F463262
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 556 | 439 | 1112 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300053162|Ga0500638_067346|Ga0500638_067346_313_1515 |
| Length | 400 |
| Sequence | MAIQQIPCGNVGLRRGASGIVDRAGRGLFPDFALKSRAERRDLGRNGPVCIAFSDVAPERFRSRRMTEADSRHVPVHIPVLGLEAVEMLSPQAGGVYVDATFGAGGYSRAILDVAGTRVIGIDRDRTAIAGGFGLVEQSGGRLTLVEGRFSNLAEVCAAQGFAEVDGIVMDVGVSSMQLDQAGRGFSFRLDGPLDMRMGQDGPTAADVVATADEAELANIIYIFGEERHSRAVARAVVAARKDAPIATTRALAEIVARVVRGKPGEIHPATRTFQALRIFVNEELDELQSALAAAERVLKPGGRLAVVSFHSLEDRIVKNFLNARAKASAGSRHRPELAQAAPSFHLLTKRPVTAGETELAANPRARSAKLRAAERTGAAAHRAADAPSWPRLSDVKRGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 45 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 66 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 67 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 68 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 69 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 70 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 73 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 117 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 121 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 122 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 127 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 129 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 134 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 135 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 136 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 144 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 145 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 146 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 147 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 148 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 149 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 214 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 215 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 216 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 217 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 218 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 219 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 220 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 244 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 245 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 246 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 247 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 256 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 257 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 258 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 259 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 260 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 261 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 262 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 263 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 264 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 265 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 266 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 267 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 268 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 269 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 270 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 271 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 272 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 273 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 275 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 276 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 277 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 279 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 280 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 281 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 282 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 283 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 284 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 285 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 286 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 287 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 288 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 289 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 290 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 291 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 292 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 293 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 294 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 295 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 296 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 297 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 298 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 299 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 300 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 301 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 302 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 303 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 304 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 305 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 306 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 307 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 308 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 309 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 310 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 311 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 312 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 313 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 314 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 315 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 316 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 317 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 318 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 319 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 320 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 321 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 322 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 323 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 324 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 325 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 326 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 327 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 328 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 329 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 330 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 331 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 332 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 333 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 334 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 335 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 336 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 337 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 338 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 339 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 340 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 341 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 342 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 343 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 344 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 345 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 346 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 347 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 348 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 349 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 350 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 351 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 352 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 353 | 2922368715 | |||
