 Bacteria 2537
77 Ga0068860_100639397 3300005843 Bacteria 1071
78 Ga0068862_100047575 3300005844 Bacteria 3661
79 Ga0081455_10001471 3300005937 Bacteria 29176
80 Ga0081538_10000960 3300005981 Bacteria 30815
81 Ga0081538_10003097 3300005981 Bacteria 15817
82 Ga0081538_10008926 3300005981 Bacteria 8424
83 Ga0081538_10016265 3300005981 Bacteria 5715
84 Ga0081538_10017114 3300005981 Bacteria 5518
85 Ga0081538_10022811 3300005981 Bacteria 4520
86 Ga0081538_10053610 3300005981 Bacteria 2396
87 Ga0070717_10090053 3300006028 Bacteria 2588
88 Ga0070715_10003966 3300006163 Bacteria 4791
89 Ga0070715_10036797 3300006163 Bacteria 2022
90 Ga0070716_100007528 3300006173 Bacteria 5368
91 Ga0070716_100013635 3300006173 Bacteria 4147
92 Ga0070716_100027036 3300006173 Bacteria 3078
93 Ga0070716_100082376 3300006173 Bacteria 1924
94 Ga0070712_100002690 3300006175 Bacteria 10966
95 Ga0070712_100375510 3300006175 Bacteria 1169
96 Ga0097621_100008165 3300006237 Bacteria 7528
97 Ga0097621_100123023 3300006237 Bacteria 2202
98 Ga0097621_100292987 3300006237 Bacteria 1435
99 Ga0068871_100023380 3300006358 Bacteria 4780
100 Ga0075428_100000193 3300006844 Bacteria 57756
101 Ga0075428_100001892 3300006844 Bacteria 22468
102 Ga0075428_100110956 3300006844 Bacteria 2988
103 Ga0075428_100442220 3300006844 Bacteria 1393
104 Ga0075430_100002791 3300006846 Bacteria 14599
105 Ga0075430_100012028 3300006846 Bacteria 7366
106 Ga0075430_100121953 3300006846 Bacteria 2173
107 Ga0075431_100001247 3300006847 Bacteria 23120
108 Ga0075431_100107080 3300006847 Bacteria 2884
109 Ga0075431_100244843 3300006847 Bacteria 1823
110 Ga0075431_100522564 3300006847 Bacteria 1176
111 Ga0075433_10001048 3300006852 Bacteria 19781
112 Ga0075434_100022708 3300006871 Bacteria 6109
113 Ga0075434_100025745 3300006871 Bacteria 5759
114 Ga0075434_100634766 3300006871 Bacteria 1087
115 Ga0075429_100009377 3300006880 Bacteria 8498
116 Ga0075429_100026104 3300006880 Bacteria 5070
117 Ga0075429_100057768 3300006880 Bacteria 3378
118 Ga0075429_100260892 3300006880 Unclassified 1517
119 Ga0075429_100288061 3300006880 Bacteria 1438
120 Ga0075429_100318940 3300006880 Bacteria 1360
121 Ga0068865_100000372 3300006881 Bacteria 24843
122 Ga0068865_100013473 3300006881 Bacteria 5167
123 Ga0075436_100158659 3300006914 Bacteria 1594
124 Ga0075436_100243710 3300006914 Bacteria 1279
125 Ga0075435_100003594 3300007076 Bacteria 10544
126 Ga0111539_10069748 3300009094 Bacteria 4150
127 Ga0111539_10163561 3300009094 Bacteria 2603
128 Ga0111539_10336075 3300009094 Unclassified 1758
129 Ga0105245_10003696 3300009098 Bacteria 13653
130 Ga0105245_10308940 3300009098 Bacteria 1554
131 Ga0105247_10010220 3300009101 Bacteria 5679
132 Ga0114129_10019052 3300009147 Bacteria 9775
133 Ga0114129_10019809 3300009147 Bacteria 9575
134 Ga0114129_10029595 3300009147 Bacteria 7755
135 Ga0114129_10036510 3300009147 Bacteria 6938
136 Ga0114129_10090227 3300009147 Bacteria 4248
137 Ga0114129_10170299 3300009147 Bacteria 2970
138 Ga0114129_10420251 3300009147 Bacteria 1758
139 Ga0105243_10000793 3300009148 Bacteria 30289
140 Ga0105243_10179989 3300009148 Bacteria 1838
141 Ga0105243_10182812 3300009148 Unclassified 1825
142 Ga0105241_10063563 3300009174 Bacteria 2848
143 Ga0105242_10008195 3300009176 Bacteria 8029
144 Ga0105242_10048537 3300009176 Unclassified 3451
145 Ga0105248_10057817 3300009177 Bacteria 4354
146 Ga0105237_10020395 3300009545 Bacteria 6834
147 Ga0105237_10058377 3300009545 Bacteria 3862
148 Ga0105249_10001946 3300009553 Bacteria 17925
149 Ga0105239_10002279 3300010375 Bacteria 24494
150 Ga0105239_10924720 3300010375 Bacteria 1001
151 Ga0105246_10203696 3300011119 Unclassified 1540
152 Ga0105246_10246009 3300011119 Bacteria 1416
153 Ga0157369_10038717 3300013105 Bacteria 5213
154 Ga0157369_10570679 3300013105 Bacteria 1169
155 Ga0157374_10017853 3300013296 Bacteria 6252
156 Ga0157374_10271097 3300013296 Bacteria 1673
157 Ga0157378_10004177 3300013297 Bacteria 12749
158 Ga0163162_10001930 3300013306 Bacteria 19506
159 Ga0157372_10013112 3300013307 Bacteria 8843
160 Ga0157372_10176702 3300013307 Bacteria 2471
161 Ga0157372_10275631 3300013307 Bacteria 1955
162 Ga0157375_10016699 3300013308 Bacteria 6604
163 Ga0157375_10020123 3300013308 Bacteria 6091
164 Ga0157375_10577379 3300013308 Unclassified 1285
165 Ga0157380_10018353 3300014326 Bacteria 5192
166 Ga0157377_10010088 3300014745 Bacteria 4662
167 Ga0157376_10002471 3300014969 Bacteria 12500
168 Ga0157376_10017492 3300014969 Bacteria 5470
169 Ga0213874_10001712 3300021377 Bacteria 4603
170 Ga0213876_10028135 3300021384 Bacteria 2964
171 Ga0213876_10054966 3300021384 Bacteria 2102
172 Ga0213875_10014674 3300021388 Bacteria 3821
