F463262

General Info

Members Datasets Scaffolds Average Seq Length
556 439 1112 333

Family's Representative Sequence

Representative Sequence 3300053162|Ga0500638_067346|Ga0500638_067346_313_1515
Length 400
Sequence MAIQQIPCGNVGLRRGASGIVDRAGRGLFPDFALKSRAERRDLGRNGPVCIAFSDVAPERFRSRRMTEADSRHVPVHIPVLGLEAVEMLSPQAGGVYVDATFGAGGYSRAILDVAGTRVIGIDRDRTAIAGGFGLVEQSGGRLTLVEGRFSNLAEVCAAQGFAEVDGIVMDVGVSSMQLDQAGRGFSFRLDGPLDMRMGQDGPTAADVVATADEAELANIIYIFGEERHSRAVARAVVAARKDAPIATTRALAEIVARVVRGKPGEIHPATRTFQALRIFVNEELDELQSALAAAERVLKPGGRLAVVSFHSLEDRIVKNFLNARAKASAGSRHRPELAQAAPSFHLLTKRPVTAGETELAANPRARSAKLRAAERTGAAAHRAADAPSWPRLSDVKRGG

Samples

Sample ID Description Type Environment
1 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
66 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
67 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
68 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
115 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
116 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
117 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
258 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
259 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
260 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
261 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
262 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
263 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
268 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
269 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
270 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
271 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
272 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
273 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
274 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
275 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
276 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
279 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
280 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
281 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
282 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
283 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
284 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
285 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
286 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
287 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
288 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
289 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
290 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
291 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
292 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
293 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
294 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
295 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
296 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
297 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
298 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
299 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
300 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
301 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
302 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
303 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
304 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
305 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
306 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
307 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
308 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
309 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
310 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
311 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
312 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
313 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
314 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
315 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
316 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
317 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
318 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
319 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
320 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
321 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
322 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
323 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
324 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
325 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
326 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
327 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
328 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
329 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
330 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
331 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
332 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
333 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
334 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
335 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
336 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
337 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
338 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
339 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
340 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
341 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
342 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
343 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
344 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
345 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
346 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
347 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
348 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
349 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
350 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
351 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
352 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
353 2922368715
