F463273

General Info

Members Datasets Scaffolds Average Seq Length
557 468 285 460

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1000508|Ga0055540_100050826
Length 473
Sequence MAELTDNGRADKTMARHADEEHHHGVSFGEAFKVWLRVAALSFGGPAGQIAVMHRIIVDEKRWIGEHRFLHALNYCMLLPGPEAQQLAVYIGWLMHRTLGGLVAGLLFVLPGFLSILCLSYIYAAYGSVGIVAGLFFGLKAAVLAVVVQAVIRIGSRALRNNVMLAIAAVAFVAIFFFHVPFPLIVLAAAIAGFLGGRFGIAAFKPGGGHKAGSGPMVSDAESALGEGIPPHARPNLGWSLSMSAALLALWLAPIAALYAAFGAHDVFTEIGLFFSKMAVVTFGGAYAALAYVAQEAVQRFGWLKPGEMLDGLGMAETTPGPLIMVLQFVGFMGAYRNSGSLDPMLAATLAAILTTWVTFVPCFLWIFLGAPFIEKLRGNVALAGAMSAITAAVVGVILNLVLWFGLHTLFAEVATVHLGGLRLDIPVLQSAVPATMALSAAAAIAIFRFKTTVIATLLACAIAGMLWTLATG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
14 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
19 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
20 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
21 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
22 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
23 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
24 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
25 2516143018 Ensifer sp. BR816 Isolate Nodule
26 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
27 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
28 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
29 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
30 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
31 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
32 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
33 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
34 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
35 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
36 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
37 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
38 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
39 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
40 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
41 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
42 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
43 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
44 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
45 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
46 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
47 2643221557 Ensifer sp. Root558 Isolate Unclassified
48 2643221582 Rhizobium sp. Root651 Isolate Unclassified
49 2643221610 Ensifer sp. Root74 Isolate Unclassified
50 2643221618 Ensifer sp. Root231 Isolate Unclassified
51 2643221626 Ensifer sp. Root31 Isolate Unclassified
52 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
53 2643221655 Ensifer sp. Root1252 Isolate Unclassified
54 2643221659 Ensifer sp. Root127 Isolate Unclassified
55 2643221668 Ensifer sp. Root423 Isolate Unclassified
56 2643221675 Ensifer sp. Root1298 Isolate Unclassified
57 2643221680 Ensifer sp. Root1312 Isolate Unclassified
58 2643221698 Ensifer sp. Root142 Isolate Unclassified
59 2643221712 Ensifer sp. Root258 Isolate Unclassified
60 2643221719 Rhizobium sp. Root274 Isolate Unclassified
61 2643221723 Ensifer sp. Root278 Isolate Unclassified
62 2643221726 Ensifer sp. Root954 Isolate Unclassified
63 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
64 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
65 2718217927 Rhizobium sp. N324 Isolate Nodule
66 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
67 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
68 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
69 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
70 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
71 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
72 2718218423 Rhizobium sp. N941 Isolate Nodule
73 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
74 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
75 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
76 2721755809 Rhizobium sp. N541 Isolate Nodule
77 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
78 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
79 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
80 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
81 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
82 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
83 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
84 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
85 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
86 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
87 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
88 2791355256 Rhizobium sp. M10 Isolate Nodule
89 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
90 2791355261 Rhizobium sp. J15 Isolate Nodule
91 2791355262 Rhizobium sp. M1 Isolate Nodule
92 2791355263 Rhizobium chutanense C5 Isolate Nodule
93 2791355266 Rhizobium sp. L43 Isolate Nodule
94 2791355267 Rhizobium sp. L18 Isolate Nodule
95 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
96 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
97 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
98 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
99 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
100 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
101 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
102 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
103 2802429633 Rhizobium anhuiense J3 Isolate Nodule
104 2802429634 Rhizobium anhuiense S10 Isolate Nodule
105 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
106 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
107 2802429637 Rhizobium anhuiense C15 Isolate Nodule
108 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
109 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
110 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
111 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
112 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
113 2838048938 Rhizobium pisi 27/80 Isolate Nodule
114 2838061910 Rhizobium phaseoli L15 Isolate Nodule
115 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
116 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
117 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
118 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
119 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
120 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
121 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
122 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
123 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
124 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
125 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
126 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
127 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
128 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
129 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
130 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
131 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
132 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
133 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
134 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
135 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
136 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
137 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
138 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
139 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
140 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
141 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
142 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
143 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
144 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
145 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
146 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
147 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
148 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
149 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
150 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
151 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
152 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
153 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
154 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
155 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
156 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
157 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
158 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
159 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
160 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
161 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
162 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
163 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
164 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
165 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
166 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
167 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
168 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
169 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
170 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
171 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
172 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
173 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
174 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
175 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
176 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
177 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
178 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
