F463290
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 557 | 225 | 556 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100000367|Ga0068853_10000036720 |
| Length | 244 |
| Sequence | MQGFFAALRMTGFIFDAGDDMLIPSIDLMGGRIVQLVQGEKLKLAFDDFEYWIERFQKYPVVQLIDLDAAMRQGDNRALIEMFCKRLPCQVGGGLRSAADGRALLAAGAKRVIFGSSLFGAAGVNKEFAAGLKKELGEEALVFSVDTKGGKVAVKGWKDSVDLTPEEAVTWLEDYCSAFLYTHVDTEGTMSGFPMDVAAVLRSTTAKQLIVAGGIKERAEVDALDAMGVDAVAGMAVYSGAMEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 67 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 114 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 120 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 121 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 128 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 129 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 130 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 131 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 194 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 195 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 196 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 203 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 204 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 224 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 225 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0.36 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.08 |
| Nodule | 0 |
| Rhizoplane | 2.69 |
| Rhizosphere | 94.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1005829 | 3300000546 | Bacteria | 1341 |
| 2 | rootH2_10009426 | 3300003320 | Bacteria | 39179 |
| 3 | rootH1_10212810 | 3300003323 | Bacteria | 1299 |
| 4 | Ga0070658_10000121 | 3300005327 | Bacteria | 70439 |
| 5 | Ga0070658_10016394 | 3300005327 | Bacteria | 5929 |
| 6 | Ga0070658_10024939 | 3300005327 | Bacteria | 4795 |
| 7 | Ga0070658_10079725 | 3300005327 | Bacteria | 2689 |
| 8 | Ga0070658_10237104 | 3300005327 | Unclassified | 1546 |
| 9 | Ga0070658_10251170 | 3300005327 | Bacteria | 1500 |
| 10 | Ga0070658_10345814 | 3300005327 | Bacteria | 1272 |
| 11 | Ga0070683_100002041 | 3300005329 | Bacteria | 15901 |
| 12 | Ga0070683_100019183 | 3300005329 | Bacteria | 6072 |
| 13 | Ga0070683_100045076 | 3300005329 | Bacteria | 4071 |
| 14 | Ga0070683_100060569 | 3300005329 | Bacteria | 3518 |
| 15 | Ga0070683_100397430 | 3300005329 | Bacteria | 1314 |
| 16 | Ga0070670_100348337 | 3300005331 | Unclassified | 1301 |
| 17 | Ga0068869_100001577 | 3300005334 | Bacteria | 13554 |
| 18 | Ga0070682_100088991 | 3300005337 | Bacteria | 2016 |
| 19 | Ga0068868_100000066 | 3300005338 | Bacteria | 59945 |
| 20 | Ga0070660_100029979 | 3300005339 | Bacteria | 4079 |
| 21 | Ga0070660_100080584 | 3300005339 | Bacteria | 2555 |
| 22 | Ga0070660_100153157 | 3300005339 | Bacteria | 1854 |
| 23 | Ga0070661_100026342 | 3300005344 | Bacteria | 4182 |
| 24 | Ga0070661_100035316 | 3300005344 | Unclassified | 3630 |
| 25 | Ga0070661_100078552 | 3300005344 | Bacteria | 2434 |
| 26 | Ga0070661_100240572 | 3300005344 | Bacteria | 1394 |
| 27 | Ga0070671_100007733 | 3300005355 | Bacteria | 8586 |