354 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
355 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
356 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
357 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
358 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
359 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
360 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
361 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
362 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
363 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
364 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
365 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
366 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
367 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
368 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
369 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
370 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
371 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
372 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
373 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
374 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
375 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
376 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
377 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
378 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
379 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
380 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
381 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
382 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
383 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
384 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
385 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
386 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
387 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
388 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
389 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
390 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
391 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
392 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
393 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
394 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
395 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
396 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
397 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
398 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
399 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
400 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
401 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
402 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
403 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
404 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
405 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
406 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
407 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
408 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
409 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
410 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
411 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
412 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
413 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
414 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
415 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
416 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
417 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
418 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
419 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
420 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
421 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
422 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
423 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
424 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
425 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
426 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
427 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
428 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
429 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
430 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
431 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
432 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
433 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
434 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
435 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
436 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
437 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
438 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
439 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.99
Metatranscriptomes 0
Isolates 29.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.57
Nodule 23.56
Rhizoplane 3.24
Rhizosphere 47.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500638_067346 3300053162 Bacteria 1715
2 RicEn_C770 2010549000 Bacteria 3671
3 JGI25153J46596_10002182 3300003215 Bacteria 11422
4 JGI25153J46596_10008407 3300003215 Bacteria 4936
5 JGI25153J46596_10008897 3300003215 Bacteria 4739
6 JGI25153J46596_10011112 3300003215 Bacteria 4007
7 JGI25153J46596_10039722 3300003215 Bacteria 1467
8 JGI25160J50197_1002761 3300003354 Bacteria 8048
9 JGI25160J50197_1002784 3300003354 Bacteria 8012
10 JGI25160J50197_1004195 3300003354 Bacteria 6264
11 Ga0055539_1003031 3300003752 Bacteria 2417
12 Ga0055531_10010031 3300003794 Bacteria 4762
13 Ga0055531_10032460 3300003794 Bacteria 1705
14 Ga0065165_1003406 3300005262 Bacteria 11219
15 Ga0065165_1004368 3300005262 Bacteria 8842
16 Ga0065165_1005272 3300005262 Bacteria 7373
17 Ga0070683_100083817 3300005329 Bacteria 2986
18 Ga0070677_10007120 3300005333 Bacteria 3727
19 Ga0070680_100148998 3300005336 Bacteria 1964
20 Ga0070669_100111255 3300005353 Bacteria 2078
21 Ga0070671_100054377 3300005355 Bacteria 3329
22 Ga0070674_100007380 3300005356 Bacteria 6484
23 Ga0070673_100308809 3300005364 Bacteria 1394