179 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
180 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
181 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
182 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
183 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
184 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
185 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
186 2844163670 Ensifer sp. 1H6 Isolate Unclassified
187 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
188 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
189 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
190 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
191 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
192 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
193 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
194 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
195 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
196 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
197 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
198 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
199 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
200 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
201 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
202 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
203 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
204 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
205 2933599457 Rhizobium phaseoli M3 Isolate Nodule
206 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
207 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
208 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
209 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
210 2936381700 Rhizobium chutanense C16 Isolate Unclassified
211 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
212 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
213 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
214 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
215 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
216 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
217 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
218 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
219 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
220 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
221 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
222 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
223 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
224 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
225 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
226 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
227 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
228 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
229 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
230 2996887358 Rhizobium sp. R711 Isolate Nodule
231 2996893221 Rhizobium sp. R635 Isolate Nodule
232 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
233 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
234 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
235 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
236 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
237 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
238 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
239 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
240 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
241 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
242 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
243 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
244 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
245 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
246 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
247 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
248 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
249 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
250 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
251 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
252 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
253 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
254 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
255 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
256 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
257 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
258 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
259 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
260 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
261 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
262 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
263 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
264 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
265 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
266 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
267 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
268 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
269 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
270 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
271 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
272 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
273 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
274 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
275 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
276 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
277 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
278 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
279 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
280 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
281 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
282 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
283 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
284 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
285 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
286 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
287 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
288 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
289 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
290 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
291 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
292 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
293 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
294 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
295 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
296 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
297 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
299 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
300 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
301 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
302 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
304 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
305 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
306 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
308 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
309 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
311 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
312 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
313 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
315 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
316 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
336 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
337 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
339 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
340 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
341 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
342 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
343 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
344 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
345 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
346 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
347 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
348 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
349 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
350 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
351 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
352 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
353 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
354 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
355 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
356 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
357 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
358 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
359 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
360 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
361 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
362 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
363 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
364 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
365 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
366 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
367 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
368 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
369 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
370 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
371 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
372 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
373 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