173 Ga0207642_10000288 3300025899 Bacteria 15083
174 Ga0207688_10021185 3300025901 Bacteria 3551
175 Ga0207688_10086051 3300025901 Bacteria 1800
176 Ga0207680_10041787 3300025903 Bacteria 2678
177 Ga0207647_10074502 3300025904 Bacteria 2044
178 Ga0207685_10019345 3300025905 Bacteria 2243
179 Ga0207685_10039250 3300025905 Bacteria 1756
180 Ga0207699_10001429 3300025906 Bacteria 11324
181 Ga0207699_10083207 3300025906 Unclassified 1990
182 Ga0207684_10629125 3300025910 Bacteria 915
183 Ga0207695_10053047 3300025913 Bacteria 4244
184 Ga0207671_10108731 3300025914 Bacteria 2107
185 Ga0207693_10002317 3300025915 Bacteria 16545
186 Ga0207693_10010699 3300025915 Bacteria 7447
187 Ga0207663_10019163 3300025916 Bacteria 3848
188 Ga0207660_10015507 3300025917 Bacteria 5030
189 Ga0207657_10017530 3300025919 Bacteria 6862
190 Ga0207646_10003386 3300025922 Bacteria 18036
191 Ga0207681_10020657 3300025923 Bacteria 4177
192 Ga0207687_10010341 3300025927 Bacteria 6097
193 Ga0207687_10091924 3300025927 Unclassified 2214
194 Ga0207700_10000028 3300025928 Bacteria 135555
195 Ga0207700_10059100 3300025928 Bacteria 2899
196 Ga0207664_10010928 3300025929 Bacteria 6430
197 Ga0207664_10013505 3300025929 Bacteria 5864
198 Ga0207644_10033734 3300025931 Bacteria 3580
199 Ga0207644_10362255 3300025931 Bacteria 1180
200 Ga0207690_10039963 3300025932 Bacteria 3064
201 Ga0207706_10068246 3300025933 Bacteria 3129
202 Ga0207686_10001561 3300025934 Bacteria 12935
203 Ga0207709_10001055 3300025935 Bacteria 20352
204 Ga0207709_10248403 3300025935 Unclassified 1298
205 Ga0207670_10017899 3300025936 Bacteria 4293
206 Ga0207669_10004831 3300025937 Bacteria 5983
207 Ga0207669_10044093 3300025937 Bacteria 2617
208 Ga0207704_10003742 3300025938 Bacteria 6924
209 Ga0207704_10252287 3300025938 Bacteria 1325
210 Ga0207665_10081880 3300025939 Bacteria 2224
211 Ga0207691_10042040 3300025940 Bacteria 4216
212 Ga0207711_10503622 3300025941 Bacteria 1129
213 Ga0207667_10042640 3300025949 Bacteria 4821
214 Ga0207651_10512724 3300025960 Bacteria 1038
215 Ga0207712_10001816 3300025961 Bacteria 14094
216 Ga0207668_10084276 3300025972 Bacteria 2315
217 Ga0207677_10009651 3300026023 Bacteria 5434
218 Ga0207678_10028439 3300026067 Bacteria 4881
219 Ga0207708_10000064 3300026075 Bacteria 85366
220 Ga0207702_10035444 3300026078 Bacteria 4172
221 Ga0207648_10000958 3300026089 Bacteria 32650
222 Ga0207676_10180934 3300026095 Unclassified 1846
223 Ga0207674_10224606 3300026116 Bacteria 1826
224 Ga0207683_10000450 3300026121 Bacteria 38100
225 Ga0207683_10033242 3300026121 Bacteria 4480
226 Ga0207683_10102949 3300026121 Bacteria 2550
227 Ga0207428_10002924 3300027907 Bacteria 16923
228 Ga0268264_10669859 3300028381 Bacteria 1028
229 Ga0265319_1002358 3300028563 Bacteria 10379
230 Ga0265334_10045688 3300028573 Unclassified 1695
231 Ga0265318_10002342 3300028577 Bacteria 10167
232 Ga0265322_10006137 3300028654 Bacteria 3539
233 Ga0265336_10070628 3300028666 Unclassified 1044
234 Ga0265338_10000719 3300028800 Bacteria 56662
235 Ga0265338_10050499 3300028800 Bacteria 3758
236 Ga0265338_10150267 3300028800 Bacteria 1810
237 Ga0265338_10312036 3300028800 Unclassified 1140
238 Ga0265330_10035248 3300031235 Unclassified 2234
239 Ga0265320_10021942 3300031240 Bacteria 3425
240 Ga0265320_10037287 3300031240 Bacteria 2449
241 Ga0265325_10018257 3300031241 Bacteria 3890
242 Ga0265340_10028437 3300031247 Bacteria 2812
243 Ga0265339_10160403 3300031249 Bacteria 1132
244 Ga0265327_10055506 3300031251 Unclassified 2045
245 Ga0265316_10035105 3300031344 Bacteria 4067
246 Ga0265316_10364169 3300031344 Bacteria 1045
247 Ga0307408_100262069 3300031548 Unclassified 1431
248 Ga0265313_10014226 3300031595 Bacteria 4717
249 Ga0265314_10016473 3300031711 Bacteria 5835
250 Ga0265342_10019688 3300031712 Bacteria 4345
251 Ga0307405_10090588 3300031731 Bacteria 2024
252 Ga0307413_10065850 3300031824 Bacteria 2258
253 Ga0307406_10190369 3300031901 Unclassified 1501
254 Ga0307406_10320388 3300031901 Bacteria 1199
255 Ga0307416_100009742 3300032002 Bacteria 6310
256 Ga0307416_100062480 3300032002 Bacteria 3046
257 Ga0307416_100126179 3300032002 Unclassified 2292
258 Ga0307416_100374502 3300032002 Bacteria 1451
259 Ga0307415_100003380 3300032126 Bacteria 8117
260 Ga0307415_100194741 3300032126 Unclassified 1602
261 Ga0316583_10022093 3300032133 Bacteria 2280
262 Ga0373926_0053495 3300035083 Unclassified 1461
263 Ga0373944_0022799 3300035089 Unclassified 1822
264 Ga0373923_0051394 3300035111 Bacteria 1729
265 Ga0373945_0009335 3300035116 Bacteria 3213
266 Ga0373953_0043757 3300035117 Bacteria 1789
267 Ga0373956_0005847 3300035119 Unclassified 4921
268 Ga0373956_0111896 3300035119 Bacteria 1271
