F463267

General Info

Members Datasets Scaffolds Average Seq Length
556 318 1102 291

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2977971508|2977971968
Length 332
Sequence RNSFFIKILLRNQMGDCESDKYLISYKLSSKMKSWESRSMPNPPTPSDIALRPDDEQIALLRDKAEFIRLETLRLIQIAKVGHYSSVFSCAEIFATLYYDAMRLKRGEPQWPDRDRFLMGKGHAAVGLYPLLVDWGFFSKDILDGYTRLGNPLGDHPDMRKVPGVDFSSGSIGHALSAGLGMTLGCRAADRQFDVYVLLGDGEMQEGQVWEAALSAAHHKAGNLIAIVDRNGYQLDGQVDDIIGIEPLTDKWAAFGWQVHEVDGHDVAALATLLRQLKAETNRTRPVCIIAKTSKGKGVGYMETEPGWHLGYLAPSDEALAADEIKRGGKAQ

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
59 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
68 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
71 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
135 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
136 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
141 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
142 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
143 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
144 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
241 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
245 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
248 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
249 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
250 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
251 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
252 2511231012 Pseudomonas sp. GM33 Isolate Nodule
253 2511231018 Pseudomonas sp. GM60 Isolate Nodule
254 2511231019 Pseudomonas sp. GM67 Isolate Nodule
255 2511231021 Pseudomonas sp. GM78 Isolate Nodule
256 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
257 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
258 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
259 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
260 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
261 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
262 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
263 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
264 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
265 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
266 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
267 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
268 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
269 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
270 2643221557 Ensifer sp. Root558 Isolate Unclassified
271 2643221569 Achromobacter sp. Root565 Isolate Unclassified
272 2643221594 Achromobacter sp. Root170 Isolate Unclassified
273 2643221621 Achromobacter sp. Root83 Isolate Unclassified
274 2643221668 Ensifer sp. Root423 Isolate Unclassified
275 2643221723 Ensifer sp. Root278 Isolate Unclassified
276 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
277 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
278 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
279 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
280 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
281 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
282 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
283 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
284 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
285 2844163670 Ensifer sp. 1H6 Isolate Unclassified
286 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
287 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
288 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
289 2858950400 Achromobacter sp. K91 Isolate Unclassified
290 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
291 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
292 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
293 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
294 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
295 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
296 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
297 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
298 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
299 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
300 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
301 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
302 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
303 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
304 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
305 2941479691
306 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
307 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
308 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
309 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
310 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
311 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
312 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
313 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
314 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
315 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
316 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
317 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
318 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.97
Metatranscriptomes 0
Isolates 14.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 6.12
Rhizoplane 5.58
Rhizosphere 64.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000042 3300002987 Bacteria 65091
2 JGI25151J46595_10012460 3300003187 Bacteria 3866
3 JGI25165J46597_1000034 3300003214 Bacteria 292458
4 JGI25160J50197_1000139 3300003354 Bacteria 65091
5 JGI25161J50226_1000837 3300003374 Bacteria 11505
6 Ga0055532_1000287 3300003758 Bacteria 32158
7 Ga0055527_1000193 3300003760 Bacteria 40712
8 Ga0055535_1000401 3300003761 Bacteria 40712
9 Ga0055542_1001329 3300003762 Bacteria 12922
10 Ga0055529_1001541 3300003763 Bacteria 6571
11 Ga0055524_1000604 3300003775 Bacteria 25776
12 Ga0055524_1002447 3300003775 Bacteria 9554
13 Ga0055536_1028900 3300003781 Bacteria 1500
14 Ga0055528_1000637 3300003790 Bacteria 25718
15 Ga0055530_10005549 3300003791 Bacteria 5953
16 Ga0055530_10044301 3300003791 Bacteria 1068