374 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
375 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
376 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
377 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
378 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
379 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
380 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
381 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
382 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
383 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
384 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
388 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
389 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
390 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
391 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
392 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
393 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
394 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
395 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
396 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
397 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
398 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
399 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
400 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
401 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
402 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
403 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
404 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
405 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
406 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
407 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
408 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
409 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
410 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
411 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
412 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
413 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
414 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
415 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
416 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
417 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
418 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
419 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
420 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
421 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
422 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
423 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
424 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
425 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
426 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
427 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
428 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
429 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
430 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
431 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
432 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
433 8005258706 Rhizobium sp. R693 Isolate Nodule
434 8005275841 Rhizobium sp. N4311 Isolate Nodule
435 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
436 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
437 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
438 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
439 8005321885 Rhizobium sp. R72 Isolate Nodule
440 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
441 8005382845 Rhizobium sp. R634 Isolate Nodule
442 8005395548 Rhizobium sp. R339 Isolate Nodule
443 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
444 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
445 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
446 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
447 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
448 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
449 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
450 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
451 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
452 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
453 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
454 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
455 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
456 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
457 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
458 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
459 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
460 8018176218 Rhizobium sp. N122 Isolate Nodule
461 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
462 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
463 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
464 8024501048 Rhizobium sp. H4 Isolate Nodule
465 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
466 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
467 8056382006 Rhizobium croatiense 13T Isolate Nodule
468 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.99
Metatranscriptomes 0.18
Isolates 48.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.59
Nodule 40.57
Rhizoplane 2.69
Rhizosphere 26.57
Stem 0
Stem Tuber 0
Unclassified 12.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005459 3300001979 Bacteria 5374
2 JGI24740J21852_10006077 3300001979 Bacteria 5045
3 JGI25155J39150_1000023 3300002704 Bacteria 136961
4 JGI25156J39149_1000029 3300002705 Bacteria 126505
5 JGI25162J39368_1000557 3300002737 Bacteria 27462
6 JGI25154J39366_1000067 3300002738 Bacteria 100452
7 JGI25157J39369_1000043 3300002741 Bacteria 122537
8 JGI25152J39213_1006882 3300002773 Bacteria 3011
9 JGI25159J45721_1001319 3300002987 Bacteria 10466
10 JGI25151J46595_10000723 3300003187 Bacteria 27441
11 JGI25165J46597_1000341 3300003214 Bacteria 53973
12 JGI25153J46596_10000070 3300003215 Bacteria 117125
13 JGI25153J46596_10019595 3300003215 Bacteria 2585
14 JGI25153J46596_10025182 3300003215 Bacteria 2131
15 JGI25160J50197_1000028 3300003354 Bacteria 179309
16 JGI25160J50197_1000782 3300003354 Bacteria 17066
17 JGI25160J50197_1028769 3300003354 Bacteria 1485
18 JGI25161J50226_1002397 3300003374 Bacteria 4828
19 Ga0055525_1000203 3300003759 Bacteria 68926
20 Ga0055542_1000040 3300003762 Bacteria 214035
21 Ga0055529_1000037 3300003763 Bacteria 237307
22 Ga0055526_1001901 3300003771 Bacteria 14476
23 Ga0055526_1007817 3300003771 Bacteria 5472
24 Ga0055526_1013505 3300003771 Bacteria 3446
25 Ga0055524_1001114 3300003775 Bacteria 16207
26 Ga0055524_1005554 3300003775 Bacteria 5606
27 Ga0055536_1001126 3300003781 Bacteria 16756
28 Ga0055528_1000331 3300003790 Bacteria 39811
29 Ga0055528_1011072 3300003790 Bacteria 3611
30 Ga0055530_10002417 3300003791 Bacteria 12090
31 Ga0055540_1000508 3300003792 Bacteria 29469
32 Ga0055531_10005396 3300003794 Bacteria 7492
33 Ga0058692_1014125 3300003856 Bacteria 1838
34 Ga0055543_1001955 3300004625 Bacteria 7343
35 Ga0055543_1002085 3300004625 Bacteria 6961
36 Ga0065165_1000061 3300005262 Bacteria 179347
37 Ga0065165_1000895 3300005262 Bacteria 38497
38 Ga0070658_10009134 3300005327 Bacteria 7969
39 Ga0070658_10010242 3300005327 Bacteria 7518
40 Ga0070670_100012940 3300005331 Bacteria 7144
41 Ga0070661_100095943 3300005344 Bacteria 2200
42 Ga0070668_100075207 3300005347 Bacteria 2636
43 Ga0070671_100008849 3300005355 Bacteria 8076
44 Ga0070671_100048141 3300005355 Bacteria 3545
45 Ga0070678_100000523 3300005456 Bacteria 18610
46 Ga0068853_100010925 3300005539 Bacteria 7359
47 Ga0068855_100032745 3300005563 Bacteria 6206
48 Ga0068857_100015947 3300005577 Bacteria 6580
49 Ga0068854_100012559 3300005578 Bacteria 5549
50 Ga0068856_100036527 3300005614 Bacteria 4817
51 Ga0068852_100013483 3300005616 Bacteria 6257
52 Ga0068863_100001872 3300005841 Bacteria 20915
53 Ga0068858_100005317 3300005842 Bacteria 12622
54 Ga0068860_100000256 3300005843 Bacteria 78477
55 Ga0075365_10000388 3300006038 Bacteria 16068
56 Ga0075368_10017008 3300006042 Bacteria 2716
57 Ga0075367_10001308 3300006178 Bacteria 10547
58 Ga0075369_10007164 3300006186 Bacteria 4238
59 Ga0075366_10000551 3300006195 Bacteria 17465
60 Ga0075366_10017896 3300006195 Bacteria 4087
61 Ga0075370_10000153 3300006353 Bacteria 23504
62 Ga0105245_10028520 3300009098 Bacteria 4925
63 Ga0105243_10000913 3300009148 Bacteria 27723
64 Ga0105237_10027746 3300009545 Bacteria 5772
65 Ga0105249_10033981 3300009553 Bacteria 4619
66 Ga0123341_1000576 3300009765 Bacteria 23339
67 Ga0123342_1023427 3300009766 Bacteria 4010
68 Ga0105239_10030872 3300010375 Bacteria 5895
69 Ga0105239_10040102 3300010375 Bacteria 5130
70 Ga0105246_10049815 3300011119 Bacteria 2870
71 Ga0157373_10022841 3300013100 Bacteria 4536
72 Ga0157370_10023193 3300013104 Bacteria 6166
73 Ga0171463_1005 3300013249 Bacteria 358236
74 Ga0206353_11591064 3300020082 Bacteria 9094
75 Ga0214542_1014550 3300021321 Bacteria 8715
76 Ga0214543_1000012 3300021327 Bacteria 338982
77 Ga0228711_1005729 3300022739 Bacteria 18833
78 Ga0209435_100011 3300025206 Bacteria 413027
79 Ga0209436_102200 3300025208 Bacteria 6072
80 Ga0209563_100147 3300025230 Bacteria 69021
81 Ga0209437_100036 3300025233 Bacteria 469153
82 Ga0207425_1005201 3300025245 Bacteria 3745
83 Ga0209646_1000024 3300025246 Bacteria 413027
84 Ga0209646_1004323 3300025246 Bacteria 2604
85 Ga0209026_1000030 3300025250 Bacteria 329811
86 Ga0209148_1000011 3300025254 Bacteria 1196503
87 Ga0209759_1000011 3300025256 Bacteria 413027
88 Ga0209129_1000784 3300025258 Bacteria 20086
89 Ga0209129_1006250 3300025258 Bacteria 3928
90 Ga0209233_1000166 3300025261 Bacteria 152270