269 Ga0373943_0012404 3300035170 Unclassified 3836
270 Ga0373955_0182727 3300035172 Bacteria 1245
271 Ga0373931_0100479 3300035691 Bacteria 1626
272 Ga0373935_0066763 3300035692 Unclassified 2312
273 Ga0373933_0068142 3300035724 Unclassified 2161
274 Ga0373947_0006505 3300035725 Bacteria 6781
275 Ga0373947_0007384 3300035725 Bacteria 6363
276 Ga0373947_0123602 3300035725 Bacteria 1646
277 Ga0373937_0019154 3300036401 Bacteria 6126
278 Ga0373937_0118734 3300036401 Unclassified 2463
279 Ga0373925_0010521 3300037068 Bacteria 6711
280 Ga0373925_0057400 3300037068 Bacteria 2917
281 Ga0395899_0014096 3300037312 Bacteria 6102
282 Ga0395899_0090899 3300037312 Bacteria 2213
283 Ga0395900_0018252 3300037418 Bacteria 7156
284 Ga0395900_0019589 3300037418 Bacteria 6899
285 Ga0395900_0110547 3300037418 Bacteria 2823
286 Ga0395900_0245906 3300037418 Unclassified 1792
287 Ga0395900_0758666 3300037418 Unclassified 900
288 Ga0395900_0786929 3300037418 Bacteria 880
289 Ga0395898_0001723 3300037466 Bacteria 28949
290 Ga0395898_0024366 3300037466 Bacteria 6102
291 Ga0395898_0030041 3300037466 Bacteria 5441
292 Ga0395898_0078788 3300037466 Bacteria 3179
293 Ga0395898_0140412 3300037466 Bacteria 2313
294 Ga0395898_0320257 3300037466 Bacteria 1479
295 Ga0395898_0378852 3300037466 Bacteria 1349
296 Ga0395898_0583199 3300037466 Bacteria 1061
297 Ga0395905_0003298 3300037471 Bacteria 17332
298 Ga0395905_0015347 3300037471 Bacteria 7282
299 Ga0395905_0050048 3300037471 Bacteria 3916
300 Ga0395905_0101859 3300037471 Bacteria 2695
301 Ga0395905_0791822 3300037471 Unclassified 851
302 Ga0436364_1025114 3300037853 Bacteria 13040
303 Ga0395901_0027748 3300038443 Bacteria 5821
304 Ga0395901_0039727 3300038443 Bacteria 4870
305 Ga0395901_0052722 3300038443 Bacteria 4227
306 Ga0395901_0067949 3300038443 Bacteria 3713
307 Ga0395901_0074636 3300038443 Bacteria 3538
308 Ga0395901_0224204 3300038443 Bacteria 1964
309 Ga0395901_0253811 3300038443 Bacteria 1832
310 Ga0395901_0283078 3300038443 Bacteria 1722
311 Ga0395901_0717063 3300038443 Bacteria 996
312 Ga0436365_1243179 3300039437 Bacteria 15724
313 Ga0436365_1401636 3300039437 Bacteria 3117
314 Ga0436363_0592184 3300039450 Bacteria 48672
315 Ga0436362_0655431 3300039453 Bacteria 2878
316 Ga0439450_017666 3300042008 Bacteria 1490
317 Ga0439451_014614 3300042009 Bacteria 1584
318 Ga0439463_012219 3300042016 Bacteria 2109
319 Ga0439460_0013740 3300042461 Bacteria 2122
320 Ga0466969_0122775 3300044656 Bacteria 1208
321 Ga0466957_0009056 3300044842 Bacteria 5675
322 Ga0451576_0079003 3300045051 Bacteria 3423
323 Ga0466958_0091085 3300045836 Unclassified 1887
324 Ga0466967_0057063 3300045976 Bacteria 3445
325 Ga0466967_0446164 3300045976 Bacteria 1264
326 Ga0495603_0052825 3300046455 Unclassified 2411
327 Ga0495603_0062595 3300046455 Bacteria 2196
328 Ga0495603_0062768 3300046455 Bacteria 2193
329 Ga0495629_0023089 3300046459 Bacteria 4432
330 Ga0495629_0064072 3300046459 Unclassified 2566
331 Ga0495629_0163837 3300046459 Unclassified 1544
332 Ga0495651_0358272 3300046462 Bacteria 962
333 Ga0495653_0011959 3300046463 Bacteria 7088
334 Ga0495653_0142704 3300046463 Bacteria 1682
335 Ga0495580_0014180 3300046472 Bacteria 6053
336 Ga0495582_0015385 3300046473 Unclassified 4202
337 Ga0495605_0060885 3300046474 Bacteria 1808
338 Ga0495662_0026813 3300046476 Bacteria 2783
339 Ga0495584_0087167 3300046491 Unclassified 1573
340 Ga0495584_0136794 3300046491 Bacteria 1244
341 Ga0495584_0189117 3300046491 Bacteria 1046
342 Ga0495594_0025846 3300046499 Unclassified 3157
343 Ga0495596_0036906 3300046500 Bacteria 1935
344 Ga0495618_0037131 3300046514 Bacteria 3059
345 Ga0495628_0570771 3300046516 Bacteria 810
346 Ga0495630_0010515 3300046517 Bacteria 6684
347 Ga0495630_0440237 3300046517 Unclassified 999
348 Ga0495644_0016346 3300046523 Bacteria 2840
349 Ga0495652_0025199 3300046529 Bacteria 5265
350 Ga0495665_0002486 3300046531 Bacteria 9957
351 Ga0495640_0073059 3300046533 Unclassified 2296
352 Ga0495640_0367245 3300046533 Unclassified 886
353 Ga0495667_0025780 3300046559 Bacteria 3961
354 Ga0495667_0039173 3300046559 Bacteria 3153
355 Ga0495667_0333034 3300046559 Unclassified 960
356 Ga0495656_0023412 3300046615 Unclassified 2431
357 Ga0495656_0027384 3300046615 Bacteria 2276
358 Ga0495634_0004039 3300046642 Bacteria 11642
359 Ga0495634_0015423 3300046642 Bacteria 5492
360 Ga0495634_0226546 3300046642 Unclassified 1151
361 Ga0495611_0024376 3300046648 Bacteria 2632
362 Ga0495635_0009418 3300046663 Bacteria 6828
363 Ga0495635_0167724 3300046663 Bacteria 1494
364 Ga0495659_0075141 3300046664 Unclassified 1272
365 Ga0495659_0154218 3300046664 Bacteria 924
366 Ga0495657_0191641 3300046675 Bacteria 1249