24 Ga0070709_10003420 3300005434 Bacteria 8519
25 Ga0070709_10013947 3300005434 Bacteria 4532
26 Ga0070714_100000678 3300005435 Bacteria 24075
27 Ga0070713_100009012 3300005436 Bacteria 7113
28 Ga0070713_100013420 3300005436 Bacteria 6049
29 Ga0070713_100025339 3300005436 Bacteria 4636
30 Ga0070713_100056199 3300005436 Bacteria 3274
31 Ga0070713_100367676 3300005436 Bacteria 1337
32 Ga0070710_10001070 3300005437 Bacteria 12969
33 Ga0070710_10001844 3300005437 Bacteria 9988
34 Ga0070710_10006019 3300005437 Bacteria 5796
35 Ga0070710_10013558 3300005437 Bacteria 4085
36 Ga0070711_100023368 3300005439 Bacteria 4019
37 Ga0070711_100240303 3300005439 Bacteria 1416
38 Ga0070663_100013964 3300005455 Bacteria 5141
39 Ga0070663_100063801 3300005455 Bacteria 2661
40 Ga0070678_100005403 3300005456 Bacteria 7373
41 Ga0070681_10008262 3300005458 Bacteria 10185
42 Ga0068867_100075951 3300005459 Bacteria 2522
43 Ga0070707_100455330 3300005468 Bacteria 1240
44 Ga0070698_100096227 3300005471 Bacteria 2938
45 Ga0070679_100002812 3300005530 Bacteria 15817
46 Ga0070679_100050461 3300005530 Bacteria 4145
47 Ga0070684_100043160 3300005535 Bacteria 3893
48 Ga0068853_100099546 3300005539 Bacteria 2568
49 Ga0070672_100043370 3300005543 Bacteria 3468
50 Ga0070686_100033215 3300005544 Bacteria 3168
51 Ga0070665_100359586 3300005548 Bacteria 1462
52 Ga0070665_100407280 3300005548 Bacteria 1368
53 Ga0068855_100114907 3300005563 Bacteria 3086
54 Ga0068861_100188677 3300005719 Bacteria 1722
55 Ga0068858_100250682 3300005842 Bacteria 1681
56 Ga0081538_10001588 3300005981 Bacteria 23316
57 Ga0081540_1020697 3300005983 Bacteria 3946
58 Ga0081540_1041110 3300005983 Bacteria 2401
59 Ga0081539_10000191 3300005985 Bacteria 142387
60 Ga0081539_10011052 3300005985 Bacteria 7216
61 Ga0081539_10074603 3300005985 Bacteria 1806
62 Ga0081539_10099369 3300005985 Bacteria 1486
63 Ga0070717_10003370 3300006028 Bacteria 11415
64 Ga0075365_10002851 3300006038 Bacteria 8679
65 Ga0075365_10054670 3300006038 Bacteria 2648
66 Ga0075365_10079474 3300006038 Bacteria 2219
67 Ga0075363_100029371 3300006048 Bacteria 2838
68 Ga0070715_10000078 3300006163 Bacteria 27243
69 Ga0070716_100025778 3300006173 Bacteria 3142
70 Ga0070716_100044507 3300006173 Bacteria 2487
71 Ga0070712_100005689 3300006175 Bacteria 7705
72 Ga0070712_100032305 3300006175 Bacteria 3534
73 Ga0075362_10015721 3300006177 Bacteria 3083
74 Ga0075367_10016856 3300006178 Bacteria 3998
75 Ga0075367_10044513 3300006178 Bacteria 2602
76 Ga0075366_10007199 3300006195 Bacteria 6130
77 Ga0075370_10156875 3300006353 Bacteria 1334
78 Ga0075430_100364998 3300006846 Bacteria 1192
79 Ga0075431_100099390 3300006847 Bacteria 3003
80 Ga0075434_100020486 3300006871 Bacteria 6416
81 Ga0068865_100236085 3300006881 Bacteria 1437
82 Ga0099825_1024679 3300006941 Bacteria 3470
83 Ga0099825_1033995 3300006941 Bacteria 1931
84 Ga0105240_10049778 3300009093 Bacteria 5286
85 Ga0105240_10376122 3300009093 Bacteria 1605
86 Ga0105245_10133943 3300009098 Bacteria 2327
87 Ga0105245_10162274 3300009098 Bacteria 2122
88 Ga0105245_10163064 3300009098 Bacteria 2116
89 Ga0114129_10005905 3300009147 Bacteria 17321
90 Ga0105241_10022865 3300009174 Bacteria 4634
91 Ga0105248_10306077 3300009177 Bacteria 1790
92 Ga0105248_10666305 3300009177 Bacteria 1174
93 Ga0105237_10009189 3300009545 Bacteria 10610
94 Ga0105237_10025461 3300009545 Bacteria 6050
95 Ga0105238_10037341 3300009551 Bacteria 4938
96 Ga0105239_10032732 3300010375 Bacteria 5713
97 Ga0105239_10160756 3300010375 Bacteria 2509
98 Ga0105239_10199218 3300010375 Bacteria 2243
99 Ga0105239_10278669 3300010375 Bacteria 1882
100 Ga0105246_10159937 3300011119 Bacteria 1715
101 Ga0163162_10208360 3300013306 Bacteria 2084
102 Ga0163163_10278642 3300014325 Bacteria 1724
103 Ga0157380_10160426 3300014326 Bacteria 1954
104 Ga0214544_1000001 3300021320 Bacteria 783667
105 Ga0214542_1000005 3300021321 Bacteria 389646
106 Ga0214545_1000003 3300021324 Bacteria 720274
107 Ga0214545_1035368 3300021324 Bacteria 1659
108 Ga0214543_1000002 3300021327 Bacteria 712733
109 Ga0213873_10008870 3300021358 Bacteria 2070
110 Ga0213874_10005542 3300021377 Bacteria 2945
111 Ga0213876_10006563 3300021384 Bacteria 6343
112 Ga0213871_10007640 3300021441 Bacteria 2350
113 Ga0209563_101091 3300025230 Bacteria 7786
114 Ga0209677_100628 3300025253 Bacteria 18938
115 Ga0209677_105157 3300025253 Bacteria 3497
116 Ga0209148_1000424 3300025254 Bacteria 47087
117 Ga0209455_1002021 3300025272 Bacteria 8282
118 Ga0209564_1008318 3300025295 Bacteria 5140
119 Ga0209564_1018742 3300025295 Bacteria 2622
120 Ga0209758_1000186 3300025297 Bacteria 138804
121 Ga0209758_1000692 3300025297 Bacteria 49946
122 Ga0209758_1000880 3300025297 Bacteria 41231
123 Ga0209758_1002083 3300025297 Bacteria 21266
124 Ga0209758_1002692 3300025297 Bacteria 17520
125 Ga0209758_1002877 3300025297 Bacteria 16674
126 Ga0209758_1013600 3300025297 Bacteria 4418
127 Ga0209256_1001638 3300025299 Bacteria 21788
128 Ga0207426_1000425 3300025302 Bacteria 69088
129 Ga0207426_1002619 3300025302 Bacteria 11150
130 Ga0207426_1008620 3300025302 Bacteria 4095
131 Ga0207426_1016063 3300025302 Bacteria 2699
132 Ga0209051_1034563 3300025303 Bacteria 1893
133 Ga0209257_1000426 3300025304 Bacteria 81095
134 Ga0209257_1028596 3300025304 Bacteria 1831
135 Ga0207682_10000295 3300025893 Bacteria 22495
136 Ga0207692_10004404 3300025898 Bacteria 5571
137 Ga0207692_10010653 3300025898 Bacteria 3884
138 Ga0207710_10011666 3300025900 Bacteria 3697
139 Ga0207680_10171204 3300025903 Bacteria 1463
140 Ga0207647_10030271 3300025904 Bacteria 3493
141 Ga0207685_10023956 3300025905 Bacteria 2086
142 Ga0207685_10049618 3300025905 Bacteria 1613
143 Ga0207699_10000688 3300025906 Bacteria 16229
144 Ga0207699_10002405 3300025906 Bacteria 8845
145 Ga0207699_10016696 3300025906 Bacteria 3846
146 Ga0207699_10125319 3300025906 Bacteria 1667
147 Ga0207645_10067043 3300025907 Bacteria 2294
148 Ga0207654_10037955 3300025911 Bacteria 2700
149 Ga0207707_10000178 3300025912 Bacteria 66057
150 Ga0207695_10000062 3300025913 Bacteria 351979
151 Ga0207671_10016261 3300025914 Bacteria 5788
152 Ga0207671_10071220 3300025914 Bacteria 2593
153 Ga0207693_10004535 3300025915 Bacteria 11731
154 Ga0207693_10015732 3300025915 Bacteria 6063