91 Ga0209455_1000006 3300025272 Bacteria 1196503
92 Ga0209673_1000384 3300025273 Bacteria 79540
93 Ga0209673_1005540 3300025273 Bacteria 6318
94 Ga0209673_1017471 3300025273 Bacteria 2643
95 Ga0209130_1000068 3300025284 Bacteria 179361
96 Ga0209676_1000714 3300025292 Bacteria 45991
97 Ga0209025_1000058 3300025294 Bacteria 311398
98 Ga0209025_1000203 3300025294 Bacteria 145210
99 Ga0209025_1011702 3300025294 Bacteria 5734
100 Ga0209564_1000081 3300025295 Bacteria 261592
101 Ga0209564_1000388 3300025295 Bacteria 79331
102 Ga0209564_1000458 3300025295 Bacteria 68749
103 Ga0209758_1000023 3300025297 Bacteria 612453
104 Ga0209758_1001805 3300025297 Bacteria 23641
105 Ga0209758_1012740 3300025297 Bacteria 4664
106 Ga0209050_1007972 3300025298 Bacteria 5786
107 Ga0209050_1034018 3300025298 Bacteria 1534
108 Ga0209256_1000408 3300025299 Bacteria 67949
109 Ga0209256_1001984 3300025299 Bacteria 18424
110 Ga0209256_1002018 3300025299 Bacteria 18110
111 Ga0209256_1008822 3300025299 Bacteria 4566
112 Ga0207426_1000155 3300025302 Bacteria 179361
113 Ga0207426_1001412 3300025302 Bacteria 20129
114 Ga0207426_1002673 3300025302 Bacteria 10935
115 Ga0209051_1002798 3300025303 Bacteria 12036
116 Ga0209051_1003025 3300025303 Bacteria 11387
117 Ga0209051_1008262 3300025303 Bacteria 5538
118 Ga0209257_1001598 3300025304 Bacteria 25935
119 Ga0207647_10001658 3300025904 Bacteria 17144
120 Ga0207705_10003962 3300025909 Bacteria 11259
121 Ga0207705_10006153 3300025909 Bacteria 8929
122 Ga0207671_10014109 3300025914 Bacteria 6330
123 Ga0207649_10067559 3300025920 Bacteria 2270
124 Ga0207650_10001778 3300025925 Bacteria 15244
125 Ga0207687_10007954 3300025927 Bacteria 6942
126 Ga0207644_10008394 3300025931 Bacteria 6760
127 Ga0207644_10023076 3300025931 Bacteria 4257
128 Ga0207644_10044456 3300025931 Bacteria 3156
129 Ga0207709_10000039 3300025935 Bacteria 260127
130 Ga0207709_10041409 3300025935 Bacteria 2763
131 Ga0207669_10000117 3300025937 Bacteria 39781
132 Ga0207669_10000809 3300025937 Bacteria 13424
133 Ga0207667_10000002 3300025949 Bacteria 895662
134 Ga0207658_10000075 3300025986 Bacteria 109004
135 Ga0207703_10079957 3300026035 Bacteria 2722
136 Ga0207639_10002462 3300026041 Bacteria 12418
137 Ga0207702_10015393 3300026078 Bacteria 6338
138 Ga0207674_10009458 3300026116 Bacteria 11136
139 Ga0207683_10000751 3300026121 Bacteria 29427
140 Ga0207698_10010061 3300026142 Bacteria 6058
141 Ga0209371_1001452 3300027312 Bacteria 16053
142 Ga0209282_1000038 3300027666 Bacteria 128955
143 Ga0268264_10000087 3300028381 Bacteria 236696
144 Ga0307515_10005688 3300028794 Bacteria 25165
145 Ga0307515_10008152 3300028794 Bacteria 20518
146 Ga0307515_10022006 3300028794 Bacteria 11262
147 Ga0268256_1004281 3300030500 Bacteria 5977
148 Ga0268256_1008775 3300030500 Bacteria 3435
149 Ga0307513_10046157 3300031456 Bacteria 4755
150 Ga0307508_10001675 3300031616 Bacteria 24607
151 Ga0307406_10027459 3300031901 Bacteria 3430
152 Ga0307412_10004424 3300031911 Bacteria 7825
153 Ga0307412_10007983 3300031911 Bacteria 6033
154 Ga0307412_10014910 3300031911 Bacteria 4595
155 Ga0315914_1000204 3300031967 Bacteria 62058
156 Ga0307414_10124281 3300032004 Bacteria 1990
157 Ga0315913_1003513 3300033430 Bacteria 18833
158 Ga0315913_1025489 3300033430 Bacteria 4802
159 Ga0315915_1000018 3300033464 Bacteria 129799
160 Ga0395905_0001232 3300037471 Bacteria 31813
161 Ga0451835_0278968 3300041492 Bacteria 3904
162 Ga0451853_0856197 3300041512 Bacteria 2112
163 Ga0439445_0010026 3300042004 Bacteria 2237
164 Ga0466963_0002617 3300044694 Bacteria 10103
165 Ga0453684_0137027 3300044712 Bacteria 2929
166 Ga0466970_0000957 3300044765 Bacteria 13931
167 Ga0466957_0027585 3300044842 Bacteria 3376
168 Ga0466958_0009358 3300045836 Bacteria 5460
169 Ga0495592_0094242 3300046454 Bacteria 2143
170 Ga0495629_0035351 3300046459 Bacteria 3531
171 Ga0495638_0000187 3300046460 Bacteria 94516
172 Ga0495638_0000238 3300046460 Bacteria 75287
173 Ga0495605_0012850 3300046474 Bacteria 4633
174 Ga0495605_0026267 3300046474 Bacteria 3028
175 Ga0495584_0008614 3300046491 Bacteria 5280
176 Ga0495585_0001756 3300046492 Bacteria 16497
177 Ga0495585_0005260 3300046492 Bacteria 8186
178 Ga0495585_0033462 3300046492 Bacteria 2909
179 Ga0495585_0041160 3300046492 Bacteria 2592
180 Ga0495596_0011156 3300046500 Bacteria 3885
181 Ga0495583_0000219 3300046506 Bacteria 96346
182 Ga0495583_0010407 3300046506 Bacteria 5428
183 Ga0495583_0014281 3300046506 Bacteria 4389
184 Ga0495606_0000092 3300046507 Bacteria 152369
185 Ga0495606_0029656 3300046507 Bacteria 3836
186 Ga0495616_0070204 3300046513 Bacteria 1696
187 Ga0495618_0023996 3300046514 Bacteria 3776
188 Ga0495631_0000842 3300046518 Bacteria 19468
189 Ga0495631_0005008 3300046518 Bacteria 6978
190 Ga0495631_0017754 3300046518 Bacteria 3359
191 Ga0495631_0026136 3300046518 Bacteria 2683
192 Ga0495632_0009419 3300046519 Bacteria 5894
193 Ga0495637_0022151 3300046520 Bacteria 2901
194 Ga0495643_0000943 3300046522 Bacteria 30130
195 Ga0495643_0004068 3300046522 Bacteria 10413
196 Ga0495643_0014657 3300046522 Bacteria 4658
197 Ga0495643_0077341 3300046522 Bacteria 1739
198 Ga0495648_0000146 3300046524 Bacteria 84443
199 Ga0495663_0002107 3300046525 Bacteria 6091
200 Ga0495642_0002900 3300046528 Bacteria 6833
201 Ga0495640_0052544 3300046533 Bacteria 2798
202 Ga0495587_0094955 3300046536 Bacteria 1721
203 Ga0495622_0029470 3300046557 Bacteria 2564
204 Ga0495633_0001313 3300046558 Bacteria 19617
205 Ga0495656_0034942 3300046615 Bacteria 2062
206 Ga0495656_0062065 3300046615 Bacteria 1634
207 Ga0495668_0000056 3300046616 Bacteria 197862
208 Ga0495668_0004034 3300046616 Bacteria 10683
209 Ga0495668_0026267 3300046616 Bacteria 3305
210 Ga0495668_0071664 3300046616 Bacteria 1904
211 Ga0495611_0053968 3300046648 Bacteria 1815
212 Ga0495625_0003634 3300046660 Bacteria 15128
213 Ga0495625_0021830 3300046660 Bacteria 4917
214 Ga0495625_0022217 3300046660 Bacteria 4868
215 Ga0495625_0022496 3300046660 Bacteria 4833
216 Ga0495625_0089432 3300046660 Bacteria 2131
217 Ga0495657_0007240 3300046675 Bacteria 8599
218 Ga0495669_0000155 3300046684 Bacteria 43475
219 Ga0495670_0000012 3300046691 Bacteria 170426
220 Ga0495670_0016276 3300046691 Bacteria 3654
221 Ga0495670_0034562 3300046691 Bacteria 2518
222 Ga0495600_0005871 3300046809 Bacteria 7426
223 Ga0495660_0018375 3300046810 Bacteria 4020
224 Ga0495660_0018736 3300046810 Bacteria 3975
225 Ga0495683_0017026 3300047323 Bacteria 3770
226 Ga0495683_0056147 3300047323 Bacteria 1959
227 Ga0495687_000109 3300047443 Bacteria 125648
228 Ga0495687_000353 3300047443 Bacteria 58833
229 Ga0495687_022641 3300047443 Bacteria 3013
230 Ga0495677_0003334 3300047445 Bacteria 6246
231 Ga0495677_0006155 3300047445 Bacteria 4538
232 Ga0495681_0003604 3300047470 Bacteria 10774
233 Ga0496102_0000163 3300048905 Bacteria 89673
234 Ga0496102_0168746 3300048905 Bacteria 2060
235 Ga0496103_0000052 3300048906 Bacteria 149437
236 Ga0496104_0150308 3300048907 Bacteria 2236
237 Ga0496104_0185514 3300048907 Bacteria 1991
238 Ga0496105_0001251 3300048908 Bacteria 17732
239 Ga0496105_0033787 3300048908 Bacteria 4203
240 Ga0496110_0043775 3300048913 Bacteria 3909
241 Ga0496110_0168719 3300048913 Bacteria 1985
242 Ga0496114_0012274 3300048917 Bacteria 6855
243 Ga0496115_0000078 3300048918 Bacteria 89817
244 Ga0496116_0003807 3300048919 Bacteria 14745
245 Ga0496116_0057163 3300048919 Bacteria 2552
246 Ga0496117_0000141 3300048920 Bacteria 158041
247 Ga0496118_0000103 3300048921 Bacteria 158099
248 Ga0496118_0008530 3300048921 Bacteria 10578
249 Ga0496119_0005128 3300048922 Bacteria 12695
250 Ga0496119_0016632 3300048922 Bacteria 5583
251 Ga0496121_0000156 3300048924 Bacteria 149376
252 Ga0496122_0002015 3300048925 Bacteria 30205
253 Ga0496122_0098794 3300048925 Bacteria 1959
254 Ga0496123_0018717 3300048926 Bacteria 5489
255 Ga0496124_0000041 3300048927 Bacteria 303887
256 Ga0496125_0000238 3300048928 Bacteria 113252
257 Ga0496125_0099017 3300048928 Bacteria 2155
258 Ga0496126_0000155 3300048929 Bacteria 158816
259 Ga0495678_016645 3300049459 Bacteria 3355
260 nmdc:mga0yw44_40105_c1 3300050492 Bacteria 2780
261 nmdc:mga0k408_733_c1 3300050493 Bacteria 17979
262 nmdc:mga07m45_104_c1 3300050496 Bacteria 33217
263 nmdc:mga07m45_145313_c1 3300050496 Bacteria 1374
264 nmdc:mga07m45_44158_c1 3300050496 Bacteria 2500
265 Ga0500610_0000144 3300053079 Bacteria 21374
266 Ga0500643_000511 3300053087 Bacteria 27517
267 Ga0500557_003653 3300053105 Bacteria 3096
268 Ga0500569_001928 3300053109 Bacteria 4012
269 Ga0500569_023100 3300053109 Bacteria 1666
270 Ga0500594_0001103 3300053118 Bacteria 5788
271 Ga0500594_0005960 3300053118 Bacteria 2719
272 Ga0500595_001019 3300053119 Bacteria 15741
273 Ga0500642_0000178 3300053130 Bacteria 26342
274 Ga0500655_002689 3300053133 Bacteria 3221
275 Ga0500658_0000578 3300053134 Bacteria 15417
276 Ga0500568_0000295 3300053139 Bacteria 40681
277 Ga0500590_000774 3300053148 Bacteria 11813
278 Ga0500616_0001084 3300053153 Bacteria 28373
279 Ga0500616_0006752 3300053153 Bacteria 7439
280 Ga0500619_005287 3300053154 Bacteria 2865
281 Ga0500624_000034 3300053157 Bacteria 101151
282 Ga0500627_0058687 3300053158 Bacteria 1690
283 Ga0500637_0000108 3300053178 Bacteria 29816
284 Ga0500645_000001 3300053730 Bacteria 455558
285 Ga0466962_0048203 3300061719 Bacteria 2036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0070204 Ga0495616_0070204_26_1216 337
2 3300053105 Ga0500557_003653 Ga0500557_003653_13_1203 337
3 iso_pu_bacteria 2928526807 2928531283 354
4 3300050496 nmdc:mga07m45_145313_c1 nmdc:mga07m45_145313_c1_153_1352 357
5 3300050493 nmdc:mga0k408_733_c1 nmdc:mga0k408_733_c1_10043_11383 359
6 3300050496 nmdc:mga07m45_104_c1 nmdc:mga07m45_104_c1_10043_11383 359
7 3300006195 Ga0075366_10000551 Ga0075366_100005519 374
8 3300006353 Ga0075370_10000153 Ga0075370_1000015317 374