367 Ga0495599_0287294 3300046678 Bacteria 995
368 Ga0495658_0074165 3300046683 Bacteria 1982
369 Ga0495658_0306776 3300046683 Bacteria 1004
370 Ga0495613_0009725 3300046689 Bacteria 7146
371 Ga0495613_0328420 3300046689 Bacteria 1054
372 Ga0495624_0144467 3300046690 Bacteria 1456
373 Ga0495589_0087726 3300046794 Unclassified 1511
374 Ga0495600_0143258 3300046809 Unclassified 1550
375 Ga0495581_0000916 3300047315 Bacteria 15822
376 Ga0495581_0008910 3300047315 Bacteria 5810
377 Ga0495604_0245238 3300047317 Bacteria 1223
378 Ga0495674_0035728 3300047319 Bacteria 4479
379 Ga0495680_0036835 3300047322 Bacteria 3923
380 Ga0495677_0070102 3300047445 Bacteria 1306
381 Ga0495684_0042910 3300047471 Bacteria 3463
382 Ga0495684_0083320 3300047471 Unclassified 2425
383 Ga0495684_0307634 3300047471 Archaea 1137
384 Ga0495593_0004428 3300047673 Bacteria 8350
385 Ga0495602_0082366 3300048088 Bacteria 2701
386 Ga0495614_0003342 3300048089 Bacteria 7173
387 Ga0496100_0042608 3300048903 Bacteria 2899
388 Ga0496100_0071786 3300048903 Bacteria 2312
389 Ga0496101_0057217 3300048904 Bacteria 2819
390 Ga0496101_0221843 3300048904 Bacteria 1467
391 Ga0496102_0008114 3300048905 Bacteria 8985
392 Ga0496102_0013749 3300048905 Bacteria 7019
393 Ga0496102_0141361 3300048905 Bacteria 2257
394 Ga0496103_0001171 3300048906 Bacteria 18044
395 Ga0496103_0118553 3300048906 Bacteria 1685
396 Ga0496104_0003331 3300048907 Bacteria 13866
397 Ga0496104_0053285 3300048907 Bacteria 3821
398 Ga0496104_0082385 3300048907 Bacteria 3068
399 Ga0496104_0524531 3300048907 Bacteria 1095
400 Ga0496105_0003158 3300048908 Bacteria 12133
401 Ga0496105_0019947 3300048908 Bacteria 5411
402 Ga0496106_0003883 3300048909 Bacteria 11150
403 Ga0496106_0009718 3300048909 Bacteria 7104
404 Ga0496107_0000731 3300048910 Bacteria 18789
405 Ga0496107_0060573 3300048910 Bacteria 2739
406 Ga0496107_0084993 3300048910 Unclassified 2309
407 Ga0496108_0011118 3300048911 Bacteria 7311
408 Ga0496108_0326700 3300048911 Bacteria 1337
409 Ga0496109_0001268 3300048912 Bacteria 20981
410 Ga0496109_0067703 3300048912 Bacteria 3272
411 Ga0496109_0101556 3300048912 Bacteria 2669
412 Ga0496109_0205839 3300048912 Bacteria 1850
413 Ga0496110_0001481 3300048913 Bacteria 17015
414 Ga0496110_0023282 3300048913 Bacteria 5266
415 Ga0496110_0098151 3300048913 Bacteria 2625
416 Ga0496110_0112167 3300048913 Bacteria 2451
417 Ga0496110_0366934 3300048913 Bacteria 1312
418 Ga0496111_0047880 3300048914 Bacteria 3079
419 Ga0496112_0078086 3300048915 Bacteria 3274
420 Ga0496112_0154009 3300048915 Bacteria 2266
421 Ga0496112_0553328 3300048915 Bacteria 1084
422 Ga0496113_0028041 3300048916 Unclassified 4045
423 Ga0496114_0066819 3300048917 Bacteria 3015
424 Ga0496114_0069193 3300048917 Bacteria 2964
425 Ga0496114_0081366 3300048917 Unclassified 2736
426 Ga0496114_0205154 3300048917 Unclassified 1728
427 Ga0496115_0002814 3300048918 Bacteria 12503
428 Ga0496115_0003228 3300048918 Bacteria 11702
429 Ga0496115_0046381 3300048918 Bacteria 3472
430 Ga0501031_0010155 3300049568 Bacteria 6135
431 Ga0501031_0077659 3300049568 Bacteria 2162
432 Ga0501031_0107208 3300049568 Bacteria 1824
433 Ga0501031_0154999 3300049568 Bacteria 1497
434 Ga0501032_0022225 3300049569 Bacteria 4399
435 Ga0501033_0148411 3300049570 Bacteria 1693
436 Ga0501036_0126195 3300049572 Bacteria 2161
437 Ga0501036_0279549 3300049572 Unclassified 1397
438 Ga0501036_0636561 3300049572 Unclassified 883
439 Ga0501037_0041379 3300049573 Bacteria 3388
440 Ga0501038_0189246 3300049574 Bacteria 1657
441 Ga0501039_0003126 3300049575 Bacteria 12381
442 Ga0501040_0025060 3300049576 Bacteria 4007
443 Ga0501040_0036637 3300049576 Bacteria 3330
444 Ga0501040_0045331 3300049576 Unclassified 2999
445 Ga0501040_0049657 3300049576 Bacteria 2869
446 Ga0501040_0062247 3300049576 Bacteria 2567
447 Ga0501040_0100926 3300049576 Bacteria 2013
448 Ga0501041_0095919 3300049577 Bacteria 1833
449 Ga0501041_0149781 3300049577 Bacteria 1456
450 Ga0501041_0528517 3300049577 Bacteria 751
451 Ga0501042_0013285 3300049578 Bacteria 5601
452 Ga0501042_0048405 3300049578 Bacteria 3031
453 Ga0501042_0053801 3300049578 Bacteria 2872
454 Ga0501042_0106926 3300049578 Bacteria 2014
455 Ga0501042_0413015 3300049578 Bacteria 978
456 Ga0501043_0032507 3300049579 Bacteria 4102
457 Ga0501046_0052189 3300049580 Bacteria 3223
458 Ga0501046_0132503 3300049580 Bacteria 1890
459 Ga0501046_0328841 3300049580 Bacteria 1113
460 Ga0501046_0525935 3300049580 Unclassified 845
461 Ga0501047_0176555 3300049581 Bacteria 2003
462 Ga0501047_0388489 3300049581 Bacteria 1229
463 Ga0501048_0067786 3300049582 Bacteria 2522
464 Ga0501048_0078954 3300049582 Bacteria 2322