17 Ga0055541_1004899 3300003841 Bacteria 2388
18 Ga0055543_1000268 3300004625 Bacteria 38841
19 Ga0065165_1000443 3300005262 Bacteria 65129
20 Ga0065714_10064524 3300005288 Bacteria 41924
21 Ga0065704_10163562 3300005289 Bacteria 1338
22 Ga0070670_100000097 3300005331 Bacteria 81485
23 Ga0070660_100000019 3300005339 Bacteria 99607
24 Ga0070668_100000312 3300005347 Bacteria 32059
25 Ga0070668_100006759 3300005347 Bacteria 8502
26 Ga0070668_100134617 3300005347 Bacteria 1986
27 Ga0070659_100000012 3300005366 Bacteria 180004
28 Ga0070667_100000169 3300005367 Bacteria 81539
29 Ga0070681_10379035 3300005458 Bacteria 1325
30 Ga0070685_10237889 3300005466 Bacteria 1201
31 Ga0068853_100017999 3300005539 Bacteria 5840
32 Ga0070665_100000610 3300005548 Bacteria 49084
33 Ga0068855_100698277 3300005563 Bacteria 1086
34 Ga0068852_100080376 3300005616 Bacteria 2890
35 Ga0068859_100060114 3300005617 Bacteria 3829
36 Ga0068864_100294320 3300005618 Bacteria 1518
37 Ga0068861_100195231 3300005719 Bacteria 1695
38 Ga0068863_100000185 3300005841 Bacteria 66169
39 Ga0068863_100034823 3300005841 Bacteria 4795
40 Ga0068858_100008637 3300005842 Bacteria 9782
41 Ga0068858_100139409 3300005842 Bacteria 2276
42 Ga0068860_100000211 3300005843 Bacteria 91286
43 Ga0068862_100000514 3300005844 Bacteria 41173
44 Ga0075364_10000118 3300006051 Bacteria 32819
45 Ga0070716_100229692 3300006173 Bacteria 1252
46 Ga0075370_10189900 3300006353 Bacteria 1210
47 Ga0075434_100013855 3300006871 Bacteria 7691
48 Ga0097620_100060110 3300006931 Bacteria 3829
49 Ga0079104_1000693 3300006946 Bacteria 30756
50 Ga0105251_10008446 3300009011 Bacteria 6197
51 Ga0105244_10001460 3300009036 Bacteria 19075
52 Ga0105244_10017137 3300009036 Bacteria 4104
53 Ga0105250_10002161 3300009092 Bacteria 10094
54 Ga0105250_10004853 3300009092 Bacteria 6116
55 Ga0105247_10145262 3300009101 Bacteria 1558
56 Ga0105242_10078858 3300009176 Bacteria 2749
57 Ga0105248_10064649 3300009177 Bacteria 4107
58 Ga0105237_10003361 3300009545 Bacteria 19048
59 Ga0105237_10005925 3300009545 Bacteria 13707
60 Ga0105238_10002329 3300009551 Bacteria 19107
61 Ga0105238_10004487 3300009551 Bacteria 13831
62 Ga0105238_10019812 3300009551 Bacteria 6848
63 Ga0105249_10000855 3300009553 Bacteria 27177
64 Ga0105239_10001477 3300010375 Bacteria 31257
65 Ga0105239_10022510 3300010375 Bacteria 6948
66 Ga0157373_10000173 3300013100 Bacteria 52678
67 Ga0157371_10000084 3300013102 Bacteria 149557
68 Ga0157370_10004581 3300013104 Bacteria 15828
69 Ga0157369_10003281 3300013105 Bacteria 19267
70 Ga0157369_10081574 3300013105 Bacteria 3461
71 Ga0157369_10101267 3300013105 Bacteria 3070
72 Ga0171463_1002 3300013249 Bacteria 1274851
73 Ga0171462_1029 3300013250 Bacteria 110139
74 Ga0157375_10006979 3300013308 Bacteria 9864
75 Ga0163163_10250312 3300014325 Bacteria 1822
76 Ga0182008_10000401 3300014497 Bacteria 33522
77 Ga0182008_10000806 3300014497 Bacteria 21928
78 Ga0182008_10001539 3300014497 Bacteria 15338
79 Ga0182008_10003476 3300014497 Bacteria 9502
80 Ga0182008_10015968 3300014497 Bacteria 3909
81 Ga0182008_10022982 3300014497 Bacteria 3190
82 Ga0182008_10036717 3300014497 Bacteria 2451
83 Ga0157379_10042615 3300014968 Bacteria 4052
84 Ga0182006_1002540 3300015261 Bacteria 9906
85 Ga0182006_1008622 3300015261 Bacteria 4618
86 Ga0182007_10000263 3300015262 Bacteria 35043
87 Ga0182007_10000547 3300015262 Bacteria 22177
88 Ga0182007_10007769 3300015262 Bacteria 4459
89 Ga0182007_10016817 3300015262 Bacteria 2688
90 Ga0182005_1000508 3300015265 Bacteria 19922
91 Ga0182005_1000555 3300015265 Bacteria 18723
92 Ga0182005_1004160 3300015265 Bacteria 4731
93 Ga0183365_10066 3300015684 Bacteria 2421
94 Ga0183363_1075 3300015690 Bacteria 29742
95 Ga0163161_10002029 3300017792 Bacteria 14663
96 Ga0163161_10005559 3300017792 Bacteria 8733
97 Ga0163161_10042114 3300017792 Bacteria 3283
98 Ga0228711_1006984 3300022739 Bacteria 16561
99 Ga0228710_1002664 3300022740 Bacteria 28275
100 Ga0209436_100065 3300025208 Bacteria 54858
101 Ga0209566_100243 3300025225 Bacteria 52362
102 Ga0209674_101231 3300025226 Bacteria 7267
103 Ga0209672_100059 3300025228 Bacteria 209692
104 Ga0209147_100072 3300025229 Bacteria 209692
105 Ga0209563_100227 3300025230 Bacteria 27902
106 Ga0209258_100102 3300025242 Bacteria 209692
107 Ga0209148_1000916 3300025254 Bacteria 19824
108 Ga0209233_1000028 3300025261 Bacteria 642062
109 Ga0209233_1018275 3300025261 Bacteria 1890
110 Ga0209455_1000375 3300025272 Bacteria 40764
111 Ga0209673_1000965 3300025273 Bacteria 35667
112 Ga0209130_1000115 3300025284 Bacteria 129623
113 Ga0209676_1001168 3300025292 Bacteria 28452
114 Ga0209676_1001421 3300025292 Bacteria 22726
115 Ga0209676_1003721 3300025292 Bacteria 9073
116 Ga0209676_1003837 3300025292 Bacteria 8832
117 Ga0209025_1000026 3300025294 Bacteria 519850
118 Ga0209025_1000079 3300025294 Bacteria 270973
119 Ga0209025_1000470 3300025294 Bacteria 78526
120 Ga0209564_1000682 3300025295 Bacteria 50102
121 Ga0209050_1000155 3300025298 Bacteria 159095
122 Ga0209050_1001226 3300025298 Bacteria 29774
123 Ga0209050_1005171 3300025298 Bacteria 8357
124 Ga0209050_1015319 3300025298 Bacteria 3227
125 Ga0209256_1000286 3300025299 Bacteria 88880
126 Ga0209256_1000357 3300025299 Bacteria 74660
127 Ga0207426_1000226 3300025302 Bacteria 129623
128 Ga0209051_1004027 3300025303 Bacteria 9296
129 Ga0209051_1012849 3300025303 Bacteria 4025
130 Ga0209051_1045028 3300025303 Bacteria 1531
131 Ga0209257_1007792 3300025304 Bacteria 6350
132 Ga0207696_1000784 3300025711 Bacteria 20866
133 Ga0207655_1000445 3300025728 Bacteria 54522
134 Ga0207713_1002802 3300025735 Bacteria 12305
135 Ga0207647_10018890 3300025904 Bacteria 4646
136 Ga0207707_10231166 3300025912 Bacteria 1609
137 Ga0207695_10267335 3300025913 Bacteria 1606
138 Ga0207671_10004094 3300025914 Bacteria 14112
139 Ga0207671_10320925 3300025914 Bacteria 1226
140 Ga0207657_10000013 3300025919 Bacteria 180080
141 Ga0207694_10012896 3300025924 Bacteria 6293
142 Ga0207694_10090826 3300025924 Bacteria 2410
143 Ga0207650_10000160 3300025925 Bacteria 81491
144 Ga0207687_10175779 3300025927 Bacteria 1655
145 Ga0207690_10000048 3300025932 Bacteria 114048