9 3300046518 Ga0495631_0026136 Ga0495631_0026136_11_1282 380
10 3300046520 Ga0495637_0022151 Ga0495637_0022151_1591_2862 380
11 3300047323 Ga0495683_0056147 Ga0495683_0056147_661_1932 381
12 3300006186 Ga0075369_10007164 Ga0075369_100071643 391
13 3300020082 Ga0206353_11591064 Ga0206353_115910646 392
14 iso_pu_bacteria 2838035591 2838041544 393
15 3300010375 Ga0105239_10030872 Ga0105239_100308723 397
16 3300046474 Ga0495605_0012850 Ga0495605_0012850_568_1971 398
17 3300046518 Ga0495631_0005008 Ga0495631_0005008_4904_6307 398
18 3300046616 Ga0495668_0026267 Ga0495668_0026267_657_2060 398
19 3300046660 Ga0495625_0003634 Ga0495625_0003634_3271_4674 398
20 3300046691 Ga0495670_0016276 Ga0495670_0016276_573_1976 398
21 3300047443 Ga0495687_022641 Ga0495687_022641_339_1745 398
22 3300053118 Ga0500594_0005960 Ga0500594_0005960_307_1710 398
23 3300053158 Ga0500627_0058687 Ga0500627_0058687_190_1593 398
24 3300003856 Ga0058692_1014125 Ga0058692_10141252 400
25 3300027312 Ga0209371_1001452 Ga0209371_10014523 400
26 3300030500 Ga0268256_1008775 Ga0268256_10087752 400
27 3300028794 Ga0307515_10005688 Ga0307515_1000568815 402
28 3300044694 Ga0466963_0002617 Ga0466963_0002617_2877_4280 402
29 3300044765 Ga0466970_0000957 Ga0466970_0000957_2875_4278 402
30 3300044842 Ga0466957_0027585 Ga0466957_0027585_545_1948 402
31 3300045836 Ga0466958_0009358 Ga0466958_0009358_704_2107 402
32 3300061719 Ga0466962_0048203 Ga0466962_0048203_360_1763 402
33 3300031456 Ga0307513_10046157 Ga0307513_100461575 403
34 3300003215 JGI25153J46596_10019595 JGI25153J46596_100195952 404
35 3300003354 JGI25160J50197_1000782 JGI25160J50197_100078214 404
36 3300003771 Ga0055526_1007817 Ga0055526_10078173 404
37 3300003775 Ga0055524_1005554 Ga0055524_10055542 404
38 3300004625 Ga0055543_1002085 Ga0055543_10020855 404
39 3300006195 Ga0075366_10017896 Ga0075366_100178961 404
40 3300025295 Ga0209564_1000458 Ga0209564_10004583 404
41 3300025297 Ga0209758_1001805 Ga0209758_100180517 404
42 3300025302 Ga0207426_1001412 Ga0207426_100141216 404
43 3300025925 Ga0207650_10001778 Ga0207650_1000177814 405
44 3300042004 Ga0439445_0010026 Ga0439445_0010026_386_1789 406
45 3300044712 Ga0453684_0137027 Ga0453684_0137027_746_2095 406
46 3300046459 Ga0495629_0035351 Ga0495629_0035351_1880_3286 406
47 3300046514 Ga0495618_0023996 Ga0495618_0023996_921_2327 406
48 3300046557 Ga0495622_0029470 Ga0495622_0029470_743_2149 406
49 3300048921 Ga0496118_0008530 Ga0496118_0008530_4137_5558 406
50 3300053148 Ga0500590_000774 Ga0500590_000774_6096_7502 406
51 3300037471 Ga0395905_0001232 Ga0395905_0001232_5680_7086 407
52 3300046454 Ga0495592_0094242 Ga0495592_0094242_237_1643 407
53 3300046492 Ga0495585_0041160 Ga0495585_0041160_966_2381 407
54 3300046533 Ga0495640_0052544 Ga0495640_0052544_46_1452 407
55 3300046536 Ga0495587_0094955 Ga0495587_0094955_32_1438 407
56 3300046615 Ga0495656_0034942 Ga0495656_0034942_389_1804 407
57 3300046675 Ga0495657_0007240 Ga0495657_0007240_6575_7981 407
58 3300002773 JGI25152J39213_1006882 JGI25152J39213_10068821 408
59 3300003354 JGI25160J50197_1028769 JGI25160J50197_10287691 408
60 3300005331 Ga0070670_100012940 Ga0070670_1000129404 408
61 3300005355 Ga0070671_100008849 Ga0070671_1000088494 408
62 3300011119 Ga0105246_10049815 Ga0105246_100498151 408
63 3300025258 Ga0209129_1006250 Ga0209129_10062502 408
64 3300025299 Ga0209256_1008822 Ga0209256_10088222 408
65 3300025302 Ga0207426_1002673 Ga0207426_10026733 408
66 3300025931 Ga0207644_10008394 Ga0207644_100083946 408
67 3300048905 Ga0496102_0168746 Ga0496102_0168746_391_1800 408
68 3300048907 Ga0496104_0185514 Ga0496104_0185514_45_1454 408
69 3300048913 Ga0496110_0168719 Ga0496110_0168719_537_1946 408
70 3300048919 Ga0496116_0057163 Ga0496116_0057163_295_1704 408
71 3300048925 Ga0496122_0098794 Ga0496122_0098794_337_1746 408
72 3300048928 Ga0496125_0099017 Ga0496125_0099017_488_1897 408
73 3300053119 Ga0500595_001019 Ga0500595_001019_8970_10322 408
74 3300046616 Ga0495668_0004034 Ga0495668_0004034_6833_8239 410
75 3300046492 Ga0495585_0005260 Ga0495585_0005260_3798_5204 411
76 3300046518 Ga0495631_0000842 Ga0495631_0000842_2503_3909 411
77 3300046519 Ga0495632_0009419 Ga0495632_0009419_3812_5218 411
78 3300046660 Ga0495625_0022217 Ga0495625_0022217_1773_3179 411
79 3300046691 Ga0495670_0034562 Ga0495670_0034562_153_1559 411
80 3300046810 Ga0495660_0018375 Ga0495660_0018375_1788_3194 411
81 3300049459 Ga0495678_016645 Ga0495678_016645_1824_3230 411
82 3300053109 Ga0500569_001928 Ga0500569_001928_483_1889 411
83 3300053118 Ga0500594_0001103 Ga0500594_0001103_2284_3690 411
84 iso_pu_bacteria 2842205361 2842205625 411
85 iso_pu_bacteria 2842278818 2842279082 411
86 3300003187 JGI25151J46595_10000723 JGI25151J46595_1000072312 412
87 3300003215 JGI25153J46596_10025182 JGI25153J46596_100251821 412
88 3300003771 Ga0055526_1013505 Ga0055526_10135052 412
89 3300003790 Ga0055528_1000331 Ga0055528_100033134 412
90 3300003790 Ga0055528_1011072 Ga0055528_10110723 412
91 3300006038 Ga0075365_10000388 Ga0075365_1000038815 412
92 3300006042 Ga0075368_10017008 Ga0075368_100170082 412
93 3300006178 Ga0075367_10001308 Ga0075367_100013086 412
94 3300025245 Ga0207425_1005201 Ga0207425_10052012 412
95 3300025258 Ga0209129_1000784 Ga0209129_100078423 412
96 3300025273 Ga0209673_1000384 Ga0209673_100038412 412
97 3300025273 Ga0209673_1005540 Ga0209673_10055403 412
98 3300025273 Ga0209673_1017471 Ga0209673_10174712 412
99 3300025294 Ga0209025_1000058 Ga0209025_1000058203 412
100 3300025295 Ga0209564_1000388 Ga0209564_100038812 412
101 3300025299 Ga0209256_1001984 Ga0209256_100198412 412
102 3300046474 Ga0495605_0026267 Ga0495605_0026267_1296_2714 412
103 3300046507 Ga0495606_0029656 Ga0495606_0029656_2055_3476 412
104 3300046518 Ga0495631_0017754 Ga0495631_0017754_298_1719 412
105 3300046615 Ga0495656_0062065 Ga0495656_0062065_135_1556 412
106 3300046616 Ga0495668_0071664 Ga0495668_0071664_228_1649 412
107 3300046660 Ga0495625_0089432 Ga0495625_0089432_322_1743 412
108 3300046810 Ga0495660_0018736 Ga0495660_0018736_322_1743 412
109 3300050492 nmdc:mga0yw44_40105_c1 nmdc:mga0yw44_40105_c1_911_2332 412
110 3300050496 nmdc:mga07m45_44158_c1 nmdc:mga07m45_44158_c1_679_2100 412
111 3300053109 Ga0500569_023100 Ga0500569_023100_218_1639 412
112 3300053134 Ga0500658_0000578 Ga0500658_0000578_12051_13472 412
113 3300053153 Ga0500616_0006752 Ga0500616_0006752_1358_2779 412
114 iso_pu_bacteria 2838680041 2838681748 412
115 iso_pu_bacteria 2838694306 2838696320 412
116 iso_pu_bacteria 2838707686 2838710441 412
117 iso_pu_bacteria 2842077413 2842078615 412
118 iso_pu_bacteria 2842118031 2842118876 412
119 iso_pu_bacteria 2842237096 2842239853 412
120 iso_pu_bacteria 2842291075 2842292277 412
121 iso_pu_bacteria 2842370503 2842372315 412
122 iso_pu_bacteria 2842377471 2842378674 412
123 iso_pu_bacteria 2842384541 2842385386 412
124 iso_pu_bacteria 2842434925 2842437439 412
125 3300030500 Ga0268256_1004281 Ga0268256_10042814 413
126 iso_pu_bacteria 2838661181 2838666290 414
127 3300046460 Ga0495638_0000238 Ga0495638_0000238_69919_71322 415
128 3300046522 Ga0495643_0077341 Ga0495643_0077341_238_1641 415
129 3300053139 Ga0500568_0000295 Ga0500568_0000295_11524_12927 415
130 3300053153 Ga0500616_0001084 Ga0500616_0001084_5909_7312 415
131 iso_pu_bacteria 2513237144 2513909852 415
132 iso_pu_bacteria 2513237146 2513926630 415
133 iso_pu_bacteria 2599185170 2599417941 415
134 iso_pu_bacteria 2791355256 2793298705 415
135 iso_pu_bacteria 2791355262 2793338328 415
136 iso_pu_bacteria 2842110456 2842114841 415
137 iso_pu_bacteria 2857516855 2857517576 415
138 iso_pu_bacteria 2537561587 2537874376 416
139 iso_pu_bacteria 2558860983 2561466824 416
140 iso_pu_bacteria 2791355267 2793370326 416
141 iso_pu_bacteria 2838668709 2838674148 416
142 iso_pu_bacteria 2838675328 2838677107 416
143 iso_pu_bacteria 2838701080 2838706606 416
144 iso_pu_bacteria 2838714209 2838715994 416
145 iso_pu_bacteria 2838719591 2838720204 416
146 iso_pu_bacteria 2838724970 2838726747 416
147 iso_pu_bacteria 2841846520 2841847138 416
148 iso_pu_bacteria 2842124991 2842126832 416
149 iso_pu_bacteria 2842130223 2842132000 416
150 iso_pu_bacteria 2842146304 2842151341 416
151 iso_pu_bacteria 2842152218 2842152830 416
152 iso_pu_bacteria 2842170452 2842172239 416
153 iso_pu_bacteria 2842175837 2842176449 416
154 iso_pu_bacteria 2842187318 2842189103 416
155 iso_pu_bacteria 2842211629 2842213416 416
156 iso_pu_bacteria 2842224351 2842224966 416
157 iso_pu_bacteria 2842250916 2842256342 416
158 iso_pu_bacteria 2842285085 2842285748 416
159 iso_pu_bacteria 2842402390 2842403107 416
160 iso_pu_bacteria 2842409023 2842409520 416
161 iso_pu_bacteria 2842415677 2842416172 416
162 iso_pu_bacteria 2926754445 2926757152 416
163 iso_pu_bacteria 2933006813 2933007475 416
164 iso_pu_bacteria 2509276033 2509445839 417
165 iso_pu_bacteria 2509276033 2509446857 417
166 iso_pu_bacteria 2524023209 2524457518 417
167 iso_pu_bacteria 2615840698 2616553413 417
168 iso_pu_bacteria 2667528174 2671112374 417
169 iso_pu_bacteria 2765235942 2766065730 417
170 iso_pu_bacteria 2775507266 2778177877 417
171 iso_pu_bacteria 2791355082 2792582886 417
172 iso_pu_bacteria 2791355259 2793314676 417
173 iso_pu_bacteria 2818991448 2819608404 417
174 iso_pu_bacteria 2838029111 2838029286 417
175 iso_pu_bacteria 2842298080 2842300868 417
176 iso_pu_bacteria 2842357229 2842358012 417
177 iso_pu_bacteria 2842475841 2842476284 417
178 iso_pu_bacteria 2842502639 2842502814 417
179 iso_pu_bacteria 2842509118 2842509207 417
180 iso_pu_bacteria 2919408235 2919408806 417
181 iso_pu_bacteria 2933586486 2933591213 417
182 iso_pu_bacteria 2936381700 2936383032 417
183 iso_pu_bacteria 8005376324 8005380786 417
184 iso_pu_bacteria 8005382845 8005385354 417
185 iso_pu_bacteria 8005645114 8005650149 417
186 iso_pu_bacteria 8005682033 8005685111 417