465 Ga0501048_0087940 3300049582 Bacteria 2192
466 Ga0501067_0061796 3300049583 Bacteria 2073
467 Ga0501068_0004535 3300049584 Bacteria 7558
468 Ga0501068_0094443 3300049584 Bacteria 1848
469 Ga0501068_0196238 3300049584 Bacteria 1280
470 Ga0501069_0015604 3300049585 Bacteria 4072
471 Ga0501069_0021447 3300049585 Bacteria 3506
472 Ga0501069_0190818 3300049585 Unclassified 1186
473 Ga0501070_0052912 3300049586 Bacteria 3369
474 Ga0501070_0542628 3300049586 Bacteria 931
475 Ga0501071_0006735 3300049587 Bacteria 7476
476 Ga0501071_0028525 3300049587 Bacteria 3935
477 Ga0501071_0047983 3300049587 Unclassified 3069
478 Ga0501071_0108509 3300049587 Bacteria 2050
479 Ga0501072_0047273 3300049588 Bacteria 3389
480 Ga0501072_0062444 3300049588 Unclassified 2939
481 Ga0501073_0033327 3300049589 Bacteria 3668
482 Ga0501074_0036909 3300049590 Bacteria 3541
483 Ga0501074_0038537 3300049590 Bacteria 3463
484 Ga0501074_0103949 3300049590 Bacteria 2033
485 Ga0501074_0133470 3300049590 Bacteria 1776
486 Ga0501076_0005030 3300049592 Bacteria 9461
487 Ga0501076_0017902 3300049592 Bacteria 5388
488 Ga0501076_0035768 3300049592 Bacteria 3886
489 Ga0501076_0038134 3300049592 Bacteria 3772
490 Ga0501076_0043345 3300049592 Bacteria 3545
491 Ga0501076_0125503 3300049592 Bacteria 2079
492 Ga0501077_0002477 3300049593 Bacteria 11061
493 Ga0501077_0017710 3300049593 Bacteria 4499
494 Ga0501077_0040458 3300049593 Bacteria 2970
495 Ga0501077_0046532 3300049593 Bacteria 2756
496 Ga0501077_0092878 3300049593 Bacteria 1912
497 Ga0501079_0023259 3300049741 Bacteria 4757
498 Ga0501079_0050414 3300049741 Bacteria 3214
499 Ga0501079_0083867 3300049741 Bacteria 2465
500 Ga0501079_0088276 3300049741 Bacteria 2401
501 Ga0501079_0097818 3300049741 Unclassified 2275
502 Ga0501079_0229350 3300049741 Bacteria 1451
503 Ga0501079_0242688 3300049741 Bacteria 1407
504 Ga0501080_0292556 3300049742 Bacteria 1479
505 Ga0501080_0305002 3300049742 Bacteria 1443
506 Ga0501080_0516352 3300049742 Bacteria 1066
507 Ga0501083_0015657 3300049744 Bacteria 5308
508 Ga0501083_0099606 3300049744 Bacteria 1917
509 Ga0501035_0009691 3300049822 Bacteria 8959
510 Ga0501045_0015838 3300049824 Bacteria 5348
511 Ga0501045_0049977 3300049824 Bacteria 3050
512 Ga0501045_0067549 3300049824 Bacteria 2626
513 Ga0501045_0120095 3300049824 Bacteria 1951
514 Ga0501045_0187945 3300049824 Bacteria 1539
515 nmdc:mga05p37_153739_c1 3300050507 Bacteria 2813
516 nmdc:mga05p37_18522_c1 3300050507 Bacteria 8413
517 nmdc:mga05p37_216276_c1 3300050507 Bacteria 2315
518 nmdc:mga05p37_46738_c1 3300050507 Bacteria 5322
519 nmdc:mga05p37_52030_c1 3300050507 Bacteria 5036
520 nmdc:mga05p37_57409_c1 3300050507 Bacteria 4795
521 nmdc:mga09592_189585_c1 3300050508 Bacteria 1780
522 nmdc:mga09592_38375_c1 3300050508 Bacteria 4021
523 nmdc:mga09592_95961_c2 3300050508 Bacteria 1923
524 nmdc:mga0qj67_103399_c1 3300050509 Bacteria 2298
525 nmdc:mga0qj67_117320_c1 3300050509 Bacteria 2151
526 nmdc:mga0qj67_149160_c1 3300050509 Bacteria 1897
527 nmdc:mga06r32_101976_c1 3300050510 Bacteria 2817
528 nmdc:mga06r32_484998_c1 3300050510 Bacteria 1214
529 nmdc:mga08y16_117253_c1 3300050511 Bacteria 2772
530 nmdc:mga08y16_436816_c1 3300050511 Bacteria 1336
531 nmdc:mga08y16_97485_c1 3300050511 Bacteria 3062
532 nmdc:mga0n895_205228_c1 3300050512 Bacteria 2001
533 nmdc:mga0n895_22851_c1 3300050512 Bacteria 5867
534 nmdc:mga0rr50_94236_c1 3300050513 Bacteria 2338
535 nmdc:mga08x19_91007_c1 3300050514 Bacteria 2013
536 nmdc:mga0a205_1770_c2 3300050515 Bacteria 15497
537 nmdc:mga0a205_749035_c1 3300050515 Unclassified 825
538 Ga0495601_0046214 3300053077 Unclassified 2740
539 Ga0495612_0006185 3300053078 Bacteria 4927
540 Ga0495595_0040737 3300053084 Unclassified 2123
541 Ga0495619_0375389 3300053085 Archaea 983
542 Ga0501084_0021281 3300054114 Bacteria 5406
543 Ga0501084_0041918 3300054114 Bacteria 3828
544 Ga0501084_0103341 3300054114 Unclassified 2393
545 Ga0501084_0293757 3300054114 Bacteria 1372
546 Ga0501082_0023738 3300060353 Bacteria 5287
547 Ga0501082_0283314 3300060353 Bacteria 1442
548 Ga0501082_0367369 3300060353 Bacteria 1255
549 Ga0501082_0403382 3300060353 Bacteria 1193
550 Ga0530510_0011099 3300061734 Bacteria 6320
551 Ga0530510_0082140 3300061734 Bacteria 2346
552 Ga0530510_0100073 3300061734 Bacteria 2120
553 Ga0530510_0234569 3300061734 Bacteria 1365
554 Ga0530510_0340490 3300061734 Bacteria 1126
555 2689958213 2687453737 Bacteria 11203906
556 2895882936 2895880812 Bacteria 11255272
557 Ga0501076_0139165
558 JGI24744J21845_10000505
559 rootH1_10246067
560 JGI25407J50210_10010825
561 Ga0070666_10058013
562 Ga0070666_10195199
563 Ga0070680_100025939
564 Ga0070680_100250493
565 Ga0070682_100003625
566 Ga0070682_100110764