146 Ga0207665_10038804 3300025939 Bacteria 3173
147 Ga0207711_10061917 3300025941 Bacteria 3227
148 Ga0207712_10000203 3300025961 Bacteria 59867
149 Ga0207668_10000414 3300025972 Bacteria 26930
150 Ga0207668_10002809 3300025972 Bacteria 10182
151 Ga0207668_10214484 3300025972 Bacteria 1541
152 Ga0207658_10000341 3300025986 Bacteria 46166
153 Ga0207703_10006632 3300026035 Bacteria 9235
154 Ga0207703_10381796 3300026035 Bacteria 1303
155 Ga0207639_10014389 3300026041 Bacteria 5565
156 Ga0207641_10001171 3300026088 Bacteria 26343
157 Ga0207676_10365325 3300026095 Bacteria 1339
158 Ga0207675_100142053 3300026118 Bacteria 2281
159 Ga0209281_1000766 3300027111 Bacteria 30770
160 Ga0268266_10002265 3300028379 Bacteria 20936
161 Ga0268266_10431235 3300028379 Bacteria 1251
162 Ga0268265_10000779 3300028380 Bacteria 30604
163 Ga0268264_10000270 3300028381 Bacteria 90954
164 Ga0265338_10010503 3300028800 Bacteria 10841
165 Ga0307408_100063379 3300031548 Bacteria 2704
166 Ga0307413_10052714 3300031824 Bacteria 2459
167 Ga0307410_10016458 3300031852 Bacteria 4411
168 Ga0307406_10000335 3300031901 Bacteria 27323
169 Ga0307407_10189679 3300031903 Bacteria 1369
170 Ga0307412_10000199 3300031911 Bacteria 41000
171 Ga0307409_100106844 3300031995 Bacteria 2337
172 Ga0307416_100022616 3300032002 Bacteria 4541
173 Ga0307416_100659444 3300032002 Bacteria 1132
174 Ga0307414_10113903 3300032004 Bacteria 2065
175 Ga0395900_0259787 3300037418 Bacteria 1735
176 Ga0395905_0047123 3300037471 Bacteria 4041
177 Ga0395905_0080748 3300037471 Bacteria 3048
178 Ga0395901_0173239 3300038443 Bacteria 2264
179 Ga0395901_0217007 3300038443 Bacteria 2000
180 Ga0436365_0839014 3300039437 Bacteria 3744
181 Ga0439436_0002149 3300041404 Bacteria 5896
182 Ga0439438_000053 3300041405 Bacteria 55678
183 Ga0439438_000154 3300041405 Bacteria 31368
184 Ga0439438_003911 3300041405 Bacteria 5863
185 Ga0439447_000015 3300041407 Bacteria 67494
186 Ga0439447_000034 3300041407 Bacteria 49064
187 Ga0439466_0000108 3300041411 Bacteria 31679
188 Ga0439466_0000130 3300041411 Bacteria 29384
189 Ga0439466_0000427 3300041411 Bacteria 16023
190 Ga0439466_0013183 3300041411 Bacteria 3029
191 Ga0451791_1411515 3300041451 Bacteria 1557
192 Ga0439432_000074 3300042006 Bacteria 30979
193 Ga0439432_012758 3300042006 Bacteria 2868
194 Ga0439451_000266 3300042009 Bacteria 10131
195 Ga0439451_000609 3300042009 Bacteria 6788
196 Ga0439452_000148 3300042010 Bacteria 51785
197 Ga0439452_005672 3300042010 Bacteria 3995
198 Ga0439456_000054 3300042013 Bacteria 42184
199 Ga0439463_044974 3300042016 Bacteria 1125
200 Ga0450911_000974 3300042115 Bacteria 7469
201 Ga0450906_009924 3300042145 Bacteria 1808
202 Ga0450907_001452 3300042146 Bacteria 5115
203 Ga0439446_0012246 3300042156 Bacteria 2341
204 Ga0450909_003180 3300042185 Bacteria 2337
205 Ga0439434_0000013 3300042435 Bacteria 44761
206 Ga0439434_0033473 3300042435 Bacteria 1566
207 Ga0450918_001497 3300042531 Bacteria 4624
208 Ga0495617_000825 3300046452 Bacteria 14838
209 Ga0495617_025317 3300046452 Bacteria 2001
210 Ga0495627_006784 3300046453 Bacteria 4455
211 Ga0495627_006865 3300046453 Bacteria 4427
212 Ga0495627_010757 3300046453 Bacteria 3310
213 Ga0495590_0001239 3300046457 Bacteria 11130
214 Ga0495590_0002653 3300046457 Bacteria 7388
215 Ga0495591_000123 3300046458 Bacteria 84832
216 Ga0495591_001526 3300046458 Bacteria 14234
217 Ga0495591_024712 3300046458 Bacteria 1898
218 Ga0495638_0000554 3300046460 Bacteria 42645
219 Ga0495638_0000770 3300046460 Bacteria 34035
220 Ga0495638_0002104 3300046460 Bacteria 16836
221 Ga0495638_0002920 3300046460 Bacteria 13653
222 Ga0495638_0003662 3300046460 Bacteria 11979
223 Ga0495638_0007210 3300046460 Bacteria 7996
224 Ga0495638_0008017 3300046460 Bacteria 7523
225 Ga0495638_0017064 3300046460 Bacteria 4850
226 Ga0495638_0092155 3300046460 Bacteria 1824
227 Ga0495653_0003254 3300046463 Bacteria 13030
228 Ga0495650_0000488 3300046471 Bacteria 60332
229 Ga0495650_0000673 3300046471 Bacteria 44385
230 Ga0495650_0000771 3300046471 Bacteria 39556
231 Ga0495605_0000194 3300046474 Bacteria 76134
232 Ga0495605_0000864 3300046474 Bacteria 20993
233 Ga0495605_0001602 3300046474 Bacteria 14657
234 Ga0495605_0004720 3300046474 Bacteria 7971
235 Ga0495584_0000020 3300046491 Bacteria 132682
236 Ga0495584_0003534 3300046491 Bacteria 8565
237 Ga0495584_0011933 3300046491 Bacteria 4442
238 Ga0495584_0019179 3300046491 Bacteria 3474
239 Ga0495584_0028313 3300046491 Bacteria 2839
240 Ga0495584_0034794 3300046491 Bacteria 2547
241 Ga0495585_0000120 3300046492 Bacteria 85123
242 Ga0495585_0000509 3300046492 Bacteria 36748
243 Ga0495585_0019774 3300046492 Bacteria 3879
244 Ga0495596_0016132 3300046500 Bacteria 3109
245 Ga0495607_0002116 3300046501 Bacteria 16575
246 Ga0495607_0011413 3300046501 Bacteria 5913
247 Ga0495583_0000163 3300046506 Bacteria 112327
248 Ga0495583_0000297 3300046506 Bacteria 78953
249 Ga0495583_0002722 3300046506 Bacteria 14633
250 Ga0495583_0048136 3300046506 Bacteria 1957
251 Ga0495606_0000300 3300046507 Bacteria 85461
252 Ga0495606_0002362 3300046507 Bacteria 22159
253 Ga0495606_0002782 3300046507 Bacteria 19567
254 Ga0495606_0018066 3300046507 Bacteria 5302
255 Ga0495606_0018113 3300046507 Bacteria 5294
256 Ga0495606_0039399 3300046507 Bacteria 3185
257 Ga0495610_0000223 3300046512 Bacteria 60959
258 Ga0495610_0001575 3300046512 Bacteria 20078
259 Ga0495610_0002570 3300046512 Bacteria 15093
260 Ga0495610_0002897 3300046512 Bacteria 13887
261 Ga0495616_0007055 3300046513 Bacteria 6753
262 Ga0495616_0059374 3300046513 Bacteria 1881
263 Ga0495620_0000098 3300046515 Bacteria 69404
264 Ga0495620_0023526 3300046515 Bacteria 2943
265 Ga0495631_0019026 3300046518 Bacteria 3225
266 Ga0495632_0000543 3300046519 Bacteria 35463
267 Ga0495632_0002536 3300046519 Bacteria 13843
268 Ga0495632_0012799 3300046519 Bacteria 4816
269 Ga0495632_0016854 3300046519 Bacteria 4051
270 Ga0495632_0030087 3300046519 Bacteria 2821
271 Ga0495632_0036739 3300046519 Bacteria 2489
272 Ga0495632_0062728 3300046519 Bacteria 1801
273 Ga0495637_0000118 3300046520 Bacteria 58203
274 Ga0495637_0000191 3300046520 Bacteria 47977