187 iso_pu_bacteria 8049293176 8049293509 417
188 3300009765 Ga0123341_1000576 Ga0123341_100057625 418
189 3300009766 Ga0123342_1023427 Ga0123342_10234273 418
190 iso_pu_bacteria 2509276021 2509392193 418
191 iso_pu_bacteria 2510065019 2510133808 418
192 iso_pu_bacteria 2510461076 2510895237 418
193 iso_pu_bacteria 2513237084 2513574152 418
194 iso_pu_bacteria 2513237085 2513576812 418
195 iso_pu_bacteria 2513237093 2513629540 418
196 iso_pu_bacteria 2513237103 2513708182 418
197 iso_pu_bacteria 2513237162 2514020143 418
198 iso_pu_bacteria 2515075009 2515112853 418
199 iso_pu_bacteria 2515154113 2515636459 418
200 iso_pu_bacteria 2515154114 2515640825 418
201 iso_pu_bacteria 2515154116 2515655491 418
202 iso_pu_bacteria 2515154134 2515739350 418
203 iso_pu_bacteria 2516653077 2517036561 418
204 iso_pu_bacteria 2516653085 2517076931 418
205 iso_pu_bacteria 2517093000 2517095693 418
206 iso_pu_bacteria 2517287029 2517407254 418
207 iso_pu_bacteria 2529292951 2530646150 418
208 iso_pu_bacteria 2585427526 2585527308 418
209 iso_pu_bacteria 2585427528 2585538046 418
210 iso_pu_bacteria 2585427593 2585835994 418
211 iso_pu_bacteria 2615840624 2616293512 418
212 iso_pu_bacteria 2718217927 2719386196 418
213 iso_pu_bacteria 2718217997 2719666005 418
214 iso_pu_bacteria 2718218199 2720492425 418
215 iso_pu_bacteria 2718218232 2720613780 418
216 iso_pu_bacteria 2718218233 2720620568 418
217 iso_pu_bacteria 2718218235 2720631993 418
218 iso_pu_bacteria 2718218269 2720775721 418
219 iso_pu_bacteria 2718218423 2721399978 418
220 iso_pu_bacteria 2721755556 2723027328 418
221 iso_pu_bacteria 2721755684 2723560947 418
222 iso_pu_bacteria 2721755685 2723567540 418
223 iso_pu_bacteria 2721755809 2724038791 418
224 iso_pu_bacteria 2721755819 2724090328 418
225 iso_pu_bacteria 2721755822 2724104805 418
226 iso_pu_bacteria 2721755823 2724110607 418
227 iso_pu_bacteria 2724679232 2725952700 418
228 iso_pu_bacteria 2728369352 2730108264 418
229 iso_pu_bacteria 2738541333 2739032703 418
230 iso_pu_bacteria 2791355261 2793330448 418
231 iso_pu_bacteria 2802429605 2805930995 418
232 iso_pu_bacteria 2802429606 2805937991 418
233 iso_pu_bacteria 2802429633 2806043683 418
234 iso_pu_bacteria 2802429634 2806050385 418
235 iso_pu_bacteria 2802429635 2806057202 418
236 iso_pu_bacteria 2802429636 2806064584 418
237 iso_pu_bacteria 2802429637 2806071851 418
238 iso_pu_bacteria 2838016132 2838017807 418
239 iso_pu_bacteria 2838042994 2838043832 418
240 iso_pu_bacteria 2838048938 2838051902 418
241 iso_pu_bacteria 2838061910 2838068322 418
242 iso_pu_bacteria 2838068647 2838070296 418
243 iso_pu_bacteria 2838686498 2838687189 418
244 iso_pu_bacteria 2838729681 2838729839 418
245 iso_pu_bacteria 2838742623 2838743146 418
246 iso_pu_bacteria 2841851746 2841852632 418
247 iso_pu_bacteria 2841864319 2841869934 418
248 iso_pu_bacteria 2842156927 2842157908 418
249 iso_pu_bacteria 2842163707 2842167544 418
250 iso_pu_bacteria 2842180545 2842181527 418
251 iso_pu_bacteria 2842192696 2842198411 418
252 iso_pu_bacteria 2842217011 2842217791 418
253 iso_pu_bacteria 2842229732 2842230422 418
254 iso_pu_bacteria 2842243621 2842244324 418
255 iso_pu_bacteria 2842257432 2842257590 418
256 iso_pu_bacteria 2842264693 2842266111 418
257 iso_pu_bacteria 2842271015 2842271273 418
258 iso_pu_bacteria 2842304105 2842304901 418
259 iso_pu_bacteria 2842311132 2842315062 418
260 iso_pu_bacteria 2842317721 2842320562 418
261 iso_pu_bacteria 2842341865 2842346319 418
262 iso_pu_bacteria 2842363717 2842369101 418
263 iso_pu_bacteria 2842395702 2842400030 418
264 iso_pu_bacteria 2842422224 2842423910 418
265 iso_pu_bacteria 2842428310 2842430574 418
266 iso_pu_bacteria 2842441272 2842443809 418
267 iso_pu_bacteria 2842447887 2842454465 418
268 iso_pu_bacteria 2842462802 2842464717 418
269 iso_pu_bacteria 2842469257 2842472057 418
270 iso_pu_bacteria 2842489311 2842490434 418
271 iso_pu_bacteria 2842495871 2842496974 418
272 iso_pu_bacteria 2844454524 2844458555 418
273 iso_pu_bacteria 2933570622 2933570709 418
274 iso_pu_bacteria 2933599457 2933601101 418
275 iso_pu_bacteria 2935901341 2935902093 418
276 iso_pu_bacteria 2936367885 2936372184 418
277 iso_pu_bacteria 2936375103 2936381013 418
278 iso_pu_bacteria 2996893221 2996896494 418
279 iso_pu_bacteria 3005416602 3005417066 418
280 iso_pu_bacteria 639633055 639649057 418
281 iso_pu_bacteria 8005275841 8005280986 418
282 iso_pu_bacteria 8005282627 8005283411 418
283 iso_pu_bacteria 8005301065 8005302968 418
284 iso_pu_bacteria 8005307578 8005312695 418
285 iso_pu_bacteria 8005314921 8005315127 418
286 iso_pu_bacteria 8005395548 8005396273 418
287 iso_pu_bacteria 8005430974 8005435000 418
288 iso_pu_bacteria 8005460587 8005463528 418
289 iso_pu_bacteria 8005497431 8005500741 418
290 iso_pu_bacteria 8005556819 8005557156 418
291 iso_pu_bacteria 8005563573 8005567848 418
292 iso_pu_bacteria 8005570704 8005573606 418
293 iso_pu_bacteria 8005619151 8005622114 418
294 iso_pu_bacteria 8005626139 8005632403 418
295 iso_pu_bacteria 8005668836 8005672159 418
296 iso_pu_bacteria 8005688590 8005692263 418
297 iso_pu_bacteria 8005695170 8005697248 418
298 iso_pu_bacteria 8018127388 8018133934 418
299 iso_pu_bacteria 8018163183 8018166236 418
300 iso_pu_bacteria 8018176218 8018181466 418
301 iso_pu_bacteria 8023680758 8023683307 418
302 iso_pu_bacteria 8024479707 8024483009 418
303 iso_pu_bacteria 8024501048 8024503924 418
304 iso_pu_bacteria 8056375014 8056378372 418
305 iso_pu_bacteria 8056382006 8056386579 418
306 iso_pu_bacteria 8057874678 8057877383 418
307 3300003792 Ga0055540_1000508 Ga0055540_100050826 419
308 3300025298 Ga0209050_1034018 Ga0209050_10340181 419
309 3300025303 Ga0209051_1002798 Ga0209051_100279812 419
310 3300025304 Ga0209257_1001598 Ga0209257_100159812 419
311 3300041492 Ga0451835_0278968 Ga0451835_0278968_1265_2686 419
312 3300041512 Ga0451853_0856197 Ga0451853_0856197_595_2016 419
313 iso_pu_bacteria 2515154107 2515610846 419
314 iso_pu_bacteria 2516143018 2516206436 419
315 iso_pu_bacteria 2582581299 2585231561 419
316 iso_pu_bacteria 2599185352 2600197659 419
317 iso_pu_bacteria 2643221557 2643809250 419
318 iso_pu_bacteria 2643221582 2643918110 419
319 iso_pu_bacteria 2643221610 2644064348 419
320 iso_pu_bacteria 2643221618 2644104132 419
321 iso_pu_bacteria 2643221626 2644149500 419
322 iso_pu_bacteria 2643221653 2644300879 419
323 iso_pu_bacteria 2643221655 2644307005 419
324 iso_pu_bacteria 2643221659 2644331490 419
325 iso_pu_bacteria 2643221668 2644378844 419
326 iso_pu_bacteria 2643221675 2644416180 419
327 iso_pu_bacteria 2643221680 2644449220 419
328 iso_pu_bacteria 2643221698 2644540344 419
329 iso_pu_bacteria 2643221712 2644619244 419
330 iso_pu_bacteria 2643221719 2644659099 419
331 iso_pu_bacteria 2643221723 2644672159 419
332 iso_pu_bacteria 2643221726 2644688444 419
333 iso_pu_bacteria 2751185821 2753461214 419
334 iso_pu_bacteria 2791355263 2793339068 419
335 iso_pu_bacteria 2791355266 2793363852 419
336 iso_pu_bacteria 2802428861 2802740269 419
337 iso_pu_bacteria 2842341865 2842342192 419
338 iso_pu_bacteria 2844163670 2844170825 419
339 iso_pu_bacteria 2848992105 2848997894 419
340 iso_pu_bacteria 2855872281 2855873858 419
341 iso_pu_bacteria 2915980308 2915982777 419
342 iso_pu_bacteria 2920822456 2920828266 419
343 iso_pu_bacteria 2935894831 2935900675 419
344 iso_pu_bacteria 2936996657 2937002188 419
345 iso_pu_bacteria 2941499720 2941502451 419
346 iso_pu_bacteria 2960680706 2960683268 419
347 iso_pu_bacteria 2967686174 2967690136 419
348 iso_pu_bacteria 2970143518 2970146276 419
349 iso_pu_bacteria 2977544691 2977545632 419
350 iso_pu_bacteria 8005484373 8005484954 419
351 3300002704 JGI25155J39150_1000023 JGI25155J39150_100002354 420
352 3300002705 JGI25156J39149_1000029 JGI25156J39149_100002989 420
353 3300002737 JGI25162J39368_1000557 JGI25162J39368_10005574 420
354 3300002738 JGI25154J39366_1000067 JGI25154J39366_100006754 420
355 3300002741 JGI25157J39369_1000043 JGI25157J39369_100004373 420
356 3300002987 JGI25159J45721_1001319 JGI25159J45721_10013198 420
357 3300003214 JGI25165J46597_1000341 JGI25165J46597_100034132 420
358 3300003354 JGI25160J50197_1000028 JGI25160J50197_10000286 420
359 3300003374 JGI25161J50226_1002397 JGI25161J50226_10023973 420
360 3300003771 Ga0055526_1001901 Ga0055526_10019018 420
361 3300003775 Ga0055524_1001114 Ga0055524_10011147 420
362 3300003781 Ga0055536_1001126 Ga0055536_100112614 420
363 3300003791 Ga0055530_10002417 Ga0055530_1000241710 420
364 3300003794 Ga0055531_10005396 Ga0055531_100053966 420
365 3300004625 Ga0055543_1001955 Ga0055543_10019555 420
366 3300005262 Ga0065165_1000061 Ga0065165_10000616 420
367 3300013249 Ga0171463_1005 Ga0171463_100573 420
368 3300025206 Ga0209435_100011 Ga0209435_100011321 420
369 3300025208 Ga0209436_102200 Ga0209436_1022007 420
370 3300025233 Ga0209437_100036 Ga0209437_10003634 420
371 3300025246 Ga0209646_1000024 Ga0209646_100002489 420
372 3300025246 Ga0209646_1004323 Ga0209646_10043232 420
373 3300025250 Ga0209026_1000030 Ga0209026_100003089 420
374 3300025256 Ga0209759_1000011 Ga0209759_1000011321 420
375 3300025261 Ga0209233_1000166 Ga0209233_100016634 420
376 3300025284 Ga0209130_1000068 Ga0209130_1000068165 420
377 3300025292 Ga0209676_1000714 Ga0209676_100071441 420
378 3300025294 Ga0209025_1000203 Ga0209025_1000203128 420
379 3300025295 Ga0209564_1000081 Ga0209564_100008133 420
380 3300025298 Ga0209050_1007972 Ga0209050_10079726 420
381 3300025299 Ga0209256_1000408 Ga0209256_10004086 420
382 3300025299 Ga0209256_1002018 Ga0209256_10020186 420
383 3300025302 Ga0207426_1000155 Ga0207426_1000155165 420
384 3300025303 Ga0209051_1003025 Ga0209051_10030252 420
385 3300031911 Ga0307412_10014910 Ga0307412_100149106 420
386 3300033430 Ga0315913_1025489 Ga0315913_10254892 420
387 3300046506 Ga0495583_0014281 Ga0495583_0014281_1027_2433 420