567 Ga0068868_100033268
568 Ga0070660_100008595
569 Ga0070689_100107935
570 Ga0070687_100101250
571 Ga0070692_10003201
572 Ga0070668_100011757
573 Ga0070671_100059114
574 Ga0070674_100001495
575 Ga0070674_100043861
576 Ga0070673_100212573
577 Ga0070688_100008128
578 Ga0070659_100016084
579 Ga0070703_10094102
580 Ga0070709_10010649
581 Ga0070709_10017142
582 Ga0070714_100010073
583 Ga0070714_100037087
584 Ga0070714_100174360
585 Ga0070713_100006856
586 Ga0070713_100036262
587 Ga0070710_10008348
588 Ga0070701_10000635
589 Ga0070711_100021217
590 Ga0070711_100037382
591 Ga0070711_100239665
592 Ga0070705_100052223
593 Ga0070700_100007743
594 Ga0070694_100532331
595 Ga0070708_100009274
596 Ga0070708_100009362
597 Ga0070708_100012134
598 Ga0070708_100142553
599 Ga0070663_100016371
600 Ga0070678_100001440
601 Ga0070678_100088258
602 Ga0070662_100119892
603 Ga0068867_100002296
604 Ga0070685_10001240
605 Ga0070706_100006302
606 Ga0070706_100143396
607 Ga0070707_100007620
608 Ga0070698_100049611
609 Ga0070698_100122209
610 Ga0070679_100065204
611 Ga0070697_100230163
612 Ga0070697_100433548
613 Ga0068853_100013374
614 Ga0070672_100010742
615 Ga0070686_100000541
616 Ga0070686_100433948
617 Ga0070695_100000485
618 Ga0070695_100158783
619 Ga0070696_100014166
620 Ga0070696_100169382
621 Ga0070693_100103864
622 Ga0070665_100009491
623 Ga0070704_100060580
624 Ga0070704_100161541
625 Ga0068855_100060362
626 Ga0068854_100069944
627 Ga0068856_100002949
628 Ga0068856_100245195
629 Ga0070702_100017737
630 Ga0068866_10002211
631 Ga0068861_100060398
632 Ga0068858_100112938
633 Ga0068860_100639397
634 Ga0068862_100047575
635 Ga0081455_10001471
636 Ga0081538_10000960
637 Ga0081538_10003097
638 Ga0081538_10008926
639 Ga0081538_10016265
640 Ga0081538_10017114
641 Ga0081538_10022811
642 Ga0081538_10053610
643 Ga0070717_10090053
644 Ga0070715_10003966
645 Ga0070715_10036797
646 Ga0070716_100007528
647 Ga0070716_100013635
648 Ga0070716_100027036
649 Ga0070716_100082376
650 Ga0070712_100002690
651 Ga0070712_100375510
652 Ga0097621_100008165
653 Ga0097621_100123023
654 Ga0097621_100292987
655 Ga0068871_100023380
656 Ga0075428_100000193
657 Ga0075428_100001892
658 Ga0075428_100110956
659 Ga0075428_100442220
660 Ga0075430_100002791
661 Ga0075430_100012028
662 Ga0075430_100121953
663 Ga0075431_100001247
664 Ga0075431_100107080
665 Ga0075431_100244843
666 Ga0075431_100522564
667 Ga0075433_10001048
668 Ga0075434_100022708
669 Ga0075434_100025745
670 Ga0075434_100634766
671 Ga0075429_100009377
672 Ga0075429_100026104
673 Ga0075429_100057768
674 Ga0075429_100260892
675 Ga0075429_100288061
676 Ga0075429_100318940
677 Ga0068865_100000372
678 Ga0068865_100013473
679 Ga0075436_100158659
680 Ga0075436_100243710
681 Ga0075435_100003594
682 Ga0111539_10069748
683 Ga0111539_10163561
684 Ga0111539_10336075
685 Ga0105245_10003696
686 Ga0105245_10308940
687 Ga0105247_10010220
688 Ga0114129_10019052
689 Ga0114129_10019809
690 Ga0114129_10029595
691 Ga0114129_10036510
692 Ga0114129_10090227
693 Ga0114129_10170299
694 Ga0114129_10420251
695 Ga0105243_10000793
696 Ga0105243_10179989
697 Ga0105243_10182812
698 Ga0105241_10063563
699 Ga0105242_10008195
700 Ga0105242_10048537
701 Ga0105248_10057817
702 Ga0105237_10020395
703 Ga0105237_10058377
704 Ga0105249_10001946
705 Ga0105239_10002279
706 Ga0105239_10924720
707 Ga0105246_10203696
708 Ga0105246_10246009
709 Ga0157369_10038717
710 Ga0157369_10570679
711 Ga0157374_10017853
712 Ga0157374_10271097
713 Ga0157378_10004177
714 Ga0163162_10001930
715 Ga0157372_10013112
716 Ga0157372_10176702
717 Ga0157372_10275631
718 Ga0157375_10016699
719 Ga0157375_10020123
720 Ga0157375_10577379
721 Ga0157380_10018353
722 Ga0157377_10010088
723 Ga0157376_10002471
724 Ga0157376_10017492
725 Ga0213874_10001712
726 Ga0213876_10028135
727 Ga0213876_10054966
728 Ga0213875_10014674
729 Ga0207642_10000288
730 Ga0207688_10021185
731 Ga0207688_10086051
732 Ga0207680_10041787
733 Ga0207647_10074502
734 Ga0207685_10019345
735 Ga0207685_10039250
736 Ga0207699_10001429
737 Ga0207699_10083207
738 Ga0207684_10629125
739 Ga0207695_10053047
740 Ga0207671_10108731
741 Ga0207693_10002317
742 Ga0207693_10010699
743 Ga0207663_10019163
744 Ga0207660_10015507
745 Ga0207657_10017530
746 Ga0207646_10003386
747 Ga0207681_10020657
748 Ga0207687_10010341
749 Ga0207687_10091924
750 Ga0207700_10000028
751 Ga0207700_10059100
752 Ga0207664_10010928
753 Ga0207664_10013505
754 Ga0207644_10033734
755 Ga0207644_10362255
756 Ga0207690_10039963
757 Ga0207706_10068246
758 Ga0207686_10001561
759 Ga0207709_10001055
760 Ga0207709_10248403
761 Ga0207670_10017899
762 Ga0207669_10004831
763 Ga0207669_10044093
764 Ga0207704_10003742
765 Ga0207704_10252287