275 Ga0495637_0001236 3300046520 Bacteria 15480
276 Ga0495637_0004494 3300046520 Bacteria 7214
277 Ga0495637_0008704 3300046520 Bacteria 4976
278 Ga0495643_0000177 3300046522 Bacteria 101375
279 Ga0495643_0004223 3300046522 Bacteria 10170
280 Ga0495643_0005789 3300046522 Bacteria 8273
281 Ga0495643_0007104 3300046522 Bacteria 7265
282 Ga0495643_0016362 3300046522 Bacteria 4355
283 Ga0495644_0000025 3300046523 Bacteria 75756
284 Ga0495644_0000052 3300046523 Bacteria 55714
285 Ga0495644_0000168 3300046523 Bacteria 30880
286 Ga0495644_0000256 3300046523 Bacteria 24532
287 Ga0495648_0038952 3300046524 Bacteria 3032
288 Ga0495648_0083252 3300046524 Bacteria 1813
289 Ga0495666_0000093 3300046526 Bacteria 36630
290 Ga0495666_0001369 3300046526 Bacteria 11815
291 Ga0495654_0000112 3300046530 Bacteria 92528
292 Ga0495654_0000311 3300046530 Bacteria 42613
293 Ga0495654_0001562 3300046530 Bacteria 15523
294 Ga0495654_0002430 3300046530 Bacteria 11997
295 Ga0495654_0006385 3300046530 Bacteria 6705
296 Ga0495597_0000816 3300046542 Bacteria 24537
297 Ga0495597_0001410 3300046542 Bacteria 17336
298 Ga0495597_0001573 3300046542 Bacteria 16076
299 Ga0495597_0001880 3300046542 Bacteria 14351
300 Ga0495597_0004976 3300046542 Bacteria 7135
301 Ga0495597_0047520 3300046542 Bacteria 1899
302 Ga0495633_0001257 3300046558 Bacteria 20202
303 Ga0495668_0036027 3300046616 Bacteria 2773
304 Ga0495611_0018510 3300046648 Bacteria 2987
305 Ga0495625_0003013 3300046660 Bacteria 17353
306 Ga0495625_0023207 3300046660 Bacteria 4741
307 Ga0495661_0000001 3300046665 Bacteria 898372
308 Ga0495661_0000299 3300046665 Bacteria 56225
309 Ga0495661_0002697 3300046665 Bacteria 13536
310 Ga0495623_0090159 3300046679 Bacteria 1883
311 Ga0495671_0000229 3300046692 Bacteria 48226
312 Ga0495671_0000459 3300046692 Bacteria 31939
313 Ga0495671_0002669 3300046692 Bacteria 11185
314 Ga0495671_0002874 3300046692 Bacteria 10768
315 Ga0495671_0003295 3300046692 Bacteria 9987
316 Ga0495671_0007392 3300046692 Bacteria 6267
317 Ga0495671_0035324 3300046692 Bacteria 2538
318 Ga0495671_0044367 3300046692 Bacteria 2229
319 Ga0495649_0001366 3300046694 Bacteria 18539
320 Ga0495649_0001930 3300046694 Bacteria 15114
321 Ga0495649_0002529 3300046694 Bacteria 12828
322 Ga0495649_0006695 3300046694 Bacteria 7147
323 Ga0495600_0005345 3300046809 Bacteria 7736
324 Ga0495660_0000720 3300046810 Bacteria 25314
325 Ga0495660_0001768 3300046810 Bacteria 14319
326 Ga0495660_0001904 3300046810 Bacteria 13639
327 Ga0495660_0010023 3300046810 Bacteria 5512
328 Ga0495660_0058657 3300046810 Bacteria 2072
329 Ga0495604_0010177 3300047317 Bacteria 7449
330 Ga0495604_0040008 3300047317 Bacteria 3682
331 Ga0495674_0000199 3300047319 Bacteria 48627
332 Ga0495672_0000247 3300047320 Bacteria 75920
333 Ga0495672_0000506 3300047320 Bacteria 45016
334 Ga0495672_0043853 3300047320 Bacteria 2686
335 Ga0495672_0077236 3300047320 Bacteria 1867
336 Ga0495680_0001784 3300047322 Bacteria 22804
337 Ga0495680_0008003 3300047322 Bacteria 9635
338 Ga0495683_0000674 3300047323 Bacteria 25217
339 Ga0495675_0000016 3300047444 Bacteria 129732
340 Ga0495675_0002600 3300047444 Bacteria 10820
341 Ga0495679_000174 3300047446 Bacteria 58164
342 Ga0495679_000324 3300047446 Bacteria 37980
343 Ga0495673_0000659 3300047469 Bacteria 33985
344 Ga0495673_0002077 3300047469 Bacteria 14634
345 Ga0495673_0008177 3300047469 Bacteria 5915
346 Ga0495673_0030343 3300047469 Bacteria 2539
347 Ga0495673_0031005 3300047469 Bacteria 2506
348 Ga0495681_0000082 3300047470 Bacteria 83609
349 Ga0495681_0000217 3300047470 Bacteria 47740
350 Ga0495681_0002018 3300047470 Bacteria 14825
351 Ga0495681_0002226 3300047470 Bacteria 13964
352 Ga0495681_0003556 3300047470 Bacteria 10846
353 Ga0495681_0006981 3300047470 Bacteria 7311
354 Ga0495681_0025622 3300047470 Bacteria 3082
355 Ga0495681_0027819 3300047470 Bacteria 2920
356 Ga0495684_0007396 3300047471 Bacteria 8514
357 Ga0495686_0000599 3300047472 Bacteria 50255
358 Ga0495686_0000653 3300047472 Bacteria 47362
359 Ga0495593_0000090 3300047673 Bacteria 40409
360 Ga0495626_0000429 3300048091 Bacteria 43047
361 Ga0495626_0000503 3300048091 Bacteria 39230
362 Ga0495626_0001953 3300048091 Bacteria 15319
363 Ga0495626_0014409 3300048091 Bacteria 4079
364 Ga0496100_0203771 3300048903 Bacteria 1443
365 Ga0496101_0008551 3300048904 Bacteria 6690
366 Ga0496102_0068506 3300048905 Bacteria 3256
367 Ga0496102_0086925 3300048905 Bacteria 2888
368 Ga0496103_0017936 3300048906 Bacteria 4242
369 Ga0496103_0112907 3300048906 Bacteria 1727
370 Ga0496104_0000930 3300048907 Bacteria 25137
371 Ga0496105_0052590 3300048908 Bacteria 3364
372 Ga0496105_0151375 3300048908 Bacteria 1907
373 Ga0496106_0213550 3300048909 Bacteria 1537
374 Ga0496107_0129277 3300048910 Bacteria 1864
375 Ga0496108_0064670 3300048911 Bacteria 3082
376 Ga0496109_0012887 3300048912 Bacteria 7229
377 Ga0496110_0408596 3300048913 Bacteria 1238
378 Ga0496112_0025314 3300048915 Bacteria 5698
379 Ga0496113_0056558 3300048916 Bacteria 2946
380 Ga0496113_0204717 3300048916 Bacteria 1569
381 Ga0496114_0006795 3300048917 Bacteria 9009
382 Ga0496114_0337482 3300048917 Bacteria 1332
383 Ga0496115_0009472 3300048918 Bacteria 7234
384 Ga0496115_0163091 3300048918 Bacteria 1843
385 Ga0496116_0003463 3300048919 Bacteria 15558
386 Ga0496117_0009256 3300048920 Bacteria 9203
387 Ga0496117_0013415 3300048920 Bacteria 7152
388 Ga0496117_0015415 3300048920 Bacteria 6518
389 Ga0496117_0021205 3300048920 Bacteria 5267
390 Ga0496117_0029913 3300048920 Bacteria 4189
391 Ga0496118_0000752 3300048921 Bacteria 52469
392 Ga0496118_0006489 3300048921 Bacteria 12837
393 Ga0496118_0015438 3300048921 Bacteria 7068
394 Ga0496118_0021890 3300048921 Bacteria 5608
395 Ga0496118_0033890 3300048921 Bacteria 4179
396 Ga0496118_0132902 3300048921 Bacteria 1594
397 Ga0496119_0004110 3300048922 Bacteria 14670
398 Ga0496119_0007370 3300048922 Bacteria 9931
399 Ga0496119_0011502 3300048922 Bacteria 7317
400 Ga0496120_0002947 3300048923 Bacteria 16215
401 Ga0496120_0003169 3300048923 Bacteria 15330
402 Ga0496120_0006186 3300048923 Bacteria 9258
403 Ga0496121_0000005 3300048924 Bacteria 1034486
404 Ga0496121_0000140 3300048924 Bacteria 162689