388 3300048922 Ga0496119_0016632 Ga0496119_0016632_572_1975 420
389 3300048926 Ga0496123_0018717 Ga0496123_0018717_1761_3164 420
390 iso_pu_bacteria 2509276019 2509377436 420
391 iso_pu_bacteria 2512875026 2512969079 420
392 iso_pu_bacteria 2513237088 2513598865 420
393 iso_pu_bacteria 2513237089 2513605601 420
394 iso_pu_bacteria 2513237156 2513986273 420
395 iso_pu_bacteria 2513237160 2514007743 420
396 iso_pu_bacteria 2517487022 2517566180 420
397 iso_pu_bacteria 2558860100 2558864969 420
398 iso_pu_bacteria 2765235802 2765467937 420
399 iso_pu_bacteria 2802428858 2802720713 420
400 iso_pu_bacteria 2802428859 2802727902 420
401 iso_pu_bacteria 2802428860 2802733055 420
402 iso_pu_bacteria 2802428862 2802746224 420
403 iso_pu_bacteria 2802428863 2802753500 420
404 iso_pu_bacteria 2850079185 2850084688 420
405 iso_pu_bacteria 2916061851 2916064572 420
406 iso_pu_bacteria 2921250672 2921253151 420
407 iso_pu_bacteria 2937029754 2937032829 420
408 iso_pu_bacteria 2937036028 2937038089 420
409 iso_pu_bacteria 2937078374 2937081161 420
410 iso_pu_bacteria 2937084907 2937088920 420
411 iso_pu_bacteria 2957375807 2957377333 420
412 iso_pu_bacteria 2957437181 2957438214 420
413 iso_pu_bacteria 2960591022 2960593873 420
414 iso_pu_bacteria 2960631154 2960634125 420
415 iso_pu_bacteria 2960693952 2960700361 420
416 iso_pu_bacteria 2967728569 2967729980 420
417 iso_pu_bacteria 2970026789 2970027055 420
418 iso_pu_bacteria 2970122695 2970124055 420
419 iso_pu_bacteria 2977530762 2977535545 420
420 iso_pu_bacteria 2996887358 2996890076 420
421 iso_pu_bacteria 8003999396 8004004636 420
422 iso_pu_bacteria 8005258706 8005262203 420
423 iso_pu_bacteria 8005321885 8005324603 420
424 3300009553 Ga0105249_10033981 Ga0105249_100339811 421
425 3300021321 Ga0214542_1014550 Ga0214542_10145504 421
426 3300021327 Ga0214543_1000012 Ga0214543_100001217 421
427 3300022739 Ga0228711_1005729 Ga0228711_100572915 421
428 3300025294 Ga0209025_1011702 Ga0209025_10117028 421
429 3300025297 Ga0209758_1012740 Ga0209758_10127404 421
430 3300027666 Ga0209282_1000038 Ga0209282_100003879 421
431 3300031967 Ga0315914_1000204 Ga0315914_100020415 421
432 3300032004 Ga0307414_10124281 Ga0307414_101242812 421
433 3300033430 Ga0315913_1003513 Ga0315913_10035136 421
434 3300033464 Ga0315915_1000018 Ga0315915_100001879 421
435 3300046460 Ga0495638_0000187 Ga0495638_0000187_36891_38282 421
436 3300046491 Ga0495584_0008614 Ga0495584_0008614_3256_4659 421
437 3300046522 Ga0495643_0000943 Ga0495643_0000943_17709_19112 421
438 3300046528 Ga0495642_0002900 Ga0495642_0002900_4208_5611 421
439 3300047445 Ga0495677_0003334 Ga0495677_0003334_4142_5545 421
440 iso_pu_bacteria 2508501122 2509110617 421
441 iso_pu_bacteria 2524023207 2524453381 421
442 iso_pu_bacteria 2534681796 2535519615 421
443 iso_pu_bacteria 2582581294 2585204843 421
444 iso_pu_bacteria 2690316117 2692317735 421
445 iso_pu_bacteria 2847417321 2847421884 421
446 iso_pu_bacteria 2919119836 2919122511 421
447 iso_pu_bacteria 2920760137 2920764626 421
448 iso_pu_bacteria 8005542996 8005547314 421
449 iso_pu_bacteria 8024486573 8024488388 421
450 3300025303 Ga0209051_1008262 Ga0209051_10082622 422
451 3300028794 Ga0307515_10008152 Ga0307515_1000815211 422
452 3300028794 Ga0307515_10022006 Ga0307515_100220065 422
453 3300031901 Ga0307406_10027459 Ga0307406_100274592 422
454 3300031911 Ga0307412_10004424 Ga0307412_100044244 422
455 3300031911 Ga0307412_10007983 Ga0307412_100079832 422
456 3300053133 Ga0500655_002689 Ga0500655_002689_1588_2988 422
457 3300046492 Ga0495585_0001756 Ga0495585_0001756_5125_6525 423
458 3300046691 Ga0495670_0000012 Ga0495670_0000012_158637_160034 423
459 3300047445 Ga0495677_0006155 Ga0495677_0006155_999_2396 423
460 3300053087 Ga0500643_000511 Ga0500643_000511_7667_9064 423
461 3300003215 JGI25153J46596_10000070 JGI25153J46596_1000007038 424
462 3300005327 Ga0070658_10010242 Ga0070658_100102427 424
463 3300005842 Ga0068858_100005317 Ga0068858_1000053172 424
464 3300009098 Ga0105245_10028520 Ga0105245_100285206 424
465 3300025297 Ga0209758_1000023 Ga0209758_1000023415 424
466 3300025909 Ga0207705_10006153 Ga0207705_100061535 424
467 3300025927 Ga0207687_10007954 Ga0207687_100079541 424
468 3300025935 Ga0207709_10041409 Ga0207709_100414093 424
469 3300026035 Ga0207703_10079957 Ga0207703_100799572 424
470 3300046506 Ga0495583_0000219 Ga0495583_0000219_66425_67825 424
471 3300046660 Ga0495625_0022496 Ga0495625_0022496_3296_4699 424
472 3300046684 Ga0495669_0000155 Ga0495669_0000155_13111_14514 424
473 3300046809 Ga0495600_0005871 Ga0495600_0005871_1137_2537 424
474 3300047443 Ga0495687_000109 Ga0495687_000109_121405_122808 424
475 3300053079 Ga0500610_0000144 Ga0500610_0000144_538_1941 424
476 3300053154 Ga0500619_005287 Ga0500619_005287_772_2172 424
477 3300053730 Ga0500645_000001 Ga0500645_000001_330264_331667 424
478 3300001979 JGI24740J21852_10005459 JGI24740J21852_100054596 425
479 3300001979 JGI24740J21852_10006077 JGI24740J21852_100060773 425
480 3300003759 Ga0055525_1000203 Ga0055525_100020334 425
481 3300003762 Ga0055542_1000040 Ga0055542_1000040130 425
482 3300003763 Ga0055529_1000037 Ga0055529_100003791 425
483 3300005262 Ga0065165_1000895 Ga0065165_100089523 425
484 3300005327 Ga0070658_10009134 Ga0070658_100091345 425
485 3300005344 Ga0070661_100095943 Ga0070661_1000959432 425
486 3300005347 Ga0070668_100075207 Ga0070668_1000752072 425
487 3300005355 Ga0070671_100048141 Ga0070671_1000481412 425
488 3300005456 Ga0070678_100000523 Ga0070678_10000052318 425
489 3300005539 Ga0068853_100010925 Ga0068853_1000109256 425
490 3300005563 Ga0068855_100032745 Ga0068855_1000327456 425
491 3300005577 Ga0068857_100015947 Ga0068857_1000159476 425
492 3300005578 Ga0068854_100012559 Ga0068854_1000125593 425
493 3300005614 Ga0068856_100036527 Ga0068856_1000365276 425
494 3300005616 Ga0068852_100013483 Ga0068852_1000134836 425
495 3300005841 Ga0068863_100001872 Ga0068863_10000187216 425
496 3300005843 Ga0068860_100000256 Ga0068860_10000025613 425
497 3300009148 Ga0105243_10000913 Ga0105243_100009138 425
498 3300009545 Ga0105237_10027746 Ga0105237_100277465 425
499 3300010375 Ga0105239_10040102 Ga0105239_100401025 425
500 3300013100 Ga0157373_10022841 Ga0157373_100228413 425
501 3300013104 Ga0157370_10023193 Ga0157370_100231935 425
502 3300025230 Ga0209563_100147 Ga0209563_10014735 425
503 3300025254 Ga0209148_1000011 Ga0209148_10000111027 425
504 3300025272 Ga0209455_1000006 Ga0209455_1000006165 425
505 3300025904 Ga0207647_10001658 Ga0207647_100016586 425
506 3300025909 Ga0207705_10003962 Ga0207705_100039628 425
507 3300025914 Ga0207671_10014109 Ga0207671_100141095 425
508 3300025920 Ga0207649_10067559 Ga0207649_100675592 425
509 3300025931 Ga0207644_10023076 Ga0207644_100230763 425
510 3300025931 Ga0207644_10044456 Ga0207644_100444563 425
511 3300025935 Ga0207709_10000039 Ga0207709_10000039168 425
512 3300025937 Ga0207669_10000117 Ga0207669_1000011719 425
513 3300025937 Ga0207669_10000809 Ga0207669_100008096 425
514 3300025949 Ga0207667_10000002 Ga0207667_10000002881 425
515 3300025986 Ga0207658_10000075 Ga0207658_10000075101 425
516 3300026041 Ga0207639_10002462 Ga0207639_1000246212 425
517 3300026078 Ga0207702_10015393 Ga0207702_100153935 425
518 3300026116 Ga0207674_10009458 Ga0207674_100094585 425
519 3300026121 Ga0207683_10000751 Ga0207683_1000075110 425
520 3300026142 Ga0207698_10010061 Ga0207698_100100615 425
521 3300028381 Ga0268264_10000087 Ga0268264_10000087186 425
522 3300031616 Ga0307508_10001675 Ga0307508_1000167515 425
523 3300046492 Ga0495585_0033462 Ga0495585_0033462_1442_2845 425
524 3300046500 Ga0495596_0011156 Ga0495596_0011156_635_2038 425
525 3300046506 Ga0495583_0010407 Ga0495583_0010407_3819_5222 425
526 3300046507 Ga0495606_0000092 Ga0495606_0000092_105410_106813 425
527 3300046522 Ga0495643_0004068 Ga0495643_0004068_1543_2946 425
528 3300046522 Ga0495643_0014657 Ga0495643_0014657_2348_3751 425
529 3300046524 Ga0495648_0000146 Ga0495648_0000146_69874_71277 425
530 3300046525 Ga0495663_0002107 Ga0495663_0002107_4368_5771 425
531 3300046558 Ga0495633_0001313 Ga0495633_0001313_11478_12881 425
532 3300046616 Ga0495668_0000056 Ga0495668_0000056_153968_155371 425
533 3300046648 Ga0495611_0053968 Ga0495611_0053968_400_1803 425
534 3300046660 Ga0495625_0021830 Ga0495625_0021830_1411_2814 425
535 3300047323 Ga0495683_0017026 Ga0495683_0017026_1592_2995 425
536 3300047443 Ga0495687_000353 Ga0495687_000353_17068_18471 425
537 3300047470 Ga0495681_0003604 Ga0495681_0003604_8407_9810 425
538 3300048905 Ga0496102_0000163 Ga0496102_0000163_51767_53170 425
539 3300048906 Ga0496103_0000052 Ga0496103_0000052_120166_121569 425
540 3300048907 Ga0496104_0150308 Ga0496104_0150308_78_1487 425
541 3300048908 Ga0496105_0001251 Ga0496105_0001251_6307_7710 425
542 3300048908 Ga0496105_0033787 Ga0496105_0033787_883_2292 425
543 3300048913 Ga0496110_0043775 Ga0496110_0043775_769_2172 425
544 3300048917 Ga0496114_0012274 Ga0496114_0012274_1603_3006 425
545 3300048918 Ga0496115_0000078 Ga0496115_0000078_36537_37940 425
546 3300048919 Ga0496116_0003807 Ga0496116_0003807_9999_11402 425
547 3300048920 Ga0496117_0000141 Ga0496117_0000141_36472_37875 425
548 3300048921 Ga0496118_0000103 Ga0496118_0000103_36530_37933 425
549 3300048922 Ga0496119_0005128 Ga0496119_0005128_303_1706 425
550 3300048924 Ga0496121_0000156 Ga0496121_0000156_120148_121551 425
551 3300048925 Ga0496122_0002015 Ga0496122_0002015_7147_8550 425
552 3300048927 Ga0496124_0000041 Ga0496124_0000041_122039_123442 425
553 3300048928 Ga0496125_0000238 Ga0496125_0000238_41300_42703 425
554 3300048929 Ga0496126_0000155 Ga0496126_0000155_36524_37927 425
555 3300053130 Ga0500642_0000178 Ga0500642_0000178_9431_10834 425
556 3300053157 Ga0500624_000034 Ga0500624_000034_21303_22715 425
557 3300053178 Ga0500637_0000108 Ga0500637_0000108_21296_22708 425