766 Ga0207665_10081880
767 Ga0207691_10042040
768 Ga0207711_10503622
769 Ga0207667_10042640
770 Ga0207651_10512724
771 Ga0207712_10001816
772 Ga0207668_10084276
773 Ga0207677_10009651
774 Ga0207678_10028439
775 Ga0207708_10000064
776 Ga0207702_10035444
777 Ga0207648_10000958
778 Ga0207676_10180934
779 Ga0207674_10224606
780 Ga0207683_10000450
781 Ga0207683_10033242
782 Ga0207683_10102949
783 Ga0207428_10002924
784 Ga0268264_10669859
785 Ga0265319_1002358
786 Ga0265334_10045688
787 Ga0265318_10002342
788 Ga0265322_10006137
789 Ga0265336_10070628
790 Ga0265338_10000719
791 Ga0265338_10050499
792 Ga0265338_10150267
793 Ga0265338_10312036
794 Ga0265330_10035248
795 Ga0265320_10021942
796 Ga0265320_10037287
797 Ga0265325_10018257
798 Ga0265340_10028437
799 Ga0265339_10160403
800 Ga0265327_10055506
801 Ga0265316_10035105
802 Ga0265316_10364169
803 Ga0307408_100262069
804 Ga0265313_10014226
805 Ga0265314_10016473
806 Ga0265342_10019688
807 Ga0307405_10090588
808 Ga0307413_10065850
809 Ga0307406_10190369
810 Ga0307406_10320388
811 Ga0307416_100009742
812 Ga0307416_100062480
813 Ga0307416_100126179
814 Ga0307416_100374502
815 Ga0307415_100003380
816 Ga0307415_100194741
817 Ga0316583_10022093
818 Ga0373926_0053495
819 Ga0373944_0022799
820 Ga0373923_0051394
821 Ga0373945_0009335
822 Ga0373953_0043757
823 Ga0373956_0005847
824 Ga0373956_0111896
825 Ga0373943_0012404
826 Ga0373955_0182727
827 Ga0373931_0100479
828 Ga0373935_0066763
829 Ga0373933_0068142
830 Ga0373947_0006505
831 Ga0373947_0007384
832 Ga0373947_0123602
833 Ga0373937_0019154
834 Ga0373937_0118734
835 Ga0373925_0010521
836 Ga0373925_0057400
837 Ga0395899_0014096
838 Ga0395899_0090899
839 Ga0395900_0018252
840 Ga0395900_0019589
841 Ga0395900_0110547
842 Ga0395900_0245906
843 Ga0395900_0758666
844 Ga0395900_0786929
845 Ga0395898_0001723
846 Ga0395898_0024366
847 Ga0395898_0030041
848 Ga0395898_0078788
849 Ga0395898_0140412
850 Ga0395898_0320257
851 Ga0395898_0378852
852 Ga0395898_0583199
853 Ga0395905_0003298
854 Ga0395905_0015347
855 Ga0395905_0050048
856 Ga0395905_0101859
857 Ga0395905_0791822
858 Ga0436364_1025114
859 Ga0395901_0027748
860 Ga0395901_0039727
861 Ga0395901_0052722
862 Ga0395901_0067949
863 Ga0395901_0074636
864 Ga0395901_0224204
865 Ga0395901_0253811
866 Ga0395901_0283078
867 Ga0395901_0717063
868 Ga0436365_1243179
869 Ga0436365_1401636
870 Ga0436363_0592184
871 Ga0436362_0655431
872 Ga0439450_017666
873 Ga0439451_014614
874 Ga0439463_012219
875 Ga0439460_0013740
876 Ga0466969_0122775
877 Ga0466957_0009056
878 Ga0451576_0079003
879 Ga0466958_0091085
880 Ga0466967_0057063
881 Ga0466967_0446164
882 Ga0495603_0052825
883 Ga0495603_0062595
884 Ga0495603_0062768
885 Ga0495629_0023089
886 Ga0495629_0064072
887 Ga0495629_0163837
888 Ga0495651_0358272
889 Ga0495653_0011959
890 Ga0495653_0142704
891 Ga0495580_0014180
892 Ga0495582_0015385
893 Ga0495605_0060885
894 Ga0495662_0026813
895 Ga0495584_0087167
896 Ga0495584_0136794
897 Ga0495584_0189117
898 Ga0495594_0025846
899 Ga0495596_0036906
900 Ga0495618_0037131
901 Ga0495628_0570771
902 Ga0495630_0010515
903 Ga0495630_0440237
904 Ga0495644_0016346
905 Ga0495652_0025199
906 Ga0495665_0002486
907 Ga0495640_0073059
908 Ga0495640_0367245
909 Ga0495667_0025780
910 Ga0495667_0039173
911 Ga0495667_0333034
912 Ga0495656_0023412
913 Ga0495656_0027384
914 Ga0495634_0004039
915 Ga0495634_0015423
916 Ga0495634_0226546
917 Ga0495611_0024376
918 Ga0495635_0009418
919 Ga0495635_0167724
920 Ga0495659_0075141
921 Ga0495659_0154218
922 Ga0495657_0191641
923 Ga0495599_0287294
924 Ga0495658_0074165
925 Ga0495658_0306776
926 Ga0495613_0009725
927 Ga0495613_0328420
928 Ga0495624_0144467
929 Ga0495589_0087726
930 Ga0495600_0143258
931 Ga0495581_0000916
932 Ga0495581_0008910
933 Ga0495604_0245238
934 Ga0495674_0035728
935 Ga0495680_0036835
936 Ga0495677_0070102
937 Ga0495684_0042910
938 Ga0495684_0083320
939 Ga0495684_0307634
940 Ga0495593_0004428
941 Ga0495602_0082366
942 Ga0495614_0003342
943 Ga0496100_0042608
944 Ga0496100_0071786
945 Ga0496101_0057217
946 Ga0496101_0221843
947 Ga0496102_0008114
948 Ga0496102_0013749
949 Ga0496102_0141361
950 Ga0496103_0001171
951 Ga0496103_0118553
952 Ga0496104_0003331
953 Ga0496104_0053285
954 Ga0496104_0082385
955 Ga0496104_0524531
956 Ga0496105_0003158
957 Ga0496105_0019947
958 Ga0496106_0003883
959 Ga0496106_0009718
960 Ga0496107_0000731
961 Ga0496107_0060573
962 Ga0496107_0084993
963 Ga0496108_0011118
964 Ga0496108_0326700
965 Ga0496109_0001268
966 Ga0496109_0067703
967 Ga0496109_0101556
968 Ga0496109_0205839
969 Ga0496110_0001481
970 Ga0496110_0023282
971 Ga0496110_0098151
972 Ga0496110_0112167
973 Ga0496110_0366934
974 Ga0496111_0047880
975 Ga0496112_0078086