| 354 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 355 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 356 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 357 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 358 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 359 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 360 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 361 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 362 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 363 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 364 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 365 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 366 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 367 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 368 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 369 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 370 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 371 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 372 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 373 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 374 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 375 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 376 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 377 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 378 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 379 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 380 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 381 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 382 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 383 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 384 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 385 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 386 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 387 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 388 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 389 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 390 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 391 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 392 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 393 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 394 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 395 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 396 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 397 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 398 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 399 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 400 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 401 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 402 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 403 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 404 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 405 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 406 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 407 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 408 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 409 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 410 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 411 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 412 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 413 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 414 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 415 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 416 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 417 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 418 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 419 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 420 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 421 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 422 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 423 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 424 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 425 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 426 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 427 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 428 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 429 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 430 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 431 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 432 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 433 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 434 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 435 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 436 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 437 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 438 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 439 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 70.99 |
| Metatranscriptomes | 0 |
| Isolates | 29.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.57 |
| Nodule | 23.56 |
| Rhizoplane | 3.24 |
| Rhizosphere | 47.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500638_067346 | 3300053162 | Bacteria | 1715 |
| 2 | RicEn_C770 | 2010549000 | Bacteria | 3671 |
| 3 | JGI25153J46596_10002182 | 3300003215 | Bacteria | 11422 |
| 4 | JGI25153J46596_10008407 | 3300003215 | Bacteria | 4936 |
| 5 | JGI25153J46596_10008897 | 3300003215 | Bacteria | 4739 |
| 6 | JGI25153J46596_10011112 | 3300003215 | Bacteria | 4007 |
| 7 | JGI25153J46596_10039722 | 3300003215 | Bacteria | 1467 |
| 8 | JGI25160J50197_1002761 | 3300003354 | Bacteria | 8048 |
| 9 | JGI25160J50197_1002784 | 3300003354 | Bacteria | 8012 |
| 10 | JGI25160J50197_1004195 | 3300003354 | Bacteria | 6264 |
| 11 | Ga0055539_1003031 | 3300003752 | Bacteria | 2417 |
| 12 | Ga0055531_10010031 | 3300003794 | Bacteria | 4762 |
| 13 | Ga0055531_10032460 | 3300003794 | Bacteria | 1705 |
| 14 | Ga0065165_1003406 | 3300005262 | Bacteria | 11219 |
| 15 | Ga0065165_1004368 | 3300005262 | Bacteria | 8842 |
| 16 | Ga0065165_1005272 | 3300005262 | Bacteria | 7373 |
| 17 | Ga0070683_100083817 | 3300005329 | Bacteria | 2986 |
| 18 | Ga0070677_10007120 | 3300005333 | Bacteria | 3727 |
| 19 | Ga0070680_100148998 | 3300005336 | Bacteria | 1964 |
| 20 | Ga0070669_100111255 | 3300005353 | Bacteria | 2078 |
| 21 | Ga0070671_100054377 | 3300005355 | Bacteria | 3329 |
| 22 | Ga0070674_100007380 | 3300005356 | Bacteria | 6484 |
| 23 | Ga0070673_100308809 | 3300005364 | Bacteria | 1394 |
| 24 | Ga0070709_10003420 | 3300005434 | Bacteria | 8519 |
| 25 | Ga0070709_10013947 | 3300005434 | Bacteria | 4532 |
| 26 | Ga0070714_100000678 | 3300005435 | Bacteria | 24075 |
| 27 | Ga0070713_100009012 | 3300005436 | Bacteria | 7113 |
| 28 | Ga0070713_100013420 | 3300005436 | Bacteria | 6049 |
| 29 | Ga0070713_100025339 | 3300005436 | Bacteria | 4636 |
| 30 | Ga0070713_100056199 | 3300005436 | Bacteria | 3274 |
| 31 | Ga0070713_100367676 | 3300005436 | Bacteria | 1337 |
| 32 | Ga0070710_10001070 | 3300005437 | Bacteria | 12969 |
| 33 | Ga0070710_10001844 | 3300005437 | Bacteria | 9988 |
| 34 | Ga0070710_10006019 | 3300005437 | Bacteria | 5796 |
| 35 | Ga0070710_10013558 | 3300005437 | Bacteria | 4085 |
| 36 | Ga0070711_100023368 | 3300005439 | Bacteria | 4019 |
| 37 | Ga0070711_100240303 | 3300005439 | Bacteria | 1416 |
| 38 | Ga0070663_100013964 | 3300005455 | Bacteria | 5141 |
| 39 | Ga0070663_100063801 | 3300005455 | Bacteria | 2661 |
| 40 | Ga0070678_100005403 | 3300005456 | Bacteria | 7373 |
| 41 | Ga0070681_10008262 | 3300005458 | Bacteria | 10185 |
| 42 | Ga0068867_100075951 | 3300005459 | Bacteria | 2522 |
| 43 | Ga0070707_100455330 | 3300005468 | Bacteria | 1240 |
| 44 | Ga0070698_100096227 | 3300005471 | Bacteria | 2938 |
| 45 | Ga0070679_100002812 | 3300005530 | Bacteria | 15817 |
| 46 | Ga0070679_100050461 | 3300005530 | Bacteria | 4145 |