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

29

194

0.97

PF02417

Chromate_transp

Chromate transporter

269

466

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8do0-assembly1.cif.gz_A cryo-em structure of the human sec61 complex inhibited by mycolactone 0.2259 219 403
5zih-assembly1.cif.gz_A crystal structure of the red light-activated channelrhodopsin chrimson. 0.2101 224 377
5och-assembly4.cif.gz_G the crystal structure of human abcb8 in an outward-facing state 0.1966 20 371
7rmg-assembly1.cif.gz_R substance p bound to active human neurokinin 1 receptor in complex with minigs/q70 0.1956 220 424
4lzc-assembly1.cif.gz_A w325f epi-isozizaene synthase: complex with mg, inorganic pyrophosphate 0.1841 27 360
ID Description Score Start End Superfamily
af_Q9T007_44_253_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.3715 229 347 1.20.1410.10
af_Q9FFW0_21_191_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3591 231 339 1.20.140.40
af_Q9CZR4_36_162_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3284 232 344 1.20.140.150
af_Q02774_1_210_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3261 229 349 1.20.1250.20
af_I1N7G8_11_135_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3143 231 343 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A3Q8S6W9-F1-model_v4 Chromate transporter 0.8291 20 187 GO:0005886
GO:0015109
AF-A0A529HL73-F1-model_v4 Chromate transporter 0.8246 1 120 GO:0005886
GO:0015109
AF-A0A1H4R8G3-F1-model_v4 Chromate transporter 0.8198 20 193 GO:0005886
GO:0015109
AF-A0A6I7NH68-F1-model_v4 Chromate transporter 0.8047 19 187 GO:0005886
GO:0015109
AF-A0A4P9YHB7-F1-model_v4 Cytochrome P450 0.794 18 190 GO:0004497
GO:0005506
GO:0005886
GO:0015109
GO:0016705
GO:0020037

Feature Viewer

pLDDT pTM Quality
73.81 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map