405 Ga0496121_0002893 3300048924 Bacteria 25260
406 Ga0496121_0033733 3300048924 Bacteria 4626
407 Ga0496121_0085647 3300048924 Bacteria 2480
408 Ga0496121_0131500 3300048924 Bacteria 1872
409 Ga0496122_0000582 3300048925 Bacteria 74845
410 Ga0496122_0001471 3300048925 Bacteria 37928
411 Ga0496122_0007162 3300048925 Bacteria 12498
412 Ga0496122_0015691 3300048925 Bacteria 7223
413 Ga0496122_0037220 3300048925 Bacteria 3921
414 Ga0496122_0057826 3300048925 Bacteria 2875
415 Ga0496123_0000479 3300048926 Bacteria 69250
416 Ga0496123_0000567 3300048926 Bacteria 63083
417 Ga0496123_0011618 3300048926 Bacteria 7604
418 Ga0496123_0027734 3300048926 Bacteria 4211
419 Ga0496123_0049241 3300048926 Bacteria 2827
420 Ga0496123_0056638 3300048926 Bacteria 2559
421 Ga0496124_0000004 3300048927 Bacteria 976131
422 Ga0496124_0002662 3300048927 Bacteria 22911
423 Ga0496124_0006230 3300048927 Bacteria 13068
424 Ga0496124_0014560 3300048927 Bacteria 7597
425 Ga0496124_0020299 3300048927 Bacteria 6146
426 Ga0496124_0113985 3300048927 Bacteria 2172
427 Ga0496124_0141063 3300048927 Bacteria 1901
428 Ga0496124_0154058 3300048927 Bacteria 1799
429 Ga0496125_0000107 3300048928 Bacteria 197483
430 Ga0496125_0000190 3300048928 Bacteria 132540
431 Ga0496125_0000359 3300048928 Bacteria 86115
432 Ga0496125_0018820 3300048928 Bacteria 6541
433 Ga0496125_0023580 3300048928 Bacteria 5676
434 Ga0496126_0010554 3300048929 Bacteria 9665
435 Ga0496126_0176981 3300048929 Bacteria 1814
436 Ga0495678_000416 3300049459 Bacteria 42950
437 Ga0495678_001316 3300049459 Bacteria 19961
438 Ga0495678_003565 3300049459 Bacteria 9537
439 Ga0495678_005277 3300049459 Bacteria 7174
440 Ga0495678_007873 3300049459 Bacteria 5473
441 Ga0495678_009629 3300049459 Bacteria 4760
442 Ga0495678_071915 3300049459 Bacteria 1265
443 Ga0495682_0000071 3300049460 Bacteria 93349
444 Ga0495682_0017924 3300049460 Bacteria 2667
445 Ga0501032_0000005 3300049569 Bacteria 262926
446 Ga0501033_0021647 3300049570 Bacteria 4851
447 Ga0501033_0064019 3300049570 Bacteria 2706
448 Ga0501033_0091476 3300049570 Bacteria 2225
449 Ga0501034_0000027 3300049571 Bacteria 260512
450 Ga0501034_0075960 3300049571 Bacteria 3367
451 Ga0501034_0136488 3300049571 Bacteria 2434
452 Ga0501037_0000125 3300049573 Bacteria 71187
453 Ga0501038_0000053 3300049574 Bacteria 94583
454 Ga0501038_0008256 3300049574 Bacteria 9584
455 Ga0501038_0084551 3300049574 Bacteria 2669
456 Ga0501039_0004313 3300049575 Bacteria 10722
457 Ga0501043_0000011 3300049579 Bacteria 198958
458 Ga0501047_0103509 3300049581 Bacteria 2727
459 Ga0501070_0019926 3300049586 Bacteria 5625
460 Ga0501035_0279533 3300049822 Bacteria 1411
461 Ga0501044_0004931 3300049823 Bacteria 14922
462 Ga0501044_0276217 3300049823 Bacteria 1615
463 nmdc:mga00v17_1134_c1 3300050491 Bacteria 13998
464 nmdc:mga00v17_145214_c1 3300050491 Bacteria 1522
465 nmdc:mga07m45_185306_c1 3300050496 Bacteria 1210
466 nmdc:mga0n895_310257_c1 3300050512 Bacteria 1599
467 Ga0500562_004848 3300053108 Bacteria 3389
468 Ga0500659_0000087 3300053135 Bacteria 46315
469 Ga0500616_0072010 3300053153 Bacteria 1758
470 Ga0500622_0030493 3300053156 Bacteria 2831
471 Ga0500627_0076882 3300053158 Bacteria 1484
472 Ga0500634_0000001 3300053161 Bacteria 258285
473 Ga0501082_0024908 3300060353 Bacteria 5156
474 2977971968 2977971508 Bacteria 7472917
475 2501079752 2501025502 Bacteria 9641094
476 2509128939 2508501125 Bacteria 7208311
477 2509145469 2508501127 Bacteria 7037543
478 2511094090 2510917013 Bacteria 9951648
479 2511303177 2511231012 Bacteria 6738011
480 2511304278 2511231012 Bacteria 6738011
481 2511340526 2511231018 Bacteria 6436256
482 2511340893 2511231018 Bacteria 6436256
483 2511345870 2511231019 Bacteria 6520662
484 2511358479 2511231021 Bacteria 7302637
485 2511358501 2511231021 Bacteria 7302637
486 2514000550 2513237159 Bacteria 6810126
487 2551714881 2551306089 Bacteria 7162724
488 2585264894 2582581306 Bacteria 6450535
489 2585386050 2582581865 Bacteria 6644329
490 2599741904 2599185239 Bacteria 8686614
491 2599904115 2599185292 Bacteria 6290804
492 2599944463 2599185302 Bacteria 5954930
493 2599954935 2599185304 Bacteria 5951361
494 2599984136 2599185309 Bacteria 5969593
495 2599988801 2599185310 Bacteria 6014457
496 2600001295 2599185312 Bacteria 5912071
497 2600049065 2599185320 Bacteria 5963263
498 2600192889 2599185352 Bacteria 7228948
499 2623589889 2622736626 Bacteria 7181580
500 2643807916 2643221557 Bacteria 7184309
501 2643863403 2643221569 Bacteria 6064337
502 2643982759 2643221594 Bacteria 5811388
503 2644120822 2643221621 Bacteria 6212786
504 2644378257 2643221668 Bacteria 7306521
505 2644672283 2643221723 Bacteria 7095460
506 2694630794 2693429783 Bacteria 7019804
507 2694634840 2693429784 Bacteria 7241525
508 2774398814 2773857763 Bacteria 4180068
509 2808931006 2808606377 Bacteria 6646337
510 2808953128 2808606381 Bacteria 6646461
511 2808958122 2808606382 Bacteria 6841132
512 2809034868 2808606395 Bacteria 6020352
513 2834581395 2834578030 Bacteria 3530182
514 2842523535 2842521101 Bacteria 6569494
515 2844169911 2844163670 Bacteria 7266046
516 2852680862 2852677369 Bacteria 3768884
517 2855845087 2855839649 Bacteria 7135830
518 2857542036 2857537821 Bacteria 5248181
519 2858956780 2858950400 Bacteria 6783797
520 2869167727 2869162929 Bacteria 6399702
521 2876382588 2876377896 Bacteria 6565995
522 2888346105 2888343758 Bacteria 6611049
523 2889013311 2889010040 Bacteria 6749192
524 2889919724 2889914905 Bacteria 5702301
525 2904547659 2904541872 Bacteria 8915136
526 2906357359 2906354277 Bacteria 6991324
527 2917703522 2917699015 Bacteria 7043791
528 2921252430 2921250672 Bacteria 6677771
529 2922190296 2922185730 Bacteria 7113964
530 2929142301 2929138655 Bacteria 5810547
531 2929167100 2929160207 Bacteria 9075316
532 2937032115 2937029754 Bacteria 6424026
533 2937055415 2937049772 Bacteria 6757901
534 2938017192 2938014810 Bacteria 6700592
535 2941480670
536 2945963622 2945961074 Bacteria 7342064
537 2958077067 2958071322 Bacteria 6815895
538 2970028737 2970026789 Bacteria 6785236
539 2970030299 2970026789 Bacteria 6785236
540 2970044839 2970040964 Bacteria 6731123