| 47 | Ga0070684_100043160 | 3300005535 | Bacteria | 3893 |
| 48 | Ga0068853_100099546 | 3300005539 | Bacteria | 2568 |
| 49 | Ga0070672_100043370 | 3300005543 | Bacteria | 3468 |
| 50 | Ga0070686_100033215 | 3300005544 | Bacteria | 3168 |
| 51 | Ga0070665_100359586 | 3300005548 | Bacteria | 1462 |
| 52 | Ga0070665_100407280 | 3300005548 | Bacteria | 1368 |
| 53 | Ga0068855_100114907 | 3300005563 | Bacteria | 3086 |
| 54 | Ga0068861_100188677 | 3300005719 | Bacteria | 1722 |
| 55 | Ga0068858_100250682 | 3300005842 | Bacteria | 1681 |
| 56 | Ga0081538_10001588 | 3300005981 | Bacteria | 23316 |
| 57 | Ga0081540_1020697 | 3300005983 | Bacteria | 3946 |
| 58 | Ga0081540_1041110 | 3300005983 | Bacteria | 2401 |
| 59 | Ga0081539_10000191 | 3300005985 | Bacteria | 142387 |
| 60 | Ga0081539_10011052 | 3300005985 | Bacteria | 7216 |
| 61 | Ga0081539_10074603 | 3300005985 | Bacteria | 1806 |
| 62 | Ga0081539_10099369 | 3300005985 | Bacteria | 1486 |
| 63 | Ga0070717_10003370 | 3300006028 | Bacteria | 11415 |
| 64 | Ga0075365_10002851 | 3300006038 | Bacteria | 8679 |
| 65 | Ga0075365_10054670 | 3300006038 | Bacteria | 2648 |
| 66 | Ga0075365_10079474 | 3300006038 | Bacteria | 2219 |
| 67 | Ga0075363_100029371 | 3300006048 | Bacteria | 2838 |
| 68 | Ga0070715_10000078 | 3300006163 | Bacteria | 27243 |
| 69 | Ga0070716_100025778 | 3300006173 | Bacteria | 3142 |
| 70 | Ga0070716_100044507 | 3300006173 | Bacteria | 2487 |
| 71 | Ga0070712_100005689 | 3300006175 | Bacteria | 7705 |
| 72 | Ga0070712_100032305 | 3300006175 | Bacteria | 3534 |
| 73 | Ga0075362_10015721 | 3300006177 | Bacteria | 3083 |
| 74 | Ga0075367_10016856 | 3300006178 | Bacteria | 3998 |
| 75 | Ga0075367_10044513 | 3300006178 | Bacteria | 2602 |
| 76 | Ga0075366_10007199 | 3300006195 | Bacteria | 6130 |
| 77 | Ga0075370_10156875 | 3300006353 | Bacteria | 1334 |
| 78 | Ga0075430_100364998 | 3300006846 | Bacteria | 1192 |
| 79 | Ga0075431_100099390 | 3300006847 | Bacteria | 3003 |
| 80 | Ga0075434_100020486 | 3300006871 | Bacteria | 6416 |
| 81 | Ga0068865_100236085 | 3300006881 | Bacteria | 1437 |
| 82 | Ga0099825_1024679 | 3300006941 | Bacteria | 3470 |
| 83 | Ga0099825_1033995 | 3300006941 | Bacteria | 1931 |
| 84 | Ga0105240_10049778 | 3300009093 | Bacteria | 5286 |
| 85 | Ga0105240_10376122 | 3300009093 | Bacteria | 1605 |
| 86 | Ga0105245_10133943 | 3300009098 | Bacteria | 2327 |
| 87 | Ga0105245_10162274 | 3300009098 | Bacteria | 2122 |
| 88 | Ga0105245_10163064 | 3300009098 | Bacteria | 2116 |
| 89 | Ga0114129_10005905 | 3300009147 | Bacteria | 17321 |
| 90 | Ga0105241_10022865 | 3300009174 | Bacteria | 4634 |
| 91 | Ga0105248_10306077 | 3300009177 | Bacteria | 1790 |
| 92 | Ga0105248_10666305 | 3300009177 | Bacteria | 1174 |
| 93 | Ga0105237_10009189 | 3300009545 | Bacteria | 10610 |
| 94 | Ga0105237_10025461 | 3300009545 | Bacteria | 6050 |
| 95 | Ga0105238_10037341 | 3300009551 | Bacteria | 4938 |
| 96 | Ga0105239_10032732 | 3300010375 | Bacteria | 5713 |
| 97 | Ga0105239_10160756 | 3300010375 | Bacteria | 2509 |
| 98 | Ga0105239_10199218 | 3300010375 | Bacteria | 2243 |
| 99 | Ga0105239_10278669 | 3300010375 | Bacteria | 1882 |
| 100 | Ga0105246_10159937 | 3300011119 | Bacteria | 1715 |
| 101 | Ga0163162_10208360 | 3300013306 | Bacteria | 2084 |
| 102 | Ga0163163_10278642 | 3300014325 | Bacteria | 1724 |
| 103 | Ga0157380_10160426 | 3300014326 | Bacteria | 1954 |
| 104 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 105 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 106 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 107 | Ga0214545_1035368 | 3300021324 | Bacteria | 1659 |
| 108 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 109 | Ga0213873_10008870 | 3300021358 | Bacteria | 2070 |
| 110 | Ga0213874_10005542 | 3300021377 | Bacteria | 2945 |
| 111 | Ga0213876_10006563 | 3300021384 | Bacteria | 6343 |
| 112 | Ga0213871_10007640 | 3300021441 | Bacteria | 2350 |
| 113 | Ga0209563_101091 | 3300025230 | Bacteria | 7786 |
| 114 | Ga0209677_100628 | 3300025253 | Bacteria | 18938 |
| 115 | Ga0209677_105157 | 3300025253 | Bacteria | 3497 |
| 116 | Ga0209148_1000424 | 3300025254 | Bacteria | 47087 |
| 117 | Ga0209455_1002021 | 3300025272 | Bacteria | 8282 |
| 118 | Ga0209564_1008318 | 3300025295 | Bacteria | 5140 |
| 119 | Ga0209564_1018742 | 3300025295 | Bacteria | 2622 |
| 120 | Ga0209758_1000186 | 3300025297 | Bacteria | 138804 |
| 121 | Ga0209758_1000692 | 3300025297 | Bacteria | 49946 |
| 122 | Ga0209758_1000880 | 3300025297 | Bacteria | 41231 |
| 123 | Ga0209758_1002083 | 3300025297 | Bacteria | 21266 |
| 124 | Ga0209758_1002692 | 3300025297 | Bacteria | 17520 |
| 125 | Ga0209758_1002877 | 3300025297 | Bacteria | 16674 |
| 126 | Ga0209758_1013600 | 3300025297 | Bacteria | 4418 |
| 127 | Ga0209256_1001638 | 3300025299 | Bacteria | 21788 |
| 128 | Ga0207426_1000425 | 3300025302 | Bacteria | 69088 |
| 129 | Ga0207426_1002619 | 3300025302 | Bacteria | 11150 |
| 130 | Ga0207426_1008620 | 3300025302 | Bacteria | 4095 |
| 131 | Ga0207426_1016063 | 3300025302 | Bacteria | 2699 |
| 132 | Ga0209051_1034563 | 3300025303 | Bacteria | 1893 |
| 133 | Ga0209257_1000426 | 3300025304 | Bacteria | 81095 |
| 134 | Ga0209257_1028596 | 3300025304 | Bacteria | 1831 |
| 135 | Ga0207682_10000295 | 3300025893 | Bacteria | 22495 |
| 136 | Ga0207692_10004404 | 3300025898 | Bacteria | 5571 |
| 137 | Ga0207692_10010653 | 3300025898 | Bacteria | 3884 |
| 138 | Ga0207710_10011666 | 3300025900 | Bacteria | 3697 |
| 139 | Ga0207680_10171204 | 3300025903 | Bacteria | 1463 |
| 140 | Ga0207647_10030271 | 3300025904 | Bacteria | 3493 |
| 141 | Ga0207685_10023956 | 3300025905 | Bacteria | 2086 |
| 142 | Ga0207685_10049618 | 3300025905 | Bacteria | 1613 |
| 143 | Ga0207699_10000688 | 3300025906 | Bacteria | 16229 |
| 144 | Ga0207699_10002405 | 3300025906 | Bacteria | 8845 |
| 145 | Ga0207699_10016696 | 3300025906 | Bacteria | 3846 |
| 146 | Ga0207699_10125319 | 3300025906 | Bacteria | 1667 |
| 147 | Ga0207645_10067043 | 3300025907 | Bacteria | 2294 |
| 148 | Ga0207654_10037955 | 3300025911 | Bacteria | 2700 |
| 149 | Ga0207707_10000178 | 3300025912 | Bacteria | 66057 |
| 150 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 151 | Ga0207671_10016261 | 3300025914 | Bacteria | 5788 |
| 152 | Ga0207671_10071220 | 3300025914 | Bacteria | 2593 |
| 153 | Ga0207693_10004535 | 3300025915 | Bacteria | 11731 |
| 154 | Ga0207693_10015732 | 3300025915 | Bacteria | 6063 |
| 155 | Ga0207693_10040774 | 3300025915 | Bacteria | 3657 |
| 156 | Ga0207663_10012571 | 3300025916 | Bacteria | 4581 |
| 157 | Ga0207663_10160023 | 3300025916 | Bacteria | 1588 |
| 158 | Ga0207657_10054471 | 3300025919 | Bacteria | 3459 |
| 159 | Ga0207652_10034778 | 3300025921 | Bacteria | 4249 |
| 160 | Ga0207652_10041372 | 3300025921 | Bacteria | 3917 |
| 161 | Ga0207650_10135419 | 3300025925 | Bacteria | 1932 |
| 162 | Ga0207700_10010260 | 3300025928 | Bacteria | 5898 |
| 163 | Ga0207700_10011271 | 3300025928 | Bacteria | 5694 |
| 164 | Ga0207700_10015348 | 3300025928 | Bacteria | 5050 |
| 165 | Ga0207664_10019556 | 3300025929 | Bacteria | 5007 |
| 166 | Ga0207644_10078579 | 3300025931 | Bacteria | 2432 |
| 167 | Ga0207665_10000361 | 3300025939 | Bacteria | 31561 |
| 168 | Ga0207665_10010893 | 3300025939 | Bacteria | 5969 |
| 169 | Ga0207691_10002066 | 3300025940 | Bacteria | 19603 |
| 170 | Ga0207689_10098598 | 3300025942 | Bacteria | 2401 |
| 171 | Ga0207668_10037105 | 3300025972 | Bacteria | 3259 |
| 172 | Ga0207658_10135457 | 3300025986 | Bacteria | 1985 |
| 173 | Ga0207678_10028516 | 3300026067 | Bacteria | 4873 |
| 174 | Ga0207678_10348387 | 3300026067 | Bacteria | 1277 |
| 175 | Ga0207641_10094219 | 3300026088 | Bacteria | 2626 |
| 176 | Ga0207676_10058427 | 3300026095 | Bacteria | 3042 |
| 177 | Ga0207675_100095407 | 3300026118 | Bacteria | 2798 |
| 178 | Ga0207675_100249952 | 3300026118 | Bacteria | 1716 |
| 179 | Ga0207683_10004372 | 3300026121 | Bacteria | 12208 |
| 180 | Ga0207698_10147677 | 3300026142 | Bacteria | 2036 |
| 181 | Ga0207698_10341882 | 3300026142 | Bacteria | 1410 |