| 28 | Ga0070671_100019026 | 3300005355 | Bacteria | 5586 |
| 29 | Ga0070671_100198513 | 3300005355 | Bacteria | 1701 |
| 30 | Ga0070671_100474754 | 3300005355 | Bacteria | 1074 |
| 31 | Ga0070659_100039546 | 3300005366 | Bacteria | 3682 |
| 32 | Ga0070659_100125529 | 3300005366 | Bacteria | 2082 |
| 33 | Ga0070667_100046288 | 3300005367 | Bacteria | 3659 |
| 34 | Ga0070714_100002654 | 3300005435 | Bacteria | 13178 |
| 35 | Ga0070714_100243936 | 3300005435 | Bacteria | 1659 |
| 36 | Ga0070713_100140660 | 3300005436 | Bacteria | 2138 |
| 37 | Ga0070713_100202201 | 3300005436 | Bacteria | 1794 |
| 38 | Ga0070713_100262209 | 3300005436 | Bacteria | 1579 |
| 39 | Ga0070663_100088869 | 3300005455 | Unclassified | 2285 |
| 40 | Ga0070681_10178163 | 3300005458 | Bacteria | 2047 |
| 41 | Ga0070679_100083871 | 3300005530 | Bacteria | 3175 |
| 42 | Ga0070679_100092454 | 3300005530 | Bacteria | 3012 |
| 43 | Ga0070679_100106995 | 3300005530 | Bacteria | 2782 |
| 44 | Ga0070679_100754701 | 3300005530 | Bacteria | 916 |
| 45 | Ga0070684_100043733 | 3300005535 | Bacteria | 3870 |
| 46 | Ga0070684_100117871 | 3300005535 | Bacteria | 2386 |
| 47 | Ga0070684_100294775 | 3300005535 | Bacteria | 1488 |
| 48 | Ga0070684_100378336 | 3300005535 | Bacteria | 1304 |
| 49 | Ga0068853_100000222 | 3300005539 | Bacteria | 40206 |
| 50 | Ga0068853_100000367 | 3300005539 | Bacteria | 31060 |
| 51 | Ga0068853_100067118 | 3300005539 | Bacteria | 3116 |
| 52 | Ga0068853_100107800 | 3300005539 | Bacteria | 2470 |
| 53 | Ga0068853_100115336 | 3300005539 | Unclassified | 2390 |
| 54 | Ga0068853_100429508 | 3300005539 | Bacteria | 1240 |
| 55 | Ga0068853_100449619 | 3300005539 | Unclassified | 1212 |
| 56 | Ga0070665_100005637 | 3300005548 | Bacteria | 12872 |
| 57 | Ga0070665_100035648 | 3300005548 | Bacteria | 5003 |
| 58 | Ga0070665_100303206 | 3300005548 | Bacteria | 1600 |
| 59 | Ga0068855_100000277 | 3300005563 | Bacteria | 63213 |
| 60 | Ga0068855_100002688 | 3300005563 | Bacteria | 21925 |
| 61 | Ga0068855_100010384 | 3300005563 | Bacteria | 11233 |
| 62 | Ga0068855_100011915 | 3300005563 | Bacteria | 10511 |
| 63 | Ga0068855_100035334 | 3300005563 | Bacteria | 5953 |
| 64 | Ga0068855_100052910 | 3300005563 | Bacteria | 4778 |
| 65 | Ga0068855_100060121 | 3300005563 | Bacteria | 4444 |
| 66 | Ga0068855_100110833 | 3300005563 | Bacteria | 3150 |
| 67 | Ga0068855_100127193 | 3300005563 | Bacteria | 2912 |
| 68 | Ga0068855_100187371 | 3300005563 | Bacteria | 2336 |
| 69 | Ga0068855_100264509 | 3300005563 | Bacteria | 1915 |
| 70 | Ga0070664_100058239 | 3300005564 | Bacteria | 3286 |
| 71 | Ga0068857_100003191 | 3300005577 | Bacteria | 13595 |
| 72 | Ga0068857_100048791 | 3300005577 | Bacteria | 3757 |
| 73 | Ga0068857_100114600 | 3300005577 | Unclassified | 2424 |
| 74 | Ga0068854_100000019 | 3300005578 | Bacteria | 134145 |
| 75 | Ga0068854_100130839 | 3300005578 | Unclassified | 1916 |
| 76 | Ga0068854_100437872 | 3300005578 | Bacteria | 1089 |
| 77 | Ga0068856_100003529 | 3300005614 | Bacteria | 15773 |
| 78 | Ga0068856_100041779 | 3300005614 | Bacteria | 4508 |
| 79 | Ga0068856_100062110 | 3300005614 | Bacteria | 3690 |