155 Ga0207693_10040774 3300025915 Bacteria 3657
156 Ga0207663_10012571 3300025916 Bacteria 4581
157 Ga0207663_10160023 3300025916 Bacteria 1588
158 Ga0207657_10054471 3300025919 Bacteria 3459
159 Ga0207652_10034778 3300025921 Bacteria 4249
160 Ga0207652_10041372 3300025921 Bacteria 3917
161 Ga0207650_10135419 3300025925 Bacteria 1932
162 Ga0207700_10010260 3300025928 Bacteria 5898
163 Ga0207700_10011271 3300025928 Bacteria 5694
164 Ga0207700_10015348 3300025928 Bacteria 5050
165 Ga0207664_10019556 3300025929 Bacteria 5007
166 Ga0207644_10078579 3300025931 Bacteria 2432
167 Ga0207665_10000361 3300025939 Bacteria 31561
168 Ga0207665_10010893 3300025939 Bacteria 5969
169 Ga0207691_10002066 3300025940 Bacteria 19603
170 Ga0207689_10098598 3300025942 Bacteria 2401
171 Ga0207668_10037105 3300025972 Bacteria 3259
172 Ga0207658_10135457 3300025986 Bacteria 1985
173 Ga0207678_10028516 3300026067 Bacteria 4873
174 Ga0207678_10348387 3300026067 Bacteria 1277
175 Ga0207641_10094219 3300026088 Bacteria 2626
176 Ga0207676_10058427 3300026095 Bacteria 3042
177 Ga0207675_100095407 3300026118 Bacteria 2798
178 Ga0207675_100249952 3300026118 Bacteria 1716
179 Ga0207683_10004372 3300026121 Bacteria 12208
180 Ga0207698_10147677 3300026142 Bacteria 2036
181 Ga0207698_10341882 3300026142 Bacteria 1410
182 Ga0209389_1000090 3300027296 Bacteria 83470
183 Ga0209589_1000006 3300027357 Bacteria 436292
184 Ga0209489_100007 3300027361 Bacteria 436292
185 Ga0209489_100385 3300027361 Bacteria 79532
186 Ga0209700_100008 3300027363 Bacteria 436292
187 Ga0209700_100013 3300027363 Bacteria 341906
188 Ga0268264_10161148 3300028381 Bacteria 2021
189 Ga0265332_10000980 3300031238 Bacteria 16889
190 Ga0265320_10093878 3300031240 Bacteria 1387
191 Ga0265340_10001693 3300031247 Bacteria 12683
192 Ga0265339_10001736 3300031249 Bacteria 16043
193 Ga0265339_10007656 3300031249 Bacteria 6955
194 Ga0265331_10016592 3300031250 Bacteria 3863
195 Ga0265331_10030273 3300031250 Bacteria 2695
196 Ga0265314_10008186 3300031711 Bacteria 8990
197 Ga0265342_10000085 3300031712 Bacteria 100652
198 Ga0265342_10008190 3300031712 Bacteria 7536
199 Ga0307510_10010233 3300033180 Bacteria 11151
200 Ga0307510_10113876 3300033180 Bacteria 2436
201 Ga0373934_0013802 3300035086 Bacteria 3057
202 Ga0373936_0011319 3300035113 Bacteria 3377
203 Ga0373936_0018483 3300035113 Bacteria 2692
204 Ga0373954_0103642 3300035118 Bacteria 1373
205 Ga0373956_0034001 3300035119 Bacteria 2244
206 Ga0373943_0012862 3300035170 Bacteria 3772
207 Ga0373943_0012944 3300035170 Bacteria 3762
208 Ga0373935_0115418 3300035692 Bacteria 1787
209 Ga0373927_0010706 3300035695 Bacteria 6109
210 Ga0373927_0029274 3300035695 Bacteria 3588
211 Ga0373927_0104855 3300035695 Bacteria 1841
212 Ga0373933_0031680 3300035724 Bacteria 3068
213 Ga0373947_0006109 3300035725 Bacteria 7015
214 Ga0316584_0019981 3300036712 Bacteria 4849
215 Ga0373925_0057849 3300037068 Bacteria 2905
216 Ga0395900_0073084 3300037418 Bacteria 3525
217 Ga0395898_0015555 3300037466 Bacteria 7802
218 Ga0395905_0005164 3300037471 Bacteria 13394
219 Ga0436364_1520200 3300037853 Bacteria 2879
220 Ga0436365_0097773 3300039437 Bacteria 28049
221 Ga0436363_0058729 3300039450 Bacteria 3793
222 Ga0436363_1153624 3300039450 Bacteria 7126
223 Ga0436362_1134988 3300039453 Bacteria 6844
224 Ga0439453_0008146 3300041408 Bacteria 1677
225 Ga0466972_0001917 3300044658 Bacteria 10202
226 Ga0466968_0006404 3300044735 Bacteria 4438
227 Ga0466960_0030747 3300044901 Bacteria 2473
228 Ga0466960_0067500 3300044901 Bacteria 1771
229 Ga0466960_0068823 3300044901 Bacteria 1757
230 Ga0451576_0454546 3300045051 Bacteria 1345
231 Ga0466967_0500901 3300045976 Bacteria 1192
232 Ga0495592_0045326 3300046454 Bacteria 3282
233 Ga0495603_0050051 3300046455 Bacteria 2485
234 Ga0495651_0011061 3300046462 Bacteria 6945
235 Ga0495653_0010641 3300046463 Bacteria 7529
236 Ga0495582_0010687 3300046473 Bacteria 5049
237 Ga0495605_0032484 3300046474 Bacteria 2657
238 Ga0495639_0005521 3300046475 Bacteria 5444
239 Ga0495662_0004104 3300046476 Bacteria 7337
240 Ga0495664_0035627 3300046477 Bacteria 2931
241 Ga0495584_0126378 3300046491 Bacteria 1296
242 Ga0495585_0082956 3300046492 Bacteria 1735
243 Ga0495594_0017630 3300046499 Bacteria 3774
244 Ga0495594_0081058 3300046499 Bacteria 1812
245 Ga0495608_0132630 3300046511 Bacteria 1593
246 Ga0495618_0039210 3300046514 Bacteria 2978
247 Ga0495618_0081031 3300046514 Bacteria 2072
248 Ga0495644_0001788 3300046523 Bacteria 8677
249 Ga0495666_0033341 3300046526 Bacteria 2515
250 Ga0495652_0019488 3300046529 Bacteria 6040
251 Ga0495640_0096220 3300046533 Bacteria 1948
252 Ga0495586_0027659 3300046535 Bacteria 3034
253 Ga0495586_0031493 3300046535 Bacteria 2842
254 Ga0495587_0009540 3300046536 Bacteria 6215
255 Ga0495587_0023279 3300046536 Bacteria 3806
256 Ga0495587_0164255 3300046536 Bacteria 1263
257 Ga0495645_0010999 3300046543 Bacteria 6357
258 Ga0495622_0004539 3300046557 Bacteria 6426
259 Ga0495633_0006743 3300046558 Bacteria 6755
260 Ga0495667_0006874 3300046559 Bacteria 7727
261 Ga0495656_0004675 3300046615 Bacteria 4703
262 Ga0495634_0025657 3300046642 Bacteria 4117
263 Ga0495634_0036844 3300046642 Bacteria 3343
264 Ga0495611_0016814 3300046648 Bacteria 3126
265 Ga0495611_0109217 3300046648 Bacteria 1287
266 Ga0495635_0020931 3300046663 Bacteria 4558
267 Ga0495635_0052166 3300046663 Bacteria 2817
268 Ga0495635_0057760 3300046663 Bacteria 2670
269 Ga0495659_0001284 3300046664 Bacteria 8638
270 Ga0495661_0132522 3300046665 Bacteria 1364
271 Ga0495657_0002511 3300046675 Bacteria 15425
272 Ga0495599_0011780 3300046678 Bacteria 5376
273 Ga0495623_0006264 3300046679 Bacteria 7735
274 Ga0495623_0132932 3300046679 Bacteria 1488
275 Ga0495646_0020545 3300046680 Bacteria 4178
276 Ga0495646_0035018 3300046680 Bacteria 3115
277 Ga0495658_0023115 3300046683 Bacteria 3297
278 Ga0495670_0040397 3300046691 Bacteria 2327
279 Ga0495671_0044020 3300046692 Bacteria 2239
280 Ga0495649_0059891 3300046694 Bacteria 2049
281 Ga0495589_0102014 3300046794 Bacteria 1388
282 Ga0495600_0020701 3300046809 Bacteria 4207
283 Ga0495604_0008332 3300047317 Bacteria 8200
284 Ga0495604_0010634 3300047317 Bacteria 7298
285 Ga0495604_0153824 3300047317 Bacteria 1631
286 Ga0495674_0012502 3300047319 Bacteria 7997