| 182 | Ga0209389_1000090 | 3300027296 | Bacteria | 83470 |
| 183 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 184 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 185 | Ga0209489_100385 | 3300027361 | Bacteria | 79532 |
| 186 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 187 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 188 | Ga0268264_10161148 | 3300028381 | Bacteria | 2021 |
| 189 | Ga0265332_10000980 | 3300031238 | Bacteria | 16889 |
| 190 | Ga0265320_10093878 | 3300031240 | Bacteria | 1387 |
| 191 | Ga0265340_10001693 | 3300031247 | Bacteria | 12683 |
| 192 | Ga0265339_10001736 | 3300031249 | Bacteria | 16043 |
| 193 | Ga0265339_10007656 | 3300031249 | Bacteria | 6955 |
| 194 | Ga0265331_10016592 | 3300031250 | Bacteria | 3863 |
| 195 | Ga0265331_10030273 | 3300031250 | Bacteria | 2695 |
| 196 | Ga0265314_10008186 | 3300031711 | Bacteria | 8990 |
| 197 | Ga0265342_10000085 | 3300031712 | Bacteria | 100652 |
| 198 | Ga0265342_10008190 | 3300031712 | Bacteria | 7536 |
| 199 | Ga0307510_10010233 | 3300033180 | Bacteria | 11151 |
| 200 | Ga0307510_10113876 | 3300033180 | Bacteria | 2436 |
| 201 | Ga0373934_0013802 | 3300035086 | Bacteria | 3057 |
| 202 | Ga0373936_0011319 | 3300035113 | Bacteria | 3377 |
| 203 | Ga0373936_0018483 | 3300035113 | Bacteria | 2692 |
| 204 | Ga0373954_0103642 | 3300035118 | Bacteria | 1373 |
| 205 | Ga0373956_0034001 | 3300035119 | Bacteria | 2244 |
| 206 | Ga0373943_0012862 | 3300035170 | Bacteria | 3772 |
| 207 | Ga0373943_0012944 | 3300035170 | Bacteria | 3762 |
| 208 | Ga0373935_0115418 | 3300035692 | Bacteria | 1787 |
| 209 | Ga0373927_0010706 | 3300035695 | Bacteria | 6109 |
| 210 | Ga0373927_0029274 | 3300035695 | Bacteria | 3588 |
| 211 | Ga0373927_0104855 | 3300035695 | Bacteria | 1841 |
| 212 | Ga0373933_0031680 | 3300035724 | Bacteria | 3068 |
| 213 | Ga0373947_0006109 | 3300035725 | Bacteria | 7015 |
| 214 | Ga0316584_0019981 | 3300036712 | Bacteria | 4849 |
| 215 | Ga0373925_0057849 | 3300037068 | Bacteria | 2905 |
| 216 | Ga0395900_0073084 | 3300037418 | Bacteria | 3525 |
| 217 | Ga0395898_0015555 | 3300037466 | Bacteria | 7802 |
| 218 | Ga0395905_0005164 | 3300037471 | Bacteria | 13394 |
| 219 | Ga0436364_1520200 | 3300037853 | Bacteria | 2879 |
| 220 | Ga0436365_0097773 | 3300039437 | Bacteria | 28049 |
| 221 | Ga0436363_0058729 | 3300039450 | Bacteria | 3793 |
| 222 | Ga0436363_1153624 | 3300039450 | Bacteria | 7126 |
| 223 | Ga0436362_1134988 | 3300039453 | Bacteria | 6844 |
| 224 | Ga0439453_0008146 | 3300041408 | Bacteria | 1677 |
| 225 | Ga0466972_0001917 | 3300044658 | Bacteria | 10202 |
| 226 | Ga0466968_0006404 | 3300044735 | Bacteria | 4438 |
| 227 | Ga0466960_0030747 | 3300044901 | Bacteria | 2473 |
| 228 | Ga0466960_0067500 | 3300044901 | Bacteria | 1771 |
| 229 | Ga0466960_0068823 | 3300044901 | Bacteria | 1757 |
| 230 | Ga0451576_0454546 | 3300045051 | Bacteria | 1345 |
| 231 | Ga0466967_0500901 | 3300045976 | Bacteria | 1192 |
| 232 | Ga0495592_0045326 | 3300046454 | Bacteria | 3282 |
| 233 | Ga0495603_0050051 | 3300046455 | Bacteria | 2485 |
| 234 | Ga0495651_0011061 | 3300046462 | Bacteria | 6945 |
| 235 | Ga0495653_0010641 | 3300046463 | Bacteria | 7529 |
| 236 | Ga0495582_0010687 | 3300046473 | Bacteria | 5049 |
| 237 | Ga0495605_0032484 | 3300046474 | Bacteria | 2657 |
| 238 | Ga0495639_0005521 | 3300046475 | Bacteria | 5444 |
| 239 | Ga0495662_0004104 | 3300046476 | Bacteria | 7337 |
| 240 | Ga0495664_0035627 | 3300046477 | Bacteria | 2931 |
| 241 | Ga0495584_0126378 | 3300046491 | Bacteria | 1296 |
| 242 | Ga0495585_0082956 | 3300046492 | Bacteria | 1735 |
| 243 | Ga0495594_0017630 | 3300046499 | Bacteria | 3774 |
| 244 | Ga0495594_0081058 | 3300046499 | Bacteria | 1812 |
| 245 | Ga0495608_0132630 | 3300046511 | Bacteria | 1593 |
| 246 | Ga0495618_0039210 | 3300046514 | Bacteria | 2978 |
| 247 | Ga0495618_0081031 | 3300046514 | Bacteria | 2072 |
| 248 | Ga0495644_0001788 | 3300046523 | Bacteria | 8677 |
| 249 | Ga0495666_0033341 | 3300046526 | Bacteria | 2515 |
| 250 | Ga0495652_0019488 | 3300046529 | Bacteria | 6040 |
| 251 | Ga0495640_0096220 | 3300046533 | Bacteria | 1948 |
| 252 | Ga0495586_0027659 | 3300046535 | Bacteria | 3034 |
| 253 | Ga0495586_0031493 | 3300046535 | Bacteria | 2842 |
| 254 | Ga0495587_0009540 | 3300046536 | Bacteria | 6215 |
| 255 | Ga0495587_0023279 | 3300046536 | Bacteria | 3806 |
| 256 | Ga0495587_0164255 | 3300046536 | Bacteria | 1263 |
| 257 | Ga0495645_0010999 | 3300046543 | Bacteria | 6357 |
| 258 | Ga0495622_0004539 | 3300046557 | Bacteria | 6426 |
| 259 | Ga0495633_0006743 | 3300046558 | Bacteria | 6755 |
| 260 | Ga0495667_0006874 | 3300046559 | Bacteria | 7727 |
| 261 | Ga0495656_0004675 | 3300046615 | Bacteria | 4703 |
| 262 | Ga0495634_0025657 | 3300046642 | Bacteria | 4117 |
| 263 | Ga0495634_0036844 | 3300046642 | Bacteria | 3343 |
| 264 | Ga0495611_0016814 | 3300046648 | Bacteria | 3126 |
| 265 | Ga0495611_0109217 | 3300046648 | Bacteria | 1287 |
| 266 | Ga0495635_0020931 | 3300046663 | Bacteria | 4558 |
| 267 | Ga0495635_0052166 | 3300046663 | Bacteria | 2817 |
| 268 | Ga0495635_0057760 | 3300046663 | Bacteria | 2670 |
| 269 | Ga0495659_0001284 | 3300046664 | Bacteria | 8638 |
| 270 | Ga0495661_0132522 | 3300046665 | Bacteria | 1364 |
| 271 | Ga0495657_0002511 | 3300046675 | Bacteria | 15425 |
| 272 | Ga0495599_0011780 | 3300046678 | Bacteria | 5376 |
| 273 | Ga0495623_0006264 | 3300046679 | Bacteria | 7735 |
| 274 | Ga0495623_0132932 | 3300046679 | Bacteria | 1488 |
| 275 | Ga0495646_0020545 | 3300046680 | Bacteria | 4178 |
| 276 | Ga0495646_0035018 | 3300046680 | Bacteria | 3115 |
| 277 | Ga0495658_0023115 | 3300046683 | Bacteria | 3297 |
| 278 | Ga0495670_0040397 | 3300046691 | Bacteria | 2327 |
| 279 | Ga0495671_0044020 | 3300046692 | Bacteria | 2239 |
| 280 | Ga0495649_0059891 | 3300046694 | Bacteria | 2049 |
| 281 | Ga0495589_0102014 | 3300046794 | Bacteria | 1388 |
| 282 | Ga0495600_0020701 | 3300046809 | Bacteria | 4207 |
| 283 | Ga0495604_0008332 | 3300047317 | Bacteria | 8200 |
| 284 | Ga0495604_0010634 | 3300047317 | Bacteria | 7298 |
| 285 | Ga0495604_0153824 | 3300047317 | Bacteria | 1631 |
| 286 | Ga0495674_0012502 | 3300047319 | Bacteria | 7997 |
| 287 | Ga0495674_0144381 | 3300047319 | Bacteria | 1998 |
| 288 | Ga0495672_0047610 | 3300047320 | Bacteria | 2548 |
| 289 | Ga0495680_0004521 | 3300047322 | Bacteria | 13286 |
| 290 | Ga0495675_0156374 | 3300047444 | Bacteria | 1406 |
| 291 | Ga0495679_028983 | 3300047446 | Bacteria | 1810 |
| 292 | Ga0495684_0003057 | 3300047471 | Bacteria | 13153 |
| 293 | Ga0495593_0015059 | 3300047673 | Bacteria | 4393 |
| 294 | Ga0495602_0129415 | 3300048088 | Bacteria | 2016 |
| 295 | Ga0495614_0027265 | 3300048089 | Bacteria | 2463 |
| 296 | Ga0496101_0293081 | 3300048904 | Bacteria | 1273 |
| 297 | Ga0496102_0074345 | 3300048905 | Bacteria | 3123 |
| 298 | Ga0496103_0178151 | 3300048906 | Bacteria | 1366 |
| 299 | Ga0496105_0010871 | 3300048908 | Bacteria | 7167 |
| 300 | Ga0496105_0052236 | 3300048908 | Bacteria | 3375 |
| 301 | Ga0496106_0013998 | 3300048909 | Bacteria | 5930 |
| 302 | Ga0496107_0008041 | 3300048910 | Bacteria | 7282 |
| 303 | Ga0496108_0054415 | 3300048911 | Bacteria | 3358 |
| 304 | Ga0496108_0059826 | 3300048911 | Bacteria | 3204 |
| 305 | Ga0496108_0335177 | 3300048911 | Bacteria | 1319 |
| 306 | Ga0496110_0073104 | 3300048913 | Bacteria | 3043 |
| 307 | Ga0496110_0083474 | 3300048913 | Bacteria | 2850 |
| 308 | Ga0496111_0136516 | 3300048914 | Bacteria | 1817 |
| 309 | Ga0496111_0163311 | 3300048914 | Bacteria | 1654 |
| 310 | Ga0496112_0041349 | 3300048915 | Bacteria | 4510 |
| 311 | Ga0496113_0112882 | 3300048916 | Bacteria | 2117 |
| 312 | Ga0496115_0092245 | 3300048918 | Bacteria | 2476 |
| 313 | Ga0496115_0164324 | 3300048918 | Bacteria | 1835 |
| 314 | Ga0496116_0018487 | 3300048919 | Bacteria | 5372 |
| 315 | Ga0496118_0009476 | 3300048921 | Bacteria | 9827 |
| 316 | Ga0496119_0006574 | 3300048922 | Bacteria | 10715 |