541 2970121681 2970116247 Bacteria 6501857
542 2977580056 2977579622 Bacteria 6772100
543 2977978673 2977971508 Bacteria 7472917
544 3004341695 3004334049 Bacteria 8449246
545 643603287 643348564 Bacteria 8839022
546 650741365 650716007 Bacteria 5573770
547 8054007286 8054002106 Bacteria 7987183
548 8055035214 8055034563 Bacteria 3562128
549 8056128930 8056125926 Bacteria 6228218
550 8056181653 8056177738 Bacteria 6748268
551 8056182411 8056177738 Bacteria 6748268
552 JGI25159J45721_1000042
553 JGI25151J46595_10012460
554 JGI25165J46597_1000034
555 JGI25160J50197_1000139
556 JGI25161J50226_1000837
557 Ga0055532_1000287
558 Ga0055527_1000193
559 Ga0055535_1000401
560 Ga0055542_1001329
561 Ga0055529_1001541
562 Ga0055524_1000604
563 Ga0055524_1002447
564 Ga0055536_1028900
565 Ga0055528_1000637
566 Ga0055530_10005549
567 Ga0055530_10044301
568 Ga0055541_1004899
569 Ga0055543_1000268
570 Ga0065165_1000443
571 Ga0065714_10064524
572 Ga0065704_10163562
573 Ga0070670_100000097
574 Ga0070660_100000019
575 Ga0070668_100000312
576 Ga0070668_100006759
577 Ga0070668_100134617
578 Ga0070659_100000012
579 Ga0070667_100000169
580 Ga0070681_10379035
581 Ga0070685_10237889
582 Ga0068853_100017999
583 Ga0070665_100000610
584 Ga0068855_100698277
585 Ga0068852_100080376
586 Ga0068859_100060114
587 Ga0068864_100294320
588 Ga0068861_100195231
589 Ga0068863_100000185
590 Ga0068863_100034823
591 Ga0068858_100008637
592 Ga0068858_100139409
593 Ga0068860_100000211
594 Ga0068862_100000514
595 Ga0075364_10000118
596 Ga0070716_100229692
597 Ga0075370_10189900
598 Ga0075434_100013855
599 Ga0097620_100060110
600 Ga0079104_1000693
601 Ga0105251_10008446
602 Ga0105244_10001460
603 Ga0105244_10017137
604 Ga0105250_10002161
605 Ga0105250_10004853
606 Ga0105247_10145262
607 Ga0105242_10078858
608 Ga0105248_10064649
609 Ga0105237_10003361
610 Ga0105237_10005925
611 Ga0105238_10002329
612 Ga0105238_10004487
613 Ga0105238_10019812
614 Ga0105249_10000855
615 Ga0105239_10001477
616 Ga0105239_10022510
617 Ga0157373_10000173
618 Ga0157371_10000084
619 Ga0157370_10004581
620 Ga0157369_10003281
621 Ga0157369_10081574
622 Ga0157369_10101267
623 Ga0171463_1002
624 Ga0171462_1029
625 Ga0157375_10006979
626 Ga0163163_10250312
627 Ga0182008_10000401
628 Ga0182008_10000806
629 Ga0182008_10001539
630 Ga0182008_10003476
631 Ga0182008_10015968
632 Ga0182008_10022982
633 Ga0182008_10036717
634 Ga0157379_10042615
635 Ga0182006_1002540
636 Ga0182006_1008622
637 Ga0182007_10000263
638 Ga0182007_10000547
639 Ga0182007_10007769
640 Ga0182007_10016817
641 Ga0182005_1000508
642 Ga0182005_1000555
643 Ga0182005_1004160
644 Ga0183365_10066
645 Ga0183363_1075
646 Ga0163161_10002029
647 Ga0163161_10005559
648 Ga0163161_10042114
649 Ga0228711_1006984
650 Ga0228710_1002664
651 Ga0209436_100065
652 Ga0209566_100243
653 Ga0209674_101231
654 Ga0209672_100059
655 Ga0209147_100072
656 Ga0209563_100227
657 Ga0209258_100102
658 Ga0209148_1000916
659 Ga0209233_1000028
660 Ga0209233_1018275
661 Ga0209455_1000375
662 Ga0209673_1000965
663 Ga0209130_1000115
664 Ga0209676_1001168
665 Ga0209676_1001421
666 Ga0209676_1003721
667 Ga0209676_1003837
668 Ga0209025_1000026
669 Ga0209025_1000079
670 Ga0209025_1000470
671 Ga0209564_1000682
672 Ga0209050_1000155
673 Ga0209050_1001226
674 Ga0209050_1005171
675 Ga0209050_1015319
676 Ga0209256_1000286
677 Ga0209256_1000357
678 Ga0207426_1000226
679 Ga0209051_1004027
680 Ga0209051_1012849
681 Ga0209051_1045028
682 Ga0209257_1007792
683 Ga0207696_1000784
684 Ga0207655_1000445
685 Ga0207713_1002802
686 Ga0207647_10018890
687 Ga0207707_10231166
688 Ga0207695_10267335
689 Ga0207671_10004094
690 Ga0207671_10320925
691 Ga0207657_10000013
692 Ga0207694_10012896
693 Ga0207694_10090826
694 Ga0207650_10000160
695 Ga0207687_10175779
696 Ga0207690_10000048
697 Ga0207665_10038804
698 Ga0207711_10061917
699 Ga0207712_10000203
700 Ga0207668_10000414
701 Ga0207668_10002809
702 Ga0207668_10214484
703 Ga0207658_10000341
704 Ga0207703_10006632
705 Ga0207703_10381796
706 Ga0207639_10014389
707 Ga0207641_10001171
708 Ga0207676_10365325
709 Ga0207675_100142053
710 Ga0209281_1000766
711 Ga0268266_10002265
712 Ga0268266_10431235
713 Ga0268265_10000779
714 Ga0268264_10000270
715 Ga0265338_10010503
716 Ga0307408_100063379
717 Ga0307413_10052714
718 Ga0307410_10016458
719 Ga0307406_10000335
720 Ga0307407_10189679
721 Ga0307412_10000199
722 Ga0307409_100106844
723 Ga0307416_100022616
724 Ga0307416_100659444
725 Ga0307414_10113903
726 Ga0395900_0259787
727 Ga0395905_0047123
728 Ga0395905_0080748
729 Ga0395901_0173239
730 Ga0395901_0217007
731 Ga0436365_0839014
732 Ga0439436_0002149
733 Ga0439438_000053
734 Ga0439438_000154
735 Ga0439438_003911
736 Ga0439447_000015
737 Ga0439447_000034
738 Ga0439466_0000108
739 Ga0439466_0000130
740 Ga0439466_0000427
741 Ga0439466_0013183
742 Ga0451791_1411515
743 Ga0439432_000074
744 Ga0439432_012758
745 Ga0439451_000266
746 Ga0439451_000609
747 Ga0439452_000148
748 Ga0439452_005672
749 Ga0439456_000054
750 Ga0439463_044974
751 Ga0450911_000974
752 Ga0450906_009924
753 Ga0450907_001452
754 Ga0439446_0012246
755 Ga0450909_003180
756 Ga0439434_0000013
757 Ga0439434_0033473
758 Ga0450918_001497
759 Ga0495617_000825
760 Ga0495617_025317
761 Ga0495627_006784
762 Ga0495627_006865
763 Ga0495627_010757
764 Ga0495590_0001239
765 Ga0495590_0002653
766 Ga0495591_000123
767 Ga0495591_001526
768 Ga0495591_024712
769 Ga0495638_0000554
770 Ga0495638_0000770
771 Ga0495638_0002104
772 Ga0495638_0002920
773 Ga0495638_0003662
774 Ga0495638_0007210
775 Ga0495638_0008017
776 Ga0495638_0017064
777 Ga0495638_0092155
778 Ga0495653_0003254
779 Ga0495650_0000488
780 Ga0495650_0000673
781 Ga0495650_0000771
782 Ga0495605_0000194
783 Ga0495605_0000864
784 Ga0495605_0001602
785 Ga0495605_0004720
786 Ga0495584_0000020
787 Ga0495584_0003534
788 Ga0495584_0011933
789 Ga0495584_0019179
790 Ga0495584_0028313
791 Ga0495584_0034794
792 Ga0495585_0000120
793 Ga0495585_0000509
794 Ga0495585_0019774
795 Ga0495596_0016132
796 Ga0495607_0002116
797 Ga0495607_0011413
798 Ga0495583_0000163
799 Ga0495583_0000297
800 Ga0495583_0002722
801 Ga0495583_0048136
802 Ga0495606_0000300
803 Ga0495606_0002362
804 Ga0495606_0002782
805 Ga0495606_0018066