287 Ga0495674_0144381 3300047319 Bacteria 1998
288 Ga0495672_0047610 3300047320 Bacteria 2548
289 Ga0495680_0004521 3300047322 Bacteria 13286
290 Ga0495675_0156374 3300047444 Bacteria 1406
291 Ga0495679_028983 3300047446 Bacteria 1810
292 Ga0495684_0003057 3300047471 Bacteria 13153
293 Ga0495593_0015059 3300047673 Bacteria 4393
294 Ga0495602_0129415 3300048088 Bacteria 2016
295 Ga0495614_0027265 3300048089 Bacteria 2463
296 Ga0496101_0293081 3300048904 Bacteria 1273
297 Ga0496102_0074345 3300048905 Bacteria 3123
298 Ga0496103_0178151 3300048906 Bacteria 1366
299 Ga0496105_0010871 3300048908 Bacteria 7167
300 Ga0496105_0052236 3300048908 Bacteria 3375
301 Ga0496106_0013998 3300048909 Bacteria 5930
302 Ga0496107_0008041 3300048910 Bacteria 7282
303 Ga0496108_0054415 3300048911 Bacteria 3358
304 Ga0496108_0059826 3300048911 Bacteria 3204
305 Ga0496108_0335177 3300048911 Bacteria 1319
306 Ga0496110_0073104 3300048913 Bacteria 3043
307 Ga0496110_0083474 3300048913 Bacteria 2850
308 Ga0496111_0136516 3300048914 Bacteria 1817
309 Ga0496111_0163311 3300048914 Bacteria 1654
310 Ga0496112_0041349 3300048915 Bacteria 4510
311 Ga0496113_0112882 3300048916 Bacteria 2117
312 Ga0496115_0092245 3300048918 Bacteria 2476
313 Ga0496115_0164324 3300048918 Bacteria 1835
314 Ga0496116_0018487 3300048919 Bacteria 5372
315 Ga0496118_0009476 3300048921 Bacteria 9827
316 Ga0496119_0006574 3300048922 Bacteria 10715
317 Ga0496119_0036521 3300048922 Bacteria 3206
318 Ga0496119_0085943 3300048922 Bacteria 1799
319 Ga0496121_0008807 3300048924 Bacteria 11754
320 Ga0496121_0018234 3300048924 Bacteria 7095
321 Ga0496121_0053877 3300048924 Bacteria 3366
322 Ga0496121_0117401 3300048924 Bacteria 2016
323 Ga0496122_0176321 3300048925 Bacteria 1281
324 Ga0496125_0061192 3300048928 Bacteria 3021
325 Ga0496126_0274804 3300048929 Bacteria 1397
326 Ga0496126_0342025 3300048929 Bacteria 1225
327 Ga0501031_0000792 3300049568 Bacteria 19041
328 Ga0501032_0003462 3300049569 Bacteria 12091
329 Ga0501033_0000249 3300049570 Bacteria 52045
330 Ga0501033_0233439 3300049570 Bacteria 1306
331 Ga0501034_0001938 3300049571 Bacteria 26206
332 Ga0501036_0000179 3300049572 Bacteria 41780
333 Ga0501037_0000112 3300049573 Bacteria 75698
334 Ga0501038_0000160 3300049574 Bacteria 57443
335 Ga0501039_0001057 3300049575 Bacteria 20191
336 Ga0501043_0000278 3300049579 Bacteria 46214
337 Ga0501043_0019781 3300049579 Bacteria 5287
338 Ga0501046_0000653 3300049580 Bacteria 33778
339 Ga0501046_0065396 3300049580 Bacteria 2837
340 Ga0501047_0000275 3300049581 Bacteria 59536
341 Ga0501048_0000426 3300049582 Bacteria 29633
342 Ga0501067_0000258 3300049583 Bacteria 28937
343 Ga0501068_0002382 3300049584 Bacteria 9992
344 Ga0501069_0006432 3300049585 Bacteria 6141
345 Ga0501070_0021007 3300049586 Bacteria 5476
346 Ga0501070_0154305 3300049586 Bacteria 1894
347 Ga0501073_0000103 3300049589 Bacteria 53962
348 Ga0501077_0072588 3300049593 Bacteria 2181
349 Ga0501079_0000451 3300049741 Bacteria 26871
350 Ga0501080_0008747 3300049742 Bacteria 9194
351 Ga0501083_0013555 3300049744 Bacteria 5699
352 Ga0501035_0000766 3300049822 Bacteria 34513
353 Ga0501044_0000418 3300049823 Bacteria 52554
354 nmdc:mga03n38_2329_c1 3300050490 Bacteria 5834
355 nmdc:mga03n38_50118_c1 3300050490 Bacteria 1859
356 nmdc:mga03n38_57640_c1 3300050490 Bacteria 1757
357 nmdc:mga0yw44_6905_c1 3300050492 Bacteria 5530
358 nmdc:mga0k408_20455_c1 3300050493 Bacteria 3708
359 nmdc:mga06z11_23684_c1 3300050494 Bacteria 2888
360 nmdc:mga06z11_6672_c1 3300050494 Bacteria 4718
361 nmdc:mga07m45_22674_c1 3300050496 Bacteria 3430
362 nmdc:mga06r32_13817_c1 3300050510 Bacteria 7325
363 nmdc:mga0n895_73473_c1 3300050512 Bacteria 3395
364 nmdc:mga0sz30_26281_c1 3300050516 Bacteria 2386
365 Ga0495601_0128026 3300053077 Bacteria 1653
366 Ga0495612_0021318 3300053078 Bacteria 2599
367 Ga0495655_0008676 3300053083 Bacteria 1942
368 Ga0495595_0001773 3300053084 Bacteria 8430
369 Ga0500578_0136518 3300053086 Bacteria 1535
370 Ga0500643_000267 3300053087 Bacteria 46005
371 Ga0500583_0043725 3300053092 Bacteria 2047
372 Ga0500566_0000921 3300053094 Bacteria 16824
373 Ga0500640_000942 3300053095 Bacteria 8202
374 Ga0500555_009614 3300053103 Bacteria 2766
375 Ga0500569_028515 3300053109 Bacteria 1548
376 Ga0500572_001211 3300053111 Bacteria 7333
377 Ga0500572_002696 3300053111 Bacteria 4202
378 Ga0500614_000296 3300053123 Bacteria 12778
379 Ga0500658_0033954 3300053134 Bacteria 2010
380 Ga0500559_0000640 3300053136 Bacteria 23656
381 Ga0500559_0002369 3300053136 Bacteria 9822
382 Ga0500568_0017339 3300053139 Bacteria 3180
383 Ga0500577_0000770 3300053142 Bacteria 8239
384 Ga0500577_0059779 3300053142 Bacteria 1462
385 Ga0500603_001029 3300053150 Bacteria 6549
386 Ga0500619_038979 3300053154 Bacteria 1491
387 Ga0500620_001319 3300053155 Bacteria 4501
388 Ga0500630_000672 3300053159 Bacteria 15562
389 Ga0500639_000014 3300053163 Bacteria 122926
390 Ga0500636_0001006 3300053177 Bacteria 15083
391 Ga0500625_009408 3300053729 Bacteria 4357
392 Ga0500601_000299 3300053737 Bacteria 9293
393 Ga0500661_009294 3300055283 Bacteria 1803
394 Ga0501082_0005697 3300060353 Bacteria 10808
395 2507511020 2507262055 Bacteria 8048963
396 2508544841 2508501009 Bacteria 7784016
397 2508696930 2508501042 Bacteria 8719808
398 2511395179 2511231028 Bacteria 8046582
399 2513623494 2513237092 Bacteria 8341956
400 2513637460 2513237094 Bacteria 8789602
401 2513649690 2513237095 Bacteria 8976980
402 2513699965 2513237102 Bacteria 7703324
403 2513716926 2513237104 Bacteria 10034502
404 2513892093 2513237141 Bacteria 8496279
405 2514010623 2513237161 Bacteria 8871253
406 2517100599 2517093001 Bacteria 9002274
407 2524438177 2524023205 Bacteria 8918781
408 2524534501 2524023228 Bacteria 10118060
409 2617350785 2617270735 Bacteria 9163226
410 2617373154 2617270741 Bacteria 8201522
411 2728747592 2728368998 Bacteria 8720350
412 2745076942 2744054633 Bacteria 8678936
413 2793064673 2791355196 Bacteria 7323613
414 2818238161 2816332527 Bacteria 8933356
415 2824607738 2824600985 Bacteria 8488197
416 2824617124 2824609381 Bacteria 8672835
417 2824624270 2824617872 Bacteria 8814715
418 2824633048 2824626560 Bacteria 8813858
419 2824641046 2824635225 Bacteria 8785348