| 317 | Ga0496119_0036521 | 3300048922 | Bacteria | 3206 |
| 318 | Ga0496119_0085943 | 3300048922 | Bacteria | 1799 |
| 319 | Ga0496121_0008807 | 3300048924 | Bacteria | 11754 |
| 320 | Ga0496121_0018234 | 3300048924 | Bacteria | 7095 |
| 321 | Ga0496121_0053877 | 3300048924 | Bacteria | 3366 |
| 322 | Ga0496121_0117401 | 3300048924 | Bacteria | 2016 |
| 323 | Ga0496122_0176321 | 3300048925 | Bacteria | 1281 |
| 324 | Ga0496125_0061192 | 3300048928 | Bacteria | 3021 |
| 325 | Ga0496126_0274804 | 3300048929 | Bacteria | 1397 |
| 326 | Ga0496126_0342025 | 3300048929 | Bacteria | 1225 |
| 327 | Ga0501031_0000792 | 3300049568 | Bacteria | 19041 |
| 328 | Ga0501032_0003462 | 3300049569 | Bacteria | 12091 |
| 329 | Ga0501033_0000249 | 3300049570 | Bacteria | 52045 |
| 330 | Ga0501033_0233439 | 3300049570 | Bacteria | 1306 |
| 331 | Ga0501034_0001938 | 3300049571 | Bacteria | 26206 |
| 332 | Ga0501036_0000179 | 3300049572 | Bacteria | 41780 |
| 333 | Ga0501037_0000112 | 3300049573 | Bacteria | 75698 |
| 334 | Ga0501038_0000160 | 3300049574 | Bacteria | 57443 |
| 335 | Ga0501039_0001057 | 3300049575 | Bacteria | 20191 |
| 336 | Ga0501043_0000278 | 3300049579 | Bacteria | 46214 |
| 337 | Ga0501043_0019781 | 3300049579 | Bacteria | 5287 |
| 338 | Ga0501046_0000653 | 3300049580 | Bacteria | 33778 |
| 339 | Ga0501046_0065396 | 3300049580 | Bacteria | 2837 |
| 340 | Ga0501047_0000275 | 3300049581 | Bacteria | 59536 |
| 341 | Ga0501048_0000426 | 3300049582 | Bacteria | 29633 |
| 342 | Ga0501067_0000258 | 3300049583 | Bacteria | 28937 |
| 343 | Ga0501068_0002382 | 3300049584 | Bacteria | 9992 |
| 344 | Ga0501069_0006432 | 3300049585 | Bacteria | 6141 |
| 345 | Ga0501070_0021007 | 3300049586 | Bacteria | 5476 |
| 346 | Ga0501070_0154305 | 3300049586 | Bacteria | 1894 |
| 347 | Ga0501073_0000103 | 3300049589 | Bacteria | 53962 |
| 348 | Ga0501077_0072588 | 3300049593 | Bacteria | 2181 |
| 349 | Ga0501079_0000451 | 3300049741 | Bacteria | 26871 |
| 350 | Ga0501080_0008747 | 3300049742 | Bacteria | 9194 |
| 351 | Ga0501083_0013555 | 3300049744 | Bacteria | 5699 |
| 352 | Ga0501035_0000766 | 3300049822 | Bacteria | 34513 |
| 353 | Ga0501044_0000418 | 3300049823 | Bacteria | 52554 |
| 354 | nmdc:mga03n38_2329_c1 | 3300050490 | Bacteria | 5834 |
| 355 | nmdc:mga03n38_50118_c1 | 3300050490 | Bacteria | 1859 |
| 356 | nmdc:mga03n38_57640_c1 | 3300050490 | Bacteria | 1757 |
| 357 | nmdc:mga0yw44_6905_c1 | 3300050492 | Bacteria | 5530 |
| 358 | nmdc:mga0k408_20455_c1 | 3300050493 | Bacteria | 3708 |
| 359 | nmdc:mga06z11_23684_c1 | 3300050494 | Bacteria | 2888 |
| 360 | nmdc:mga06z11_6672_c1 | 3300050494 | Bacteria | 4718 |
| 361 | nmdc:mga07m45_22674_c1 | 3300050496 | Bacteria | 3430 |
| 362 | nmdc:mga06r32_13817_c1 | 3300050510 | Bacteria | 7325 |
| 363 | nmdc:mga0n895_73473_c1 | 3300050512 | Bacteria | 3395 |
| 364 | nmdc:mga0sz30_26281_c1 | 3300050516 | Bacteria | 2386 |
| 365 | Ga0495601_0128026 | 3300053077 | Bacteria | 1653 |
| 366 | Ga0495612_0021318 | 3300053078 | Bacteria | 2599 |
| 367 | Ga0495655_0008676 | 3300053083 | Bacteria | 1942 |
| 368 | Ga0495595_0001773 | 3300053084 | Bacteria | 8430 |
| 369 | Ga0500578_0136518 | 3300053086 | Bacteria | 1535 |
| 370 | Ga0500643_000267 | 3300053087 | Bacteria | 46005 |
| 371 | Ga0500583_0043725 | 3300053092 | Bacteria | 2047 |
| 372 | Ga0500566_0000921 | 3300053094 | Bacteria | 16824 |
| 373 | Ga0500640_000942 | 3300053095 | Bacteria | 8202 |
| 374 | Ga0500555_009614 | 3300053103 | Bacteria | 2766 |
| 375 | Ga0500569_028515 | 3300053109 | Bacteria | 1548 |
| 376 | Ga0500572_001211 | 3300053111 | Bacteria | 7333 |
| 377 | Ga0500572_002696 | 3300053111 | Bacteria | 4202 |
| 378 | Ga0500614_000296 | 3300053123 | Bacteria | 12778 |
| 379 | Ga0500658_0033954 | 3300053134 | Bacteria | 2010 |
| 380 | Ga0500559_0000640 | 3300053136 | Bacteria | 23656 |
| 381 | Ga0500559_0002369 | 3300053136 | Bacteria | 9822 |
| 382 | Ga0500568_0017339 | 3300053139 | Bacteria | 3180 |
| 383 | Ga0500577_0000770 | 3300053142 | Bacteria | 8239 |
| 384 | Ga0500577_0059779 | 3300053142 | Bacteria | 1462 |
| 385 | Ga0500603_001029 | 3300053150 | Bacteria | 6549 |
| 386 | Ga0500619_038979 | 3300053154 | Bacteria | 1491 |
| 387 | Ga0500620_001319 | 3300053155 | Bacteria | 4501 |
| 388 | Ga0500630_000672 | 3300053159 | Bacteria | 15562 |
| 389 | Ga0500639_000014 | 3300053163 | Bacteria | 122926 |
| 390 | Ga0500636_0001006 | 3300053177 | Bacteria | 15083 |
| 391 | Ga0500625_009408 | 3300053729 | Bacteria | 4357 |
| 392 | Ga0500601_000299 | 3300053737 | Bacteria | 9293 |
| 393 | Ga0500661_009294 | 3300055283 | Bacteria | 1803 |
| 394 | Ga0501082_0005697 | 3300060353 | Bacteria | 10808 |
| 395 | 2507511020 | 2507262055 | Bacteria | 8048963 |
| 396 | 2508544841 | 2508501009 | Bacteria | 7784016 |
| 397 | 2508696930 | 2508501042 | Bacteria | 8719808 |
| 398 | 2511395179 | 2511231028 | Bacteria | 8046582 |
| 399 | 2513623494 | 2513237092 | Bacteria | 8341956 |
| 400 | 2513637460 | 2513237094 | Bacteria | 8789602 |
| 401 | 2513649690 | 2513237095 | Bacteria | 8976980 |
| 402 | 2513699965 | 2513237102 | Bacteria | 7703324 |
| 403 | 2513716926 | 2513237104 | Bacteria | 10034502 |
| 404 | 2513892093 | 2513237141 | Bacteria | 8496279 |
| 405 | 2514010623 | 2513237161 | Bacteria | 8871253 |
| 406 | 2517100599 | 2517093001 | Bacteria | 9002274 |
| 407 | 2524438177 | 2524023205 | Bacteria | 8918781 |
| 408 | 2524534501 | 2524023228 | Bacteria | 10118060 |
| 409 | 2617350785 | 2617270735 | Bacteria | 9163226 |
| 410 | 2617373154 | 2617270741 | Bacteria | 8201522 |
| 411 | 2728747592 | 2728368998 | Bacteria | 8720350 |
| 412 | 2745076942 | 2744054633 | Bacteria | 8678936 |
| 413 | 2793064673 | 2791355196 | Bacteria | 7323613 |
| 414 | 2818238161 | 2816332527 | Bacteria | 8933356 |
| 415 | 2824607738 | 2824600985 | Bacteria | 8488197 |
| 416 | 2824617124 | 2824609381 | Bacteria | 8672835 |
| 417 | 2824624270 | 2824617872 | Bacteria | 8814715 |
| 418 | 2824633048 | 2824626560 | Bacteria | 8813858 |
| 419 | 2824641046 | 2824635225 | Bacteria | 8785348 |
| 420 | 2824648766 | 2824644064 | Bacteria | 8743947 |
| 421 | 2824658720 | 2824653114 | Bacteria | 8493680 |
| 422 | 2824668274 | 2824661429 | Bacteria | 9877870 |
| 423 | 2824676188 | 2824671348 | Bacteria | 8369588 |
| 424 | 2824682877 | 2824679649 | Bacteria | 8248951 |
| 425 | 2824692354 | 2824687955 | Bacteria | 8360029 |
| 426 | 2824713326 | 2824704595 | Bacteria | 9667483 |
| 427 | 2824723099 | 2824714736 | Bacteria | 8717648 |
| 428 | 2824731384 | 2824723954 | Bacteria | 8758240 |
| 429 | 2824740627 | 2824732956 | Bacteria | 7810675 |
| 430 | 2824751548 | 2824746037 | Bacteria | 7911610 |
| 431 | 2824761232 | 2824753945 | Bacteria | 9787441 |
| 432 | 2824771843 | 2824763712 | Bacteria | 9792355 |
| 433 | 2838127904 | 2838122688 | Bacteria | 8803140 |
| 434 | 2841954071 | 2841949485 | Bacteria | 8680857 |
| 435 | 2841960210 | 2841957949 | Bacteria | 8652217 |
| 436 | 2841968162 | 2841966195 | Bacteria | 8673214 |
| 437 | 2841988001 | 2841983080 | Bacteria | 8395090 |
| 438 | 2842042696 | 2842038055 | Bacteria | 8002051 |
| 439 | 2842050739 | 2842045827 | Bacteria | 8006841 |
| 440 | 2844316905 | 2844315083 | Bacteria | 8138177 |
| 441 | 2847938571 | 2847930680 | Bacteria | 9342022 |
| 442 | 2849081539 | 2849076700 | Bacteria | 7039503 |
| 443 | 2857512198 | 2857509624 | Bacteria | 7472071 |
| 444 | 2874597757 | 2874590934 | Bacteria | 8299676 |
| 445 | 2874617688 | 2874612657 | Bacteria | 8252029 |
| 446 | 2874623426 | 2874620515 | Bacteria | 8290088 |
| 447 | 2874630663 | 2874628541 | Bacteria | 8630250 |
| 448 | 2874651286 | 2874645413 | Bacteria | 8214782 |
| 449 | 2876762393 | 2876761206 | Bacteria | 10111113 |
| 450 | 2876776357 | 2876771140 | Bacteria | 8287509 |
| 451 | 2876820925 | 2876818435 | Bacteria | 8274608 |
| 452 | 2879081780 | 2879074833 | Bacteria | 8279565 |
| 453 | 2879086184 | 2879083081 | Bacteria | 8587928 |
| 454 | 2879101340 | 2879099564 | Bacteria | 10442239 |
| 455 | 2879130495 | 2879127579 | Bacteria | 8294491 |