806 Ga0495606_0018113
807 Ga0495606_0039399
808 Ga0495610_0000223
809 Ga0495610_0001575
810 Ga0495610_0002570
811 Ga0495610_0002897
812 Ga0495616_0007055
813 Ga0495616_0059374
814 Ga0495620_0000098
815 Ga0495620_0023526
816 Ga0495631_0019026
817 Ga0495632_0000543
818 Ga0495632_0002536
819 Ga0495632_0012799
820 Ga0495632_0016854
821 Ga0495632_0030087
822 Ga0495632_0036739
823 Ga0495632_0062728
824 Ga0495637_0000118
825 Ga0495637_0000191
826 Ga0495637_0001236
827 Ga0495637_0004494
828 Ga0495637_0008704
829 Ga0495643_0000177
830 Ga0495643_0004223
831 Ga0495643_0005789
832 Ga0495643_0007104
833 Ga0495643_0016362
834 Ga0495644_0000025
835 Ga0495644_0000052
836 Ga0495644_0000168
837 Ga0495644_0000256
838 Ga0495648_0038952
839 Ga0495648_0083252
840 Ga0495666_0000093
841 Ga0495666_0001369
842 Ga0495654_0000112
843 Ga0495654_0000311
844 Ga0495654_0001562
845 Ga0495654_0002430
846 Ga0495654_0006385
847 Ga0495597_0000816
848 Ga0495597_0001410
849 Ga0495597_0001573
850 Ga0495597_0001880
851 Ga0495597_0004976
852 Ga0495597_0047520
853 Ga0495633_0001257
854 Ga0495668_0036027
855 Ga0495611_0018510
856 Ga0495625_0003013
857 Ga0495625_0023207
858 Ga0495661_0000001
859 Ga0495661_0000299
860 Ga0495661_0002697
861 Ga0495623_0090159
862 Ga0495671_0000229
863 Ga0495671_0000459
864 Ga0495671_0002669
865 Ga0495671_0002874
866 Ga0495671_0003295
867 Ga0495671_0007392
868 Ga0495671_0035324
869 Ga0495671_0044367
870 Ga0495649_0001366
871 Ga0495649_0001930
872 Ga0495649_0002529
873 Ga0495649_0006695
874 Ga0495600_0005345
875 Ga0495660_0000720
876 Ga0495660_0001768
877 Ga0495660_0001904
878 Ga0495660_0010023
879 Ga0495660_0058657
880 Ga0495604_0010177
881 Ga0495604_0040008
882 Ga0495674_0000199
883 Ga0495672_0000247
884 Ga0495672_0000506
885 Ga0495672_0043853
886 Ga0495672_0077236
887 Ga0495680_0001784
888 Ga0495680_0008003
889 Ga0495683_0000674
890 Ga0495675_0000016
891 Ga0495675_0002600
892 Ga0495679_000174
893 Ga0495679_000324
894 Ga0495673_0000659
895 Ga0495673_0002077
896 Ga0495673_0008177
897 Ga0495673_0030343
898 Ga0495673_0031005
899 Ga0495681_0000082
900 Ga0495681_0000217
901 Ga0495681_0002018
902 Ga0495681_0002226
903 Ga0495681_0003556
904 Ga0495681_0006981
905 Ga0495681_0025622
906 Ga0495681_0027819
907 Ga0495684_0007396
908 Ga0495686_0000599
909 Ga0495686_0000653
910 Ga0495593_0000090
911 Ga0495626_0000429
912 Ga0495626_0000503
913 Ga0495626_0001953
914 Ga0495626_0014409
915 Ga0496100_0203771
916 Ga0496101_0008551
917 Ga0496102_0068506
918 Ga0496102_0086925
919 Ga0496103_0017936
920 Ga0496103_0112907
921 Ga0496104_0000930
922 Ga0496105_0052590
923 Ga0496105_0151375
924 Ga0496106_0213550
925 Ga0496107_0129277
926 Ga0496108_0064670
927 Ga0496109_0012887
928 Ga0496110_0408596
929 Ga0496112_0025314
930 Ga0496113_0056558
931 Ga0496113_0204717
932 Ga0496114_0006795
933 Ga0496114_0337482
934 Ga0496115_0009472
935 Ga0496115_0163091
936 Ga0496116_0003463
937 Ga0496117_0009256
938 Ga0496117_0013415
939 Ga0496117_0015415
940 Ga0496117_0021205
941 Ga0496117_0029913
942 Ga0496118_0000752
943 Ga0496118_0006489
944 Ga0496118_0015438
945 Ga0496118_0021890
946 Ga0496118_0033890
947 Ga0496118_0132902
948 Ga0496119_0004110
949 Ga0496119_0007370
950 Ga0496119_0011502
951 Ga0496120_0002947
952 Ga0496120_0003169
953 Ga0496120_0006186
954 Ga0496121_0000005
955 Ga0496121_0000140
956 Ga0496121_0002893
957 Ga0496121_0033733
958 Ga0496121_0085647
959 Ga0496121_0131500
960 Ga0496122_0000582
961 Ga0496122_0001471
962 Ga0496122_0007162
963 Ga0496122_0015691
964 Ga0496122_0037220
965 Ga0496122_0057826
966 Ga0496123_0000479
967 Ga0496123_0000567
968 Ga0496123_0011618
969 Ga0496123_0027734
970 Ga0496123_0049241
971 Ga0496123_0056638
972 Ga0496124_0000004
973 Ga0496124_0002662
974 Ga0496124_0006230
975 Ga0496124_0014560
976 Ga0496124_0020299
977 Ga0496124_0113985
978 Ga0496124_0141063
979 Ga0496124_0154058
980 Ga0496125_0000107
981 Ga0496125_0000190
982 Ga0496125_0000359
983 Ga0496125_0018820
984 Ga0496125_0023580
985 Ga0496126_0010554
986 Ga0496126_0176981
987 Ga0495678_000416
988 Ga0495678_001316
989 Ga0495678_003565
990 Ga0495678_005277
991 Ga0495678_007873
992 Ga0495678_009629
993 Ga0495678_071915
994 Ga0495682_0000071
995 Ga0495682_0017924
996 Ga0501032_0000005
997 Ga0501033_0021647
998 Ga0501033_0064019
999 Ga0501033_0091476
1000 Ga0501034_0000027
1001 Ga0501034_0075960
1002 Ga0501034_0136488
1003 Ga0501037_0000125
1004 Ga0501038_0000053
1005 Ga0501038_0008256
1006 Ga0501038_0084551
1007 Ga0501039_0004313
1008 Ga0501043_0000011
1009 Ga0501047_0103509
1010 Ga0501070_0019926
1011 Ga0501035_0279533
1012 Ga0501044_0004931
1013 Ga0501044_0276217
1014 nmdc:mga00v17_1134_c1
1015 nmdc:mga00v17_145214_c1
1016 nmdc:mga07m45_185306_c1
1017 nmdc:mga0n895_310257_c1
1018 Ga0500562_004848
1019 Ga0500659_0000087
1020 Ga0500616_0072010
1021 Ga0500622_0030493
1022 Ga0500627_0076882
1023 Ga0500634_0000001
1024 Ga0501082_0024908
1025 2977971968
1026 2501079752
1027 2509128939
1028 2509145469
1029 2511094090
1030 2511303177
1031 2511304278
1032 2511340526
1033 2511340893
1034 2511345870
1035 2511358479
1036 2511358501
1037 2514000550
1038 2551714881
1039 2585264894
1040 2585386050
1041 2599741904
1042 2599904115
1043 2599944463
1044 2599954935
1045 2599984136
1046 2599988801
1047 2600001295
1048 2600049065
1049 2600192889
1050 2623589889
1051 2643807916
1052 2643863403
1053 2643982759
1054 2644120822
1055 2644378257
1056 2644672283
1057 2694630794
1058 2694634840
1059 2774398814
1060 2808931006
1061 2808953128
1062 2808958122
1063 2809034868
1064 2834581395
1065 2842523535
1066 2844169911
1067 2852680862
1068 2855845087
1069 2857542036
1070 2858956780
1071 2869167727
1072 2876382588
1073 2888346105
1074 2889013311
1075 2889919724
1076 2904547659
1077 2906357359
1078 2917703522
1079 2921252430
1080 2922190296
1081 2929142301
1082 2929167100
1083 2937032115
1084 2937055415
1085 2938017192
1086 2941480670
1087 2945963622
1088 2958077067
1089 2970028737
1090 2970030299
1091 2970044839
1092 2970121681
1093 2977580056
1094 2977978673
1095 3004341695
1096 643603287
1097 650741365
1098 8054007286
1099 8055035214
1100 8056128930
1101 8056181653
1102 8056182411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