420 2824648766 2824644064 Bacteria 8743947
421 2824658720 2824653114 Bacteria 8493680
422 2824668274 2824661429 Bacteria 9877870
423 2824676188 2824671348 Bacteria 8369588
424 2824682877 2824679649 Bacteria 8248951
425 2824692354 2824687955 Bacteria 8360029
426 2824713326 2824704595 Bacteria 9667483
427 2824723099 2824714736 Bacteria 8717648
428 2824731384 2824723954 Bacteria 8758240
429 2824740627 2824732956 Bacteria 7810675
430 2824751548 2824746037 Bacteria 7911610
431 2824761232 2824753945 Bacteria 9787441
432 2824771843 2824763712 Bacteria 9792355
433 2838127904 2838122688 Bacteria 8803140
434 2841954071 2841949485 Bacteria 8680857
435 2841960210 2841957949 Bacteria 8652217
436 2841968162 2841966195 Bacteria 8673214
437 2841988001 2841983080 Bacteria 8395090
438 2842042696 2842038055 Bacteria 8002051
439 2842050739 2842045827 Bacteria 8006841
440 2844316905 2844315083 Bacteria 8138177
441 2847938571 2847930680 Bacteria 9342022
442 2849081539 2849076700 Bacteria 7039503
443 2857512198 2857509624 Bacteria 7472071
444 2874597757 2874590934 Bacteria 8299676
445 2874617688 2874612657 Bacteria 8252029
446 2874623426 2874620515 Bacteria 8290088
447 2874630663 2874628541 Bacteria 8630250
448 2874651286 2874645413 Bacteria 8214782
449 2876762393 2876761206 Bacteria 10111113
450 2876776357 2876771140 Bacteria 8287509
451 2876820925 2876818435 Bacteria 8274608
452 2879081780 2879074833 Bacteria 8279565
453 2879086184 2879083081 Bacteria 8587928
454 2879101340 2879099564 Bacteria 10442239
455 2879130495 2879127579 Bacteria 8294491
456 2879146381 2879142872 Bacteria 8267021
457 2881370690 2881364244 Bacteria 7710352
458 2881671324 2881665667 Bacteria 8175609
459 2885366925 2885366525 Bacteria 8326213
460 2888381516 2888378607 Bacteria 9652610
461 2888389123 2888388044 Bacteria 7304136
462 2888421919 2888419890 Bacteria 7857137
463 2903733955 2903727486 Bacteria 8281579
464 2904667343 2904666416 Bacteria 8226587
465 2904719236 2904711408 Bacteria 9771557
466 2906604571 2906602504 Bacteria 8295279
467 2906635187 2906626472 Bacteria 8826946
468 2906650953 2906643746 Bacteria 8722424
469 2908781609 2908775508 Bacteria 8092255
470 2922371184
471 2922393556 2922393267 Bacteria 8285685
472 2932785898 2932784394 Bacteria 9704911
473 2932798322 2932794094 Bacteria 7915132
474 2932804118 2932801729 Bacteria 7987968
475 2932817268 2932809354 Bacteria 9135765
476 2932826865 2932818245 Bacteria 9955613
477 2932830942 2932828146 Bacteria 9745859
478 2933581488 2933577622 Bacteria 9116884
479 2935612743 2935608549 Bacteria 8203142
480 2935621007 2935616580 Bacteria 9032984
481 2935640083 2935638405 Bacteria 10015038
482 2935656784 2935648319 Bacteria 8801166
483 2935665611 2935656913 Bacteria 8965014
484 2935667078 2935665750 Bacteria 9571747
485 2935680279 2935675223 Bacteria 9928132
486 2935690210 2935684952 Bacteria 9590419
487 2935699704 2935694250 Bacteria 9291695
488 2935704834 2935703347 Bacteria 10242284
489 2935718093 2935713505 Bacteria 9608509
490 2935726757 2935722832 Bacteria 9608746
491 2935735526 2935732158 Bacteria 9706831
492 2935745203 2935741537 Bacteria 9707219
493 2935755221 2935750917 Bacteria 9590372
494 2935762261 2935760218 Bacteria 9817913
495 2935773649 2935769743 Bacteria 7878163
496 2935780203 2935777560 Bacteria 8077691
497 2935788446 2935785616 Bacteria 7962367
498 2935796602 2935793552 Bacteria 8012592
499 2935803764 2935801545 Bacteria 9301974
500 2935811679 2935810662 Bacteria 9401221
501 2935824232 2935819856 Bacteria 8261050
502 2935829566 2935827899 Bacteria 10038562
503 2935843100 2935837841 Bacteria 9454360
504 2935852621 2935847175 Bacteria 8228321
505 2935858814 2935855204 Bacteria 9035059
506 2935866788 2935864058 Bacteria 9784707
507 2935876919 2935873716 Bacteria 9632195
508 2935884076 2935883170 Bacteria 7964738
509 2935912233 2935908558 Bacteria 8568796
510 2935924093 2935916978 Bacteria 9113783
511 2935929262 2935926038 Bacteria 8601059
512 2935935893 2935934488 Bacteria 8602579
513 2935950401 2935942939 Bacteria 8599779
514 2935957441 2935951376 Bacteria 8602333
515 2935968472 2935967501 Bacteria 8603075
516 2935976661 2935975950 Bacteria 8347125
517 2935990714 2935984226 Bacteria 8302647
518 2935993444 2935992306 Bacteria 9802711
519 2936004339 2936002035 Bacteria 9362176
520 2936019661 2936011229 Bacteria 8801034
521 2936028282 2936019824 Bacteria 8804134
522 2936037146 2936028420 Bacteria 8965941
523 2936038261 2936037263 Bacteria 9446081
524 2936055134 2936046547 Bacteria 8903709
525 2936058599 2936055302 Bacteria 8785755
526 2940561498 2940556831 Bacteria 9590747
527 2941533685 2941531003 Bacteria 7653939
528 2941544324 2941538514 Bacteria 9402094
529 3005486174 3005483717 Bacteria 7877331
530 3005593076 3005587118 Bacteria 7794411
531 3005596539 3005594810 Bacteria 8716512
532 3005712607 3005710791 Bacteria 7622528
533 3005719668 3005718088 Bacteria 8283608
534 8006927613 8006926726 Bacteria 6749210
535 8016516443 8016511872 Bacteria 9921665
536 8016589123 8016583857 Bacteria 10421953
537 8016604070 8016603502 Bacteria 8731218
538 8016620655 8016613128 Bacteria 8794220
539 8016629342 8016622563 Bacteria 7999408
540 8016633859 8016630954 Bacteria 9217207
541 8017060094 8017057580 Bacteria 10023680
542 8019542480 8019538911 Bacteria 7872763
543 8019548273 8019547302 Bacteria 7996444
544 8019579603 8019576017 Bacteria 10049540
545 8019587312 8019586578 Bacteria 10212056
546 8019604027 8019597564 Bacteria 10041141
547 8019614501 8019608314 Bacteria 10042931
548 8019625128 8019619141 Bacteria 9218857
549 8019637053 8019629233 Bacteria 8687553
550 8019642551 8019638758 Bacteria 9062356
551 8019664897 8019659431 Bacteria 8577854
552 8019674453 8019668869 Bacteria 8791617
553 8019681649 8019678201 Bacteria 8863603
554 8055749174 8055742211 Bacteria 9226248
555 8056695178 8056689827 Bacteria 6712655
556 8056969712 8056967851 Bacteria 9038162
557 Ga0500638_067346
558 RicEn_C770
559 JGI25153J46596_10002182
560 JGI25153J46596_10008407
561 JGI25153J46596_10008897
562 JGI25153J46596_10011112
563 JGI25153J46596_10039722
564 JGI25160J50197_1002761
565 JGI25160J50197_1002784
566 JGI25160J50197_1004195
567 Ga0055539_1003031
568 Ga0055531_10010031
569 Ga0055531_10032460
570 Ga0065165_1003406
571 Ga0065165_1004368
572 Ga0065165_1005272