| 456 | 2879146381 | 2879142872 | Bacteria | 8267021 |
| 457 | 2881370690 | 2881364244 | Bacteria | 7710352 |
| 458 | 2881671324 | 2881665667 | Bacteria | 8175609 |
| 459 | 2885366925 | 2885366525 | Bacteria | 8326213 |
| 460 | 2888381516 | 2888378607 | Bacteria | 9652610 |
| 461 | 2888389123 | 2888388044 | Bacteria | 7304136 |
| 462 | 2888421919 | 2888419890 | Bacteria | 7857137 |
| 463 | 2903733955 | 2903727486 | Bacteria | 8281579 |
| 464 | 2904667343 | 2904666416 | Bacteria | 8226587 |
| 465 | 2904719236 | 2904711408 | Bacteria | 9771557 |
| 466 | 2906604571 | 2906602504 | Bacteria | 8295279 |
| 467 | 2906635187 | 2906626472 | Bacteria | 8826946 |
| 468 | 2906650953 | 2906643746 | Bacteria | 8722424 |
| 469 | 2908781609 | 2908775508 | Bacteria | 8092255 |
| 470 | 2922371184 | |||
| 471 | 2922393556 | 2922393267 | Bacteria | 8285685 |
| 472 | 2932785898 | 2932784394 | Bacteria | 9704911 |
| 473 | 2932798322 | 2932794094 | Bacteria | 7915132 |
| 474 | 2932804118 | 2932801729 | Bacteria | 7987968 |
| 475 | 2932817268 | 2932809354 | Bacteria | 9135765 |
| 476 | 2932826865 | 2932818245 | Bacteria | 9955613 |
| 477 | 2932830942 | 2932828146 | Bacteria | 9745859 |
| 478 | 2933581488 | 2933577622 | Bacteria | 9116884 |
| 479 | 2935612743 | 2935608549 | Bacteria | 8203142 |
| 480 | 2935621007 | 2935616580 | Bacteria | 9032984 |
| 481 | 2935640083 | 2935638405 | Bacteria | 10015038 |
| 482 | 2935656784 | 2935648319 | Bacteria | 8801166 |
| 483 | 2935665611 | 2935656913 | Bacteria | 8965014 |
| 484 | 2935667078 | 2935665750 | Bacteria | 9571747 |
| 485 | 2935680279 | 2935675223 | Bacteria | 9928132 |
| 486 | 2935690210 | 2935684952 | Bacteria | 9590419 |
| 487 | 2935699704 | 2935694250 | Bacteria | 9291695 |
| 488 | 2935704834 | 2935703347 | Bacteria | 10242284 |
| 489 | 2935718093 | 2935713505 | Bacteria | 9608509 |
| 490 | 2935726757 | 2935722832 | Bacteria | 9608746 |
| 491 | 2935735526 | 2935732158 | Bacteria | 9706831 |
| 492 | 2935745203 | 2935741537 | Bacteria | 9707219 |
| 493 | 2935755221 | 2935750917 | Bacteria | 9590372 |
| 494 | 2935762261 | 2935760218 | Bacteria | 9817913 |
| 495 | 2935773649 | 2935769743 | Bacteria | 7878163 |
| 496 | 2935780203 | 2935777560 | Bacteria | 8077691 |
| 497 | 2935788446 | 2935785616 | Bacteria | 7962367 |
| 498 | 2935796602 | 2935793552 | Bacteria | 8012592 |
| 499 | 2935803764 | 2935801545 | Bacteria | 9301974 |
| 500 | 2935811679 | 2935810662 | Bacteria | 9401221 |
| 501 | 2935824232 | 2935819856 | Bacteria | 8261050 |
| 502 | 2935829566 | 2935827899 | Bacteria | 10038562 |
| 503 | 2935843100 | 2935837841 | Bacteria | 9454360 |
| 504 | 2935852621 | 2935847175 | Bacteria | 8228321 |
| 505 | 2935858814 | 2935855204 | Bacteria | 9035059 |
| 506 | 2935866788 | 2935864058 | Bacteria | 9784707 |
| 507 | 2935876919 | 2935873716 | Bacteria | 9632195 |
| 508 | 2935884076 | 2935883170 | Bacteria | 7964738 |
| 509 | 2935912233 | 2935908558 | Bacteria | 8568796 |
| 510 | 2935924093 | 2935916978 | Bacteria | 9113783 |
| 511 | 2935929262 | 2935926038 | Bacteria | 8601059 |
| 512 | 2935935893 | 2935934488 | Bacteria | 8602579 |
| 513 | 2935950401 | 2935942939 | Bacteria | 8599779 |
| 514 | 2935957441 | 2935951376 | Bacteria | 8602333 |
| 515 | 2935968472 | 2935967501 | Bacteria | 8603075 |
| 516 | 2935976661 | 2935975950 | Bacteria | 8347125 |
| 517 | 2935990714 | 2935984226 | Bacteria | 8302647 |
| 518 | 2935993444 | 2935992306 | Bacteria | 9802711 |
| 519 | 2936004339 | 2936002035 | Bacteria | 9362176 |
| 520 | 2936019661 | 2936011229 | Bacteria | 8801034 |
| 521 | 2936028282 | 2936019824 | Bacteria | 8804134 |
| 522 | 2936037146 | 2936028420 | Bacteria | 8965941 |
| 523 | 2936038261 | 2936037263 | Bacteria | 9446081 |
| 524 | 2936055134 | 2936046547 | Bacteria | 8903709 |
| 525 | 2936058599 | 2936055302 | Bacteria | 8785755 |
| 526 | 2940561498 | 2940556831 | Bacteria | 9590747 |
| 527 | 2941533685 | 2941531003 | Bacteria | 7653939 |
| 528 | 2941544324 | 2941538514 | Bacteria | 9402094 |
| 529 | 3005486174 | 3005483717 | Bacteria | 7877331 |
| 530 | 3005593076 | 3005587118 | Bacteria | 7794411 |
| 531 | 3005596539 | 3005594810 | Bacteria | 8716512 |
| 532 | 3005712607 | 3005710791 | Bacteria | 7622528 |
| 533 | 3005719668 | 3005718088 | Bacteria | 8283608 |
| 534 | 8006927613 | 8006926726 | Bacteria | 6749210 |
| 535 | 8016516443 | 8016511872 | Bacteria | 9921665 |
| 536 | 8016589123 | 8016583857 | Bacteria | 10421953 |
| 537 | 8016604070 | 8016603502 | Bacteria | 8731218 |
| 538 | 8016620655 | 8016613128 | Bacteria | 8794220 |
| 539 | 8016629342 | 8016622563 | Bacteria | 7999408 |
| 540 | 8016633859 | 8016630954 | Bacteria | 9217207 |
| 541 | 8017060094 | 8017057580 | Bacteria | 10023680 |
| 542 | 8019542480 | 8019538911 | Bacteria | 7872763 |
| 543 | 8019548273 | 8019547302 | Bacteria | 7996444 |
| 544 | 8019579603 | 8019576017 | Bacteria | 10049540 |
| 545 | 8019587312 | 8019586578 | Bacteria | 10212056 |
| 546 | 8019604027 | 8019597564 | Bacteria | 10041141 |
| 547 | 8019614501 | 8019608314 | Bacteria | 10042931 |
| 548 | 8019625128 | 8019619141 | Bacteria | 9218857 |
| 549 | 8019637053 | 8019629233 | Bacteria | 8687553 |
| 550 | 8019642551 | 8019638758 | Bacteria | 9062356 |
| 551 | 8019664897 | 8019659431 | Bacteria | 8577854 |
| 552 | 8019674453 | 8019668869 | Bacteria | 8791617 |
| 553 | 8019681649 | 8019678201 | Bacteria | 8863603 |
| 554 | 8055749174 | 8055742211 | Bacteria | 9226248 |
| 555 | 8056695178 | 8056689827 | Bacteria | 6712655 |
| 556 | 8056969712 | 8056967851 | Bacteria | 9038162 |
| 557 | Ga0500638_067346 | |||
| 558 | RicEn_C770 | |||
| 559 | JGI25153J46596_10002182 | |||
| 560 | JGI25153J46596_10008407 | |||
| 561 | JGI25153J46596_10008897 | |||
| 562 | JGI25153J46596_10011112 | |||
| 563 | JGI25153J46596_10039722 | |||
| 564 | JGI25160J50197_1002761 | |||
| 565 | JGI25160J50197_1002784 | |||
| 566 | JGI25160J50197_1004195 | |||
| 567 | Ga0055539_1003031 | |||
| 568 | Ga0055531_10010031 | |||
| 569 | Ga0055531_10032460 | |||
| 570 | Ga0065165_1003406 | |||
| 571 | Ga0065165_1004368 | |||
| 572 | Ga0065165_1005272 | |||
| 573 | Ga0070683_100083817 | |||
| 574 | Ga0070677_10007120 | |||
| 575 | Ga0070680_100148998 | |||
| 576 | Ga0070669_100111255 | |||
| 577 | Ga0070671_100054377 | |||
| 578 | Ga0070674_100007380 | |||
| 579 | Ga0070673_100308809 | |||
| 580 | Ga0070709_10003420 | |||
| 581 | Ga0070709_10013947 | |||
| 582 | Ga0070714_100000678 | |||
| 583 | Ga0070713_100009012 | |||
| 584 | Ga0070713_100013420 | |||
| 585 | Ga0070713_100025339 | |||
| 586 | Ga0070713_100056199 | |||
| 587 | Ga0070713_100367676 | |||
| 588 | Ga0070710_10001070 | |||
| 589 | Ga0070710_10001844 | |||
| 590 | Ga0070710_10006019 | |||
| 591 | Ga0070710_10013558 | |||
| 592 | Ga0070711_100023368 | |||
| 593 | Ga0070711_100240303 | |||
| 594 | Ga0070663_100013964 | |||
| 595 | Ga0070663_100063801 | |||
| 596 | Ga0070678_100005403 | |||
| 597 | Ga0070681_10008262 | |||
| 598 | Ga0068867_100075951 | |||
| 599 | Ga0070707_100455330 | |||
| 600 | Ga0070698_100096227 | |||
| 601 | Ga0070679_100002812 | |||
| 602 | Ga0070679_100050461 | |||
| 603 | Ga0070684_100043160 | |||
| 604 | Ga0068853_100099546 | |||
| 605 | Ga0070672_100043370 | |||
| 606 | Ga0070686_100033215 | |||
| 607 | Ga0070665_100359586 | |||
| 608 | Ga0070665_100407280 | |||
| 609 | Ga0068855_100114907 | |||
| 610 | Ga0068861_100188677 | |||
| 611 | Ga0068858_100250682 | |||
| 612 | Ga0081538_10001588 | |||
| 613 | Ga0081540_1020697 | |||
| 614 | Ga0081540_1041110 | |||
| 615 | Ga0081539_10000191 | |||
| 616 | Ga0081539_10011052 | |||
| 617 | Ga0081539_10074603 | |||
| 618 | Ga0081539_10099369 | |||
| 619 | Ga0070717_10003370 | |||
| 620 | Ga0075365_10002851 | |||
| 621 | Ga0075365_10054670 | |||
| 622 | Ga0075365_10079474 | |||
| 623 | Ga0075363_100029371 | |||
| 624 | Ga0070715_10000078 | |||
| 625 | Ga0070716_100025778 | |||
| 626 | Ga0070716_100044507 | |||
| 627 | Ga0070712_100005689 | |||
| 628 | Ga0070712_100032305 | |||
| 629 | Ga0075362_10015721 | |||