976 Ga0496112_0154009
977 Ga0496112_0553328
978 Ga0496113_0028041
979 Ga0496114_0066819
980 Ga0496114_0069193
981 Ga0496114_0081366
982 Ga0496114_0205154
983 Ga0496115_0002814
984 Ga0496115_0003228
985 Ga0496115_0046381
986 Ga0501031_0010155
987 Ga0501031_0077659
988 Ga0501031_0107208
989 Ga0501031_0154999
990 Ga0501032_0022225
991 Ga0501033_0148411
992 Ga0501036_0126195
993 Ga0501036_0279549
994 Ga0501036_0636561
995 Ga0501037_0041379
996 Ga0501038_0189246
997 Ga0501039_0003126
998 Ga0501040_0025060
999 Ga0501040_0036637
1000 Ga0501040_0045331
1001 Ga0501040_0049657
1002 Ga0501040_0062247
1003 Ga0501040_0100926
1004 Ga0501041_0095919
1005 Ga0501041_0149781
1006 Ga0501041_0528517
1007 Ga0501042_0013285
1008 Ga0501042_0048405
1009 Ga0501042_0053801
1010 Ga0501042_0106926
1011 Ga0501042_0413015
1012 Ga0501043_0032507
1013 Ga0501046_0052189
1014 Ga0501046_0132503
1015 Ga0501046_0328841
1016 Ga0501046_0525935
1017 Ga0501047_0176555
1018 Ga0501047_0388489
1019 Ga0501048_0067786
1020 Ga0501048_0078954
1021 Ga0501048_0087940
1022 Ga0501067_0061796
1023 Ga0501068_0004535
1024 Ga0501068_0094443
1025 Ga0501068_0196238
1026 Ga0501069_0015604
1027 Ga0501069_0021447
1028 Ga0501069_0190818
1029 Ga0501070_0052912
1030 Ga0501070_0542628
1031 Ga0501071_0006735
1032 Ga0501071_0028525
1033 Ga0501071_0047983
1034 Ga0501071_0108509
1035 Ga0501072_0047273
1036 Ga0501072_0062444
1037 Ga0501073_0033327
1038 Ga0501074_0036909
1039 Ga0501074_0038537
1040 Ga0501074_0103949
1041 Ga0501074_0133470
1042 Ga0501076_0005030
1043 Ga0501076_0017902
1044 Ga0501076_0035768
1045 Ga0501076_0038134
1046 Ga0501076_0043345
1047 Ga0501076_0125503
1048 Ga0501077_0002477
1049 Ga0501077_0017710
1050 Ga0501077_0040458
1051 Ga0501077_0046532
1052 Ga0501077_0092878
1053 Ga0501079_0023259
1054 Ga0501079_0050414
1055 Ga0501079_0083867
1056 Ga0501079_0088276
1057 Ga0501079_0097818
1058 Ga0501079_0229350
1059 Ga0501079_0242688
1060 Ga0501080_0292556
1061 Ga0501080_0305002
1062 Ga0501080_0516352
1063 Ga0501083_0015657
1064 Ga0501083_0099606
1065 Ga0501035_0009691
1066 Ga0501045_0015838
1067 Ga0501045_0049977
1068 Ga0501045_0067549
1069 Ga0501045_0120095
1070 Ga0501045_0187945
1071 nmdc:mga05p37_153739_c1
1072 nmdc:mga05p37_18522_c1
1073 nmdc:mga05p37_216276_c1
1074 nmdc:mga05p37_46738_c1
1075 nmdc:mga05p37_52030_c1
1076 nmdc:mga05p37_57409_c1
1077 nmdc:mga09592_189585_c1
1078 nmdc:mga09592_38375_c1
1079 nmdc:mga09592_95961_c2
1080 nmdc:mga0qj67_103399_c1
1081 nmdc:mga0qj67_117320_c1
1082 nmdc:mga0qj67_149160_c1
1083 nmdc:mga06r32_101976_c1
1084 nmdc:mga06r32_484998_c1
1085 nmdc:mga08y16_117253_c1
1086 nmdc:mga08y16_436816_c1
1087 nmdc:mga08y16_97485_c1
1088 nmdc:mga0n895_205228_c1
1089 nmdc:mga0n895_22851_c1
1090 nmdc:mga0rr50_94236_c1
1091 nmdc:mga08x19_91007_c1
1092 nmdc:mga0a205_1770_c2
1093 nmdc:mga0a205_749035_c1
1094 Ga0495601_0046214
1095 Ga0495612_0006185
1096 Ga0495595_0040737
1097 Ga0495619_0375389
1098 Ga0501084_0021281
1099 Ga0501084_0041918
1100 Ga0501084_0103341
1101 Ga0501084_0293757
1102 Ga0501082_0023738
1103 Ga0501082_0283314
1104 Ga0501082_0367369
1105 Ga0501082_0403382
1106 Ga0530510_0011099
1107 Ga0530510_0082140
1108 Ga0530510_0100073
1109 Ga0530510_0234569
1110 Ga0530510_0340490
1111 2689958213
1112 2895882936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zqm-assembly1.cif.gz_A crystal structure of the prefoldin beta subunit from thermococcus strain ks-1 0.6453 152 208
1fxk-assembly1.cif.gz_B crystal structure of archaeal prefoldin (gimc). 0.6399 152 207
2zdi-assembly1.cif.gz_B-2 crystal structure of prefoldin from pyrococcus horikoshii ot3 0.6155 152 208
6nr8-assembly1.cif.gz_4 htric-hpfd class6 0.6048 152 207
2zdi-assembly1.cif.gz_A-2 crystal structure of prefoldin from pyrococcus horikoshii ot3 0.5995 152 208
ID Description Score Start End Superfamily
af_Q12887_160_330_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.7803 30 154 1.10.357.140
af_F1LVF4_158_307_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.7461 30 140 1.10.357.140
af_P0AEA5_14_182_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.7374 30 162 1.10.357.140
2zqmA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6453 152 208 1.10.287.370
af_O14450_1_107_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6433 152 210 1.10.287.370
ID Description Score Start End GO Terms
AF-A0A7W1QQ92-F1-model_v4 Uncharacterized protein 0.9343 126 208 GO:0016020
AF-A0A2D9A2C8-F1-model_v4 Uncharacterized protein 0.9248 106 209 GO:0016020
AF-A0A537G6C7-F1-model_v4 Prenyltransferase 0.9133 19 165 GO:0016020
AF-A0A538AFI1-F1-model_v4 Uncharacterized protein 0.9071 95 208 GO:0016020
AF-A0A538HAE4-F1-model_v4 Uncharacterized protein 0.8883 101 209 GO:0016020

Map