573 Ga0070683_100083817
574 Ga0070677_10007120
575 Ga0070680_100148998
576 Ga0070669_100111255
577 Ga0070671_100054377
578 Ga0070674_100007380
579 Ga0070673_100308809
580 Ga0070709_10003420
581 Ga0070709_10013947
582 Ga0070714_100000678
583 Ga0070713_100009012
584 Ga0070713_100013420
585 Ga0070713_100025339
586 Ga0070713_100056199
587 Ga0070713_100367676
588 Ga0070710_10001070
589 Ga0070710_10001844
590 Ga0070710_10006019
591 Ga0070710_10013558
592 Ga0070711_100023368
593 Ga0070711_100240303
594 Ga0070663_100013964
595 Ga0070663_100063801
596 Ga0070678_100005403
597 Ga0070681_10008262
598 Ga0068867_100075951
599 Ga0070707_100455330
600 Ga0070698_100096227
601 Ga0070679_100002812
602 Ga0070679_100050461
603 Ga0070684_100043160
604 Ga0068853_100099546
605 Ga0070672_100043370
606 Ga0070686_100033215
607 Ga0070665_100359586
608 Ga0070665_100407280
609 Ga0068855_100114907
610 Ga0068861_100188677
611 Ga0068858_100250682
612 Ga0081538_10001588
613 Ga0081540_1020697
614 Ga0081540_1041110
615 Ga0081539_10000191
616 Ga0081539_10011052
617 Ga0081539_10074603
618 Ga0081539_10099369
619 Ga0070717_10003370
620 Ga0075365_10002851
621 Ga0075365_10054670
622 Ga0075365_10079474
623 Ga0075363_100029371
624 Ga0070715_10000078
625 Ga0070716_100025778
626 Ga0070716_100044507
627 Ga0070712_100005689
628 Ga0070712_100032305
629 Ga0075362_10015721
630 Ga0075367_10016856
631 Ga0075367_10044513
632 Ga0075366_10007199
633 Ga0075370_10156875
634 Ga0075430_100364998
635 Ga0075431_100099390
636 Ga0075434_100020486
637 Ga0068865_100236085
638 Ga0099825_1024679
639 Ga0099825_1033995
640 Ga0105240_10049778
641 Ga0105240_10376122
642 Ga0105245_10133943
643 Ga0105245_10162274
644 Ga0105245_10163064
645 Ga0114129_10005905
646 Ga0105241_10022865
647 Ga0105248_10306077
648 Ga0105248_10666305
649 Ga0105237_10009189
650 Ga0105237_10025461
651 Ga0105238_10037341
652 Ga0105239_10032732
653 Ga0105239_10160756
654 Ga0105239_10199218
655 Ga0105239_10278669
656 Ga0105246_10159937
657 Ga0163162_10208360
658 Ga0163163_10278642
659 Ga0157380_10160426
660 Ga0214544_1000001
661 Ga0214542_1000005
662 Ga0214545_1000003
663 Ga0214545_1035368
664 Ga0214543_1000002
665 Ga0213873_10008870
666 Ga0213874_10005542
667 Ga0213876_10006563
668 Ga0213871_10007640
669 Ga0209563_101091
670 Ga0209677_100628
671 Ga0209677_105157
672 Ga0209148_1000424
673 Ga0209455_1002021
674 Ga0209564_1008318
675 Ga0209564_1018742
676 Ga0209758_1000186
677 Ga0209758_1000692
678 Ga0209758_1000880
679 Ga0209758_1002083
680 Ga0209758_1002692
681 Ga0209758_1002877
682 Ga0209758_1013600
683 Ga0209256_1001638
684 Ga0207426_1000425
685 Ga0207426_1002619
686 Ga0207426_1008620
687 Ga0207426_1016063
688 Ga0209051_1034563
689 Ga0209257_1000426
690 Ga0209257_1028596
691 Ga0207682_10000295
692 Ga0207692_10004404
693 Ga0207692_10010653
694 Ga0207710_10011666
695 Ga0207680_10171204
696 Ga0207647_10030271
697 Ga0207685_10023956
698 Ga0207685_10049618
699 Ga0207699_10000688
700 Ga0207699_10002405
701 Ga0207699_10016696
702 Ga0207699_10125319
703 Ga0207645_10067043
704 Ga0207654_10037955
705 Ga0207707_10000178
706 Ga0207695_10000062
707 Ga0207671_10016261
708 Ga0207671_10071220
709 Ga0207693_10004535
710 Ga0207693_10015732
711 Ga0207693_10040774
712 Ga0207663_10012571
713 Ga0207663_10160023
714 Ga0207657_10054471
715 Ga0207652_10034778
716 Ga0207652_10041372
717 Ga0207650_10135419
718 Ga0207700_10010260
719 Ga0207700_10011271
720 Ga0207700_10015348
721 Ga0207664_10019556
722 Ga0207644_10078579
723 Ga0207665_10000361
724 Ga0207665_10010893
725 Ga0207691_10002066
726 Ga0207689_10098598
727 Ga0207668_10037105
728 Ga0207658_10135457
729 Ga0207678_10028516
730 Ga0207678_10348387
731 Ga0207641_10094219
732 Ga0207676_10058427
733 Ga0207675_100095407
734 Ga0207675_100249952
735 Ga0207683_10004372
736 Ga0207698_10147677
737 Ga0207698_10341882
738 Ga0209389_1000090
739 Ga0209589_1000006
740 Ga0209489_100007
741 Ga0209489_100385
742 Ga0209700_100008
743 Ga0209700_100013
744 Ga0268264_10161148
745 Ga0265332_10000980
746 Ga0265320_10093878
747 Ga0265340_10001693
748 Ga0265339_10001736
749 Ga0265339_10007656
750 Ga0265331_10016592
751 Ga0265331_10030273
752 Ga0265314_10008186
753 Ga0265342_10000085
754 Ga0265342_10008190
755 Ga0307510_10010233
756 Ga0307510_10113876
757 Ga0373934_0013802
758 Ga0373936_0011319
759 Ga0373936_0018483
760 Ga0373954_0103642
761 Ga0373956_0034001
762 Ga0373943_0012862
763 Ga0373943_0012944
764 Ga0373935_0115418
765 Ga0373927_0010706
766 Ga0373927_0029274
767 Ga0373927_0104855
768 Ga0373933_0031680
769 Ga0373947_0006109
770 Ga0316584_0019981
771 Ga0373925_0057849
772 Ga0395900_0073084
773 Ga0395898_0015555
774 Ga0395905_0005164
775 Ga0436364_1520200
776 Ga0436365_0097773
777 Ga0436363_0058729
778 Ga0436363_1153624
779 Ga0436362_1134988
780 Ga0439453_0008146
781 Ga0466972_0001917
782 Ga0466968_0006404
783 Ga0466960_0030747
784 Ga0466960_0067500
785 Ga0466960_0068823
786 Ga0451576_0454546
787 Ga0466967_0500901
788 Ga0495592_0045326
789 Ga0495603_0050051
790 Ga0495651_0011061
791 Ga0495653_0010641
792 Ga0495582_0010687
793 Ga0495605_0032484
794 Ga0495639_0005521
795 Ga0495662_0004104
796 Ga0495664_0035627
797 Ga0495584_0126378
798 Ga0495585_0082956
799 Ga0495594_0017630
800 Ga0495594_0081058
801 Ga0495608_0132630
802 Ga0495618_0039210
803 Ga0495618_0081031
804 Ga0495644_0001788
805 Ga0495666_0033341
806 Ga0495652_0019488
807 Ga0495640_0096220
808 Ga0495586_0027659
809 Ga0495586_0031493
810 Ga0495587_0009540
811 Ga0495587_0023279
812 Ga0495587_0164255
813 Ga0495645_0010999
814 Ga0495622_0004539
815 Ga0495633_0006743
816 Ga0495667_0006874
817 Ga0495656_0004675
818 Ga0495634_0025657
819 Ga0495634_0036844
820 Ga0495611_0016814
821 Ga0495611_0109217
822 Ga0495635_0020931
823 Ga0495635_0052166
824 Ga0495635_0057760
825 Ga0495659_0001284
826 Ga0495661_0132522
827 Ga0495657_0002511
828 Ga0495599_0011780
829 Ga0495623_0006264
830 Ga0495623_0132932
831 Ga0495646_0020545
832 Ga0495646_0035018
833 Ga0495658_0023115
834 Ga0495670_0040397
835 Ga0495671_0044020
836 Ga0495649_0059891
837 Ga0495589_0102014
838 Ga0495600_0020701
839 Ga0495604_0008332
840 Ga0495604_0010634
841 Ga0495604_0153824
842 Ga0495674_0012502
843 Ga0495674_0144381
844 Ga0495672_0047610
845 Ga0495680_0004521
846 Ga0495675_0156374
847 Ga0495679_028983
848 Ga0495684_0003057