| 630 | Ga0075367_10016856 | |||
| 631 | Ga0075367_10044513 | |||
| 632 | Ga0075366_10007199 | |||
| 633 | Ga0075370_10156875 | |||
| 634 | Ga0075430_100364998 | |||
| 635 | Ga0075431_100099390 | |||
| 636 | Ga0075434_100020486 | |||
| 637 | Ga0068865_100236085 | |||
| 638 | Ga0099825_1024679 | |||
| 639 | Ga0099825_1033995 | |||
| 640 | Ga0105240_10049778 | |||
| 641 | Ga0105240_10376122 | |||
| 642 | Ga0105245_10133943 | |||
| 643 | Ga0105245_10162274 | |||
| 644 | Ga0105245_10163064 | |||
| 645 | Ga0114129_10005905 | |||
| 646 | Ga0105241_10022865 | |||
| 647 | Ga0105248_10306077 | |||
| 648 | Ga0105248_10666305 | |||
| 649 | Ga0105237_10009189 | |||
| 650 | Ga0105237_10025461 | |||
| 651 | Ga0105238_10037341 | |||
| 652 | Ga0105239_10032732 | |||
| 653 | Ga0105239_10160756 | |||
| 654 | Ga0105239_10199218 | |||
| 655 | Ga0105239_10278669 | |||
| 656 | Ga0105246_10159937 | |||
| 657 | Ga0163162_10208360 | |||
| 658 | Ga0163163_10278642 | |||
| 659 | Ga0157380_10160426 | |||
| 660 | Ga0214544_1000001 | |||
| 661 | Ga0214542_1000005 | |||
| 662 | Ga0214545_1000003 | |||
| 663 | Ga0214545_1035368 | |||
| 664 | Ga0214543_1000002 | |||
| 665 | Ga0213873_10008870 | |||
| 666 | Ga0213874_10005542 | |||
| 667 | Ga0213876_10006563 | |||
| 668 | Ga0213871_10007640 | |||
| 669 | Ga0209563_101091 | |||
| 670 | Ga0209677_100628 | |||
| 671 | Ga0209677_105157 | |||
| 672 | Ga0209148_1000424 | |||
| 673 | Ga0209455_1002021 | |||
| 674 | Ga0209564_1008318 | |||
| 675 | Ga0209564_1018742 | |||
| 676 | Ga0209758_1000186 | |||
| 677 | Ga0209758_1000692 | |||
| 678 | Ga0209758_1000880 | |||
| 679 | Ga0209758_1002083 | |||
| 680 | Ga0209758_1002692 | |||
| 681 | Ga0209758_1002877 | |||
| 682 | Ga0209758_1013600 | |||
| 683 | Ga0209256_1001638 | |||
| 684 | Ga0207426_1000425 | |||
| 685 | Ga0207426_1002619 | |||
| 686 | Ga0207426_1008620 | |||
| 687 | Ga0207426_1016063 | |||
| 688 | Ga0209051_1034563 | |||
| 689 | Ga0209257_1000426 | |||
| 690 | Ga0209257_1028596 | |||
| 691 | Ga0207682_10000295 | |||
| 692 | Ga0207692_10004404 | |||
| 693 | Ga0207692_10010653 | |||
| 694 | Ga0207710_10011666 | |||
| 695 | Ga0207680_10171204 | |||
| 696 | Ga0207647_10030271 | |||
| 697 | Ga0207685_10023956 | |||
| 698 | Ga0207685_10049618 | |||
| 699 | Ga0207699_10000688 | |||
| 700 | Ga0207699_10002405 | |||
| 701 | Ga0207699_10016696 | |||
| 702 | Ga0207699_10125319 | |||
| 703 | Ga0207645_10067043 | |||
| 704 | Ga0207654_10037955 | |||
| 705 | Ga0207707_10000178 | |||
| 706 | Ga0207695_10000062 | |||
| 707 | Ga0207671_10016261 | |||
| 708 | Ga0207671_10071220 | |||
| 709 | Ga0207693_10004535 | |||
| 710 | Ga0207693_10015732 | |||
| 711 | Ga0207693_10040774 | |||
| 712 | Ga0207663_10012571 | |||
| 713 | Ga0207663_10160023 | |||
| 714 | Ga0207657_10054471 | |||
| 715 | Ga0207652_10034778 | |||
| 716 | Ga0207652_10041372 | |||
| 717 | Ga0207650_10135419 | |||
| 718 | Ga0207700_10010260 | |||
| 719 | Ga0207700_10011271 | |||
| 720 | Ga0207700_10015348 | |||
| 721 | Ga0207664_10019556 | |||
| 722 | Ga0207644_10078579 | |||
| 723 | Ga0207665_10000361 | |||
| 724 | Ga0207665_10010893 | |||
| 725 | Ga0207691_10002066 | |||
| 726 | Ga0207689_10098598 | |||
| 727 | Ga0207668_10037105 | |||
| 728 | Ga0207658_10135457 | |||
| 729 | Ga0207678_10028516 | |||
| 730 | Ga0207678_10348387 | |||
| 731 | Ga0207641_10094219 | |||
| 732 | Ga0207676_10058427 | |||
| 733 | Ga0207675_100095407 | |||
| 734 | Ga0207675_100249952 | |||
| 735 | Ga0207683_10004372 | |||
| 736 | Ga0207698_10147677 | |||
| 737 | Ga0207698_10341882 | |||
| 738 | Ga0209389_1000090 | |||
| 739 | Ga0209589_1000006 | |||
| 740 | Ga0209489_100007 | |||
| 741 | Ga0209489_100385 | |||
| 742 | Ga0209700_100008 | |||
| 743 | Ga0209700_100013 | |||
| 744 | Ga0268264_10161148 | |||
| 745 | Ga0265332_10000980 | |||
| 746 | Ga0265320_10093878 | |||
| 747 | Ga0265340_10001693 | |||
| 748 | Ga0265339_10001736 | |||
| 749 | Ga0265339_10007656 | |||
| 750 | Ga0265331_10016592 | |||
| 751 | Ga0265331_10030273 | |||
| 752 | Ga0265314_10008186 | |||
| 753 | Ga0265342_10000085 | |||
| 754 | Ga0265342_10008190 | |||
| 755 | Ga0307510_10010233 | |||
| 756 | Ga0307510_10113876 | |||
| 757 | Ga0373934_0013802 | |||
| 758 | Ga0373936_0011319 | |||
| 759 | Ga0373936_0018483 | |||
| 760 | Ga0373954_0103642 | |||
| 761 | Ga0373956_0034001 | |||
| 762 | Ga0373943_0012862 | |||
| 763 | Ga0373943_0012944 | |||
| 764 | Ga0373935_0115418 | |||
| 765 | Ga0373927_0010706 | |||
| 766 | Ga0373927_0029274 | |||
| 767 | Ga0373927_0104855 | |||
| 768 | Ga0373933_0031680 | |||
| 769 | Ga0373947_0006109 | |||
| 770 | Ga0316584_0019981 | |||
| 771 | Ga0373925_0057849 | |||
| 772 | Ga0395900_0073084 | |||
| 773 | Ga0395898_0015555 | |||
| 774 | Ga0395905_0005164 | |||
| 775 | Ga0436364_1520200 | |||
| 776 | Ga0436365_0097773 | |||
| 777 | Ga0436363_0058729 | |||
| 778 | Ga0436363_1153624 | |||
| 779 | Ga0436362_1134988 | |||
| 780 | Ga0439453_0008146 | |||
| 781 | Ga0466972_0001917 | |||
| 782 | Ga0466968_0006404 | |||
| 783 | Ga0466960_0030747 | |||
| 784 | Ga0466960_0067500 | |||
| 785 | Ga0466960_0068823 | |||
| 786 | Ga0451576_0454546 | |||
| 787 | Ga0466967_0500901 | |||
| 788 | Ga0495592_0045326 | |||
| 789 | Ga0495603_0050051 | |||
| 790 | Ga0495651_0011061 | |||
| 791 | Ga0495653_0010641 | |||
| 792 | Ga0495582_0010687 | |||
| 793 | Ga0495605_0032484 | |||
| 794 | Ga0495639_0005521 | |||
| 795 | Ga0495662_0004104 | |||
| 796 | Ga0495664_0035627 | |||
| 797 | Ga0495584_0126378 | |||
| 798 | Ga0495585_0082956 | |||
| 799 | Ga0495594_0017630 | |||
| 800 | Ga0495594_0081058 | |||
| 801 | Ga0495608_0132630 | |||
| 802 | Ga0495618_0039210 | |||
| 803 | Ga0495618_0081031 | |||
| 804 | Ga0495644_0001788 | |||
| 805 | Ga0495666_0033341 | |||
| 806 | Ga0495652_0019488 | |||
| 807 | Ga0495640_0096220 | |||
| 808 | Ga0495586_0027659 | |||
| 809 | Ga0495586_0031493 | |||
| 810 | Ga0495587_0009540 | |||
| 811 | Ga0495587_0023279 | |||
| 812 | Ga0495587_0164255 | |||
| 813 | Ga0495645_0010999 | |||
| 814 | Ga0495622_0004539 | |||
| 815 | Ga0495633_0006743 | |||
| 816 | Ga0495667_0006874 | |||
| 817 | Ga0495656_0004675 | |||
| 818 | Ga0495634_0025657 | |||
| 819 | Ga0495634_0036844 | |||
| 820 | Ga0495611_0016814 | |||
| 821 | Ga0495611_0109217 | |||
| 822 | Ga0495635_0020931 | |||
| 823 | Ga0495635_0052166 | |||
| 824 | Ga0495635_0057760 | |||
| 825 | Ga0495659_0001284 | |||
| 826 | Ga0495661_0132522 | |||
| 827 | Ga0495657_0002511 | |||
| 828 | Ga0495599_0011780 | |||
| 829 | Ga0495623_0006264 | |||
| 830 | Ga0495623_0132932 | |||
| 831 | Ga0495646_0020545 | |||
| 832 | Ga0495646_0035018 | |||
| 833 | Ga0495658_0023115 | |||
| 834 | Ga0495670_0040397 | |||
| 835 | Ga0495671_0044020 | |||
| 836 | Ga0495649_0059891 | |||
| 837 | Ga0495589_0102014 | |||
| 838 | Ga0495600_0020701 | |||
| 839 | Ga0495604_0008332 | |||
| 840 | Ga0495604_0010634 | |||
| 841 | Ga0495604_0153824 | |||
| 842 | Ga0495674_0012502 | |||
| 843 | Ga0495674_0144381 | |||
| 844 | Ga0495672_0047610 | |||
| 845 | Ga0495680_0004521 | |||
| 846 | Ga0495675_0156374 | |||
| 847 | Ga0495679_028983 | |||
| 848 | Ga0495684_0003057 | |||
| 849 | Ga0495593_0015059 | |||
| 850 | Ga0495602_0129415 | |||
| 851 | Ga0495614_0027265 | |||
| 852 | Ga0496101_0293081 | |||
| 853 | Ga0496102_0074345 | |||
| 854 | Ga0496103_0178151 | |||
| 855 | Ga0496105_0010871 | |||
| 856 | Ga0496105_0052236 | |||
| 857 | Ga0496106_0013998 | |||
| 858 | Ga0496107_0008041 | |||
| 859 | Ga0496108_0054415 | |||
| 860 | Ga0496108_0059826 | |||
| 861 | Ga0496108_0335177 | |||
| 862 | Ga0496110_0073104 | |||
| 863 | Ga0496110_0083474 | |||
| 864 | Ga0496111_0136516 | |||
| 865 | Ga0496111_0163311 | |||
| 866 | Ga0496112_0041349 | |||
| 867 | Ga0496113_0112882 | |||
| 868 | Ga0496115_0092245 | |||
| 869 | Ga0496115_0164324 | |||
| 870 | Ga0496116_0018487 | |||
| 871 | Ga0496118_0009476 | |||
| 872 | Ga0496119_0006574 | |||
| 873 | Ga0496119_0036521 | |||
| 874 | Ga0496119_0085943 | |||
| 875 | Ga0496121_0008807 | |||
| 876 | Ga0496121_0018234 | |||
| 877 | Ga0496121_0053877 | |||