61

327

0.9

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

154

245

0.87

PF00676

E1_dh

Dehydrogenase E1 component

149

290

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yak-assembly1.cif.gz_CCC split gene transketolase, active alpha2beta2 heterotetramer 0.9469 9 281
3ooy-assembly1.cif.gz_A crystal structure of human transketolase (tkt) 0.9298 9 280
6rjb-assembly1.cif.gz_A human transketolase variant t382e 0.924 3 287
4kxw-assembly1.cif.gz_A human transketolase in covalent complex with donor ketose d-xylulose-5-phosphate, crystal 2 0.9239 3 287
8cip-assembly2.cif.gz_D crystal structure of transketolase from geobacillus stearothermophilus 0.9181 16 283
ID Description Score Start End Superfamily
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9517 13 282 3.40.50.970
af_Q6PHI8_1_298_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9299 6 287 3.40.50.970
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9283 13 282 3.40.50.970
af_C6KSV3_9_337_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9018 17 285 3.40.50.970
af_Q6PHI8_1_298_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8988 6 287 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A371XJP2-F1-model_v4 Transketolase 0.9812 6 284
AF-A0A5A9GPC7-F1-model_v4 Transketolase 0.9788 6 283
AF-A0A527KPL3-F1-model_v4 Transketolase 0.9774 7 285
AF-A0A1S7RD18-F1-model_v4 deleted 0.9751 4 248
AF-A0A529MBE2-F1-model_v4 Transketolase 0.9732 42 281

Map