849 Ga0495593_0015059
850 Ga0495602_0129415
851 Ga0495614_0027265
852 Ga0496101_0293081
853 Ga0496102_0074345
854 Ga0496103_0178151
855 Ga0496105_0010871
856 Ga0496105_0052236
857 Ga0496106_0013998
858 Ga0496107_0008041
859 Ga0496108_0054415
860 Ga0496108_0059826
861 Ga0496108_0335177
862 Ga0496110_0073104
863 Ga0496110_0083474
864 Ga0496111_0136516
865 Ga0496111_0163311
866 Ga0496112_0041349
867 Ga0496113_0112882
868 Ga0496115_0092245
869 Ga0496115_0164324
870 Ga0496116_0018487
871 Ga0496118_0009476
872 Ga0496119_0006574
873 Ga0496119_0036521
874 Ga0496119_0085943
875 Ga0496121_0008807
876 Ga0496121_0018234
877 Ga0496121_0053877
878 Ga0496121_0117401
879 Ga0496122_0176321
880 Ga0496125_0061192
881 Ga0496126_0274804
882 Ga0496126_0342025
883 Ga0501031_0000792
884 Ga0501032_0003462
885 Ga0501033_0000249
886 Ga0501033_0233439
887 Ga0501034_0001938
888 Ga0501036_0000179
889 Ga0501037_0000112
890 Ga0501038_0000160
891 Ga0501039_0001057
892 Ga0501043_0000278
893 Ga0501043_0019781
894 Ga0501046_0000653
895 Ga0501046_0065396
896 Ga0501047_0000275
897 Ga0501048_0000426
898 Ga0501067_0000258
899 Ga0501068_0002382
900 Ga0501069_0006432
901 Ga0501070_0021007
902 Ga0501070_0154305
903 Ga0501073_0000103
904 Ga0501077_0072588
905 Ga0501079_0000451
906 Ga0501080_0008747
907 Ga0501083_0013555
908 Ga0501035_0000766
909 Ga0501044_0000418
910 nmdc:mga03n38_2329_c1
911 nmdc:mga03n38_50118_c1
912 nmdc:mga03n38_57640_c1
913 nmdc:mga0yw44_6905_c1
914 nmdc:mga0k408_20455_c1
915 nmdc:mga06z11_23684_c1
916 nmdc:mga06z11_6672_c1
917 nmdc:mga07m45_22674_c1
918 nmdc:mga06r32_13817_c1
919 nmdc:mga0n895_73473_c1
920 nmdc:mga0sz30_26281_c1
921 Ga0495601_0128026
922 Ga0495612_0021318
923 Ga0495655_0008676
924 Ga0495595_0001773
925 Ga0500578_0136518
926 Ga0500643_000267
927 Ga0500583_0043725
928 Ga0500566_0000921
929 Ga0500640_000942
930 Ga0500555_009614
931 Ga0500569_028515
932 Ga0500572_001211
933 Ga0500572_002696
934 Ga0500614_000296
935 Ga0500658_0033954
936 Ga0500559_0000640
937 Ga0500559_0002369
938 Ga0500568_0017339
939 Ga0500577_0000770
940 Ga0500577_0059779
941 Ga0500603_001029
942 Ga0500619_038979
943 Ga0500620_001319
944 Ga0500630_000672
945 Ga0500639_000014
946 Ga0500636_0001006
947 Ga0500625_009408
948 Ga0500601_000299
949 Ga0500661_009294
950 Ga0501082_0005697
951 2507511020
952 2508544841
953 2508696930
954 2511395179
955 2513623494
956 2513637460
957 2513649690
958 2513699965
959 2513716926
960 2513892093
961 2514010623
962 2517100599
963 2524438177
964 2524534501
965 2617350785
966 2617373154
967 2728747592
968 2745076942
969 2793064673
970 2818238161
971 2824607738
972 2824617124
973 2824624270
974 2824633048
975 2824641046
976 2824648766
977 2824658720
978 2824668274
979 2824676188
980 2824682877
981 2824692354
982 2824713326
983 2824723099
984 2824731384
985 2824740627
986 2824751548
987 2824761232
988 2824771843
989 2838127904
990 2841954071
991 2841960210
992 2841968162
993 2841988001
994 2842042696
995 2842050739
996 2844316905
997 2847938571
998 2849081539
999 2857512198
1000 2874597757
1001 2874617688
1002 2874623426
1003 2874630663
1004 2874651286
1005 2876762393
1006 2876776357
1007 2876820925
1008 2879081780
1009 2879086184
1010 2879101340
1011 2879130495
1012 2879146381
1013 2881370690
1014 2881671324
1015 2885366925
1016 2888381516
1017 2888389123
1018 2888421919
1019 2903733955
1020 2904667343
1021 2904719236
1022 2906604571
1023 2906635187
1024 2906650953
1025 2908781609
1026 2922371184
1027 2922393556
1028 2932785898
1029 2932798322
1030 2932804118
1031 2932817268
1032 2932826865
1033 2932830942
1034 2933581488
1035 2935612743
1036 2935621007
1037 2935640083
1038 2935656784
1039 2935665611
1040 2935667078
1041 2935680279
1042 2935690210
1043 2935699704
1044 2935704834
1045 2935718093
1046 2935726757
1047 2935735526
1048 2935745203
1049 2935755221
1050 2935762261
1051 2935773649
1052 2935780203
1053 2935788446
1054 2935796602
1055 2935803764
1056 2935811679
1057 2935824232
1058 2935829566
1059 2935843100
1060 2935852621
1061 2935858814
1062 2935866788
1063 2935876919
1064 2935884076
1065 2935912233
1066 2935924093
1067 2935929262
1068 2935935893
1069 2935950401
1070 2935957441
1071 2935968472
1072 2935976661
1073 2935990714
1074 2935993444
1075 2936004339
1076 2936019661
1077 2936028282
1078 2936037146
1079 2936038261
1080 2936055134
1081 2936058599
1082 2940561498
1083 2941533685
1084 2941544324
1085 3005486174
1086 3005593076
1087 3005596539
1088 3005712607
1089 3005719668
1090 8006927613
1091 8016516443
1092 8016589123
1093 8016604070
1094 8016620655
1095 8016629342
1096 8016633859
1097 8017060094
1098 8019542480
1099 8019548273
1100 8019579603
1101 8019587312
1102 8019604027
1103 8019614501
1104 8019625128
1105 8019637053
1106 8019642551
1107 8019664897
1108 8019674453
1109 8019681649
1110 8055749174
1111 8056695178
1112 8056969712

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

75

377

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9515 6 307
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9449 6 307
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9354 8 308
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9322 8 308
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9094 6 305
ID Description Score Start End Superfamily
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9653 113 211 1.10.150.170
1wg8B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9607 113 211 1.10.150.170
af_P9WJP1_66_380_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9399 7 306 3.40.50.150
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9396 6 307 3.40.50.150
af_P60390_9_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9336 8 308 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7S7QUH8-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9674 2 329 GO:0005737
GO:0070475
GO:0071424
AF-A0A176Z2R9-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9654 1 329 GO:0005737
GO:0070475
GO:0071424
AF-A0A660XZT3-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9632 6 305 GO:0005737
GO:0070475
GO:0071424
AF-A0A7S7QUH8-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9616 2 329 GO:0005737
GO:0070475
GO:0071424
AF-A0A418MKK4-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9563 8 307 GO:0005737
GO:0070475
GO:0071424

Map