| 878 | Ga0496121_0117401 | |||
| 879 | Ga0496122_0176321 | |||
| 880 | Ga0496125_0061192 | |||
| 881 | Ga0496126_0274804 | |||
| 882 | Ga0496126_0342025 | |||
| 883 | Ga0501031_0000792 | |||
| 884 | Ga0501032_0003462 | |||
| 885 | Ga0501033_0000249 | |||
| 886 | Ga0501033_0233439 | |||
| 887 | Ga0501034_0001938 | |||
| 888 | Ga0501036_0000179 | |||
| 889 | Ga0501037_0000112 | |||
| 890 | Ga0501038_0000160 | |||
| 891 | Ga0501039_0001057 | |||
| 892 | Ga0501043_0000278 | |||
| 893 | Ga0501043_0019781 | |||
| 894 | Ga0501046_0000653 | |||
| 895 | Ga0501046_0065396 | |||
| 896 | Ga0501047_0000275 | |||
| 897 | Ga0501048_0000426 | |||
| 898 | Ga0501067_0000258 | |||
| 899 | Ga0501068_0002382 | |||
| 900 | Ga0501069_0006432 | |||
| 901 | Ga0501070_0021007 | |||
| 902 | Ga0501070_0154305 | |||
| 903 | Ga0501073_0000103 | |||
| 904 | Ga0501077_0072588 | |||
| 905 | Ga0501079_0000451 | |||
| 906 | Ga0501080_0008747 | |||
| 907 | Ga0501083_0013555 | |||
| 908 | Ga0501035_0000766 | |||
| 909 | Ga0501044_0000418 | |||
| 910 | nmdc:mga03n38_2329_c1 | |||
| 911 | nmdc:mga03n38_50118_c1 | |||
| 912 | nmdc:mga03n38_57640_c1 | |||
| 913 | nmdc:mga0yw44_6905_c1 | |||
| 914 | nmdc:mga0k408_20455_c1 | |||
| 915 | nmdc:mga06z11_23684_c1 | |||
| 916 | nmdc:mga06z11_6672_c1 | |||
| 917 | nmdc:mga07m45_22674_c1 | |||
| 918 | nmdc:mga06r32_13817_c1 | |||
| 919 | nmdc:mga0n895_73473_c1 | |||
| 920 | nmdc:mga0sz30_26281_c1 | |||
| 921 | Ga0495601_0128026 | |||
| 922 | Ga0495612_0021318 | |||
| 923 | Ga0495655_0008676 | |||
| 924 | Ga0495595_0001773 | |||
| 925 | Ga0500578_0136518 | |||
| 926 | Ga0500643_000267 | |||
| 927 | Ga0500583_0043725 | |||
| 928 | Ga0500566_0000921 | |||
| 929 | Ga0500640_000942 | |||
| 930 | Ga0500555_009614 | |||
| 931 | Ga0500569_028515 | |||
| 932 | Ga0500572_001211 | |||
| 933 | Ga0500572_002696 | |||
| 934 | Ga0500614_000296 | |||
| 935 | Ga0500658_0033954 | |||
| 936 | Ga0500559_0000640 | |||
| 937 | Ga0500559_0002369 | |||
| 938 | Ga0500568_0017339 | |||
| 939 | Ga0500577_0000770 | |||
| 940 | Ga0500577_0059779 | |||
| 941 | Ga0500603_001029 | |||
| 942 | Ga0500619_038979 | |||
| 943 | Ga0500620_001319 | |||
| 944 | Ga0500630_000672 | |||
| 945 | Ga0500639_000014 | |||
| 946 | Ga0500636_0001006 | |||
| 947 | Ga0500625_009408 | |||
| 948 | Ga0500601_000299 | |||
| 949 | Ga0500661_009294 | |||
| 950 | Ga0501082_0005697 | |||
| 951 | 2507511020 | |||
| 952 | 2508544841 | |||
| 953 | 2508696930 | |||
| 954 | 2511395179 | |||
| 955 | 2513623494 | |||
| 956 | 2513637460 | |||
| 957 | 2513649690 | |||
| 958 | 2513699965 | |||
| 959 | 2513716926 | |||
| 960 | 2513892093 | |||
| 961 | 2514010623 | |||
| 962 | 2517100599 | |||
| 963 | 2524438177 | |||
| 964 | 2524534501 | |||
| 965 | 2617350785 | |||
| 966 | 2617373154 | |||
| 967 | 2728747592 | |||
| 968 | 2745076942 | |||
| 969 | 2793064673 | |||
| 970 | 2818238161 | |||
| 971 | 2824607738 | |||
| 972 | 2824617124 | |||
| 973 | 2824624270 | |||
| 974 | 2824633048 | |||
| 975 | 2824641046 | |||
| 976 | 2824648766 | |||
| 977 | 2824658720 | |||
| 978 | 2824668274 | |||
| 979 | 2824676188 | |||
| 980 | 2824682877 | |||
| 981 | 2824692354 | |||
| 982 | 2824713326 | |||
| 983 | 2824723099 | |||
| 984 | 2824731384 | |||
| 985 | 2824740627 | |||
| 986 | 2824751548 | |||
| 987 | 2824761232 | |||
| 988 | 2824771843 | |||
| 989 | 2838127904 | |||
| 990 | 2841954071 | |||
| 991 | 2841960210 | |||
| 992 | 2841968162 | |||
| 993 | 2841988001 | |||
| 994 | 2842042696 | |||
| 995 | 2842050739 | |||
| 996 | 2844316905 | |||
| 997 | 2847938571 | |||
| 998 | 2849081539 | |||
| 999 | 2857512198 | |||
| 1000 | 2874597757 | |||
| 1001 | 2874617688 | |||
| 1002 | 2874623426 | |||
| 1003 | 2874630663 | |||
| 1004 | 2874651286 | |||
| 1005 | 2876762393 | |||
| 1006 | 2876776357 | |||
| 1007 | 2876820925 | |||
| 1008 | 2879081780 | |||
| 1009 | 2879086184 | |||
| 1010 | 2879101340 | |||
| 1011 | 2879130495 | |||
| 1012 | 2879146381 | |||
| 1013 | 2881370690 | |||
| 1014 | 2881671324 | |||
| 1015 | 2885366925 | |||
| 1016 | 2888381516 | |||
| 1017 | 2888389123 | |||
| 1018 | 2888421919 | |||
| 1019 | 2903733955 | |||
| 1020 | 2904667343 | |||
| 1021 | 2904719236 | |||
| 1022 | 2906604571 | |||
| 1023 | 2906635187 | |||
| 1024 | 2906650953 | |||
| 1025 | 2908781609 | |||
| 1026 | 2922371184 | |||
| 1027 | 2922393556 | |||
| 1028 | 2932785898 | |||
| 1029 | 2932798322 | |||
| 1030 | 2932804118 | |||
| 1031 | 2932817268 | |||
| 1032 | 2932826865 | |||
| 1033 | 2932830942 | |||
| 1034 | 2933581488 | |||
| 1035 | 2935612743 | |||
| 1036 | 2935621007 | |||
| 1037 | 2935640083 | |||
| 1038 | 2935656784 | |||
| 1039 | 2935665611 | |||
| 1040 | 2935667078 | |||
| 1041 | 2935680279 | |||
| 1042 | 2935690210 | |||
| 1043 | 2935699704 | |||
| 1044 | 2935704834 | |||
| 1045 | 2935718093 | |||
| 1046 | 2935726757 | |||
| 1047 | 2935735526 | |||
| 1048 | 2935745203 | |||
| 1049 | 2935755221 | |||
| 1050 | 2935762261 | |||
| 1051 | 2935773649 | |||
| 1052 | 2935780203 | |||
| 1053 | 2935788446 | |||
| 1054 | 2935796602 | |||
| 1055 | 2935803764 | |||
| 1056 | 2935811679 | |||
| 1057 | 2935824232 | |||
| 1058 | 2935829566 | |||
| 1059 | 2935843100 | |||
| 1060 | 2935852621 | |||
| 1061 | 2935858814 | |||
| 1062 | 2935866788 | |||
| 1063 | 2935876919 | |||
| 1064 | 2935884076 | |||
| 1065 | 2935912233 | |||
| 1066 | 2935924093 | |||
| 1067 | 2935929262 | |||
| 1068 | 2935935893 | |||
| 1069 | 2935950401 | |||
| 1070 | 2935957441 | |||
| 1071 | 2935968472 | |||
| 1072 | 2935976661 | |||
| 1073 | 2935990714 | |||
| 1074 | 2935993444 | |||
| 1075 | 2936004339 | |||
| 1076 | 2936019661 | |||
| 1077 | 2936028282 | |||
| 1078 | 2936037146 | |||
| 1079 | 2936038261 | |||
| 1080 | 2936055134 | |||
| 1081 | 2936058599 | |||
| 1082 | 2940561498 | |||
| 1083 | 2941533685 | |||
| 1084 | 2941544324 | |||
| 1085 | 3005486174 | |||
| 1086 | 3005593076 | |||
| 1087 | 3005596539 | |||
| 1088 | 3005712607 | |||
| 1089 | 3005719668 | |||
| 1090 | 8006927613 | |||
| 1091 | 8016516443 | |||
| 1092 | 8016589123 | |||
| 1093 | 8016604070 | |||
| 1094 | 8016620655 | |||
| 1095 | 8016629342 | |||
| 1096 | 8016633859 | |||
| 1097 | 8017060094 | |||
| 1098 | 8019542480 | |||
| 1099 | 8019548273 | |||
| 1100 | 8019579603 | |||
| 1101 | 8019587312 | |||
| 1102 | 8019604027 | |||
| 1103 | 8019614501 | |||
| 1104 | 8019625128 | |||
| 1105 | 8019637053 | |||
| 1106 | 8019642551 | |||
| 1107 | 8019664897 | |||
| 1108 | 8019674453 | |||
| 1109 | 8019681649 | |||
| 1110 | 8055749174 | |||
| 1111 | 8056695178 | |||
| 1112 | 8056969712 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9515 | 6 | 307 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9449 | 6 | 307 |
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.9354 | 8 | 308 |
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.9322 | 8 | 308 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9094 | 6 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9653 | 113 | 211 | 1.10.150.170 |
| 1wg8B02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9607 | 113 | 211 | 1.10.150.170 |
| af_P9WJP1_66_380_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9399 | 7 | 306 | 3.40.50.150 |
| 1wg8B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9396 | 6 | 307 | 3.40.50.150 |
| af_P60390_9_313_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9336 | 8 | 308 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S7QUH8-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9674 | 2 | 329 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A176Z2R9-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9654 | 1 | 329 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A660XZT3-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9632 | 6 | 305 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A7S7QUH8-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9616 | 2 | 329 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A418MKK4-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9563 | 8 | 307 |
GO:0005737
GO:0070475 GO:0071424 |