| 80 | Ga0068856_100730844 | 3300005614 | Bacteria | 1010 |
| 81 | Ga0068852_100000019 | 3300005616 | Bacteria | 129021 |
| 82 | Ga0068852_100000097 | 3300005616 | Bacteria | 59430 |
| 83 | Ga0068852_100032008 | 3300005616 | Unclassified | 4349 |
| 84 | Ga0068852_100068135 | 3300005616 | Bacteria | 3113 |
| 85 | Ga0068852_100259189 | 3300005616 | Bacteria | 1669 |
| 86 | Ga0068852_100264972 | 3300005616 | Bacteria | 1651 |
| 87 | Ga0068852_100286115 | 3300005616 | Bacteria | 1591 |
| 88 | Ga0068864_100000625 | 3300005618 | Bacteria | 29830 |
| 89 | Ga0068864_100086854 | 3300005618 | Bacteria | 2753 |
| 90 | Ga0068864_100403628 | 3300005618 | Bacteria | 1299 |
| 91 | Ga0068851_10085117 | 3300005834 | Unclassified | 1657 |
| 92 | Ga0068863_100001753 | 3300005841 | Bacteria | 21524 |
| 93 | Ga0068863_100001814 | 3300005841 | Bacteria | 21208 |
| 94 | Ga0068863_100315699 | 3300005841 | Bacteria | 1517 |
| 95 | Ga0068858_100014586 | 3300005842 | Bacteria | 7404 |
| 96 | Ga0068860_100000689 | 3300005843 | Bacteria | 38878 |
| 97 | Ga0081540_1004351 | 3300005983 | Bacteria | 10839 |
| 98 | Ga0070717_10523552 | 3300006028 | Bacteria | 1073 |
| 99 | Ga0070712_100658460 | 3300006175 | Bacteria | 890 |
| 100 | Ga0097621_100000349 | 3300006237 | Bacteria | 31779 |
| 101 | Ga0068871_100002325 | 3300006358 | Bacteria | 12946 |
| 102 | Ga0075436_100009109 | 3300006914 | Bacteria | 6792 |
| 103 | Ga0105240_10000372 | 3300009093 | Bacteria | 84325 |
| 104 | Ga0105240_10000496 | 3300009093 | Bacteria | 72575 |
| 105 | Ga0105240_10009346 | 3300009093 | Bacteria | 13895 |
| 106 | Ga0105240_10010838 | 3300009093 | Bacteria | 12767 |
| 107 | Ga0105240_10030875 | 3300009093 | Bacteria | 6960 |
| 108 | Ga0105240_10064615 | 3300009093 | Bacteria | 4546 |
| 109 | Ga0105240_10087131 | 3300009093 | Bacteria | 3824 |
| 110 | Ga0105240_10132371 | 3300009093 | Bacteria | 2990 |
| 111 | Ga0105240_10244112 | 3300009093 | Bacteria | 2080 |
| 112 | Ga0105240_10379291 | 3300009093 | Bacteria | 1597 |
| 113 | Ga0105240_10663251 | 3300009093 | Bacteria | 1142 |
| 114 | Ga0105240_11152276 | 3300009093 | Bacteria | 823 |
| 115 | Ga0105245_10000486 | 3300009098 | Bacteria | 36378 |
| 116 | Ga0105245_10504514 | 3300009098 | Bacteria | 1226 |
| 117 | Ga0105247_10002346 | 3300009101 | Bacteria | 12922 |
| 118 | Ga0105243_10008481 | 3300009148 | Bacteria | 7889 |
| 119 | Ga0105241_10000026 | 3300009174 | Bacteria | 132695 |
| 120 | Ga0105241_10000121 | 3300009174 | Bacteria | 57041 |
| 121 | Ga0105241_10002032 | 3300009174 | Bacteria | 15308 |
| 122 | Ga0105241_10139161 | 3300009174 | Bacteria | 1974 |
| 123 | Ga0105241_10179856 | 3300009174 | Unclassified | 1753 |
| 124 | Ga0105248_10006539 | 3300009177 | Bacteria | 12780 |
| 125 | Ga0105248_10007017 | 3300009177 | Bacteria | 12337 |
| 126 | Ga0105248_10016372 | 3300009177 | Bacteria | 8160 |
| 127 | Ga0105248_10029618 | 3300009177 | Bacteria | 6107 |
| 128 | Ga0105248_10039332 | 3300009177 | Bacteria | 5296 |
| 129 | Ga0105248_10108464 | 3300009177 | Bacteria | 3131 |
| 130 | Ga0105248_10131792 | 3300009177 | Bacteria | 2820 |
| 131 | Ga0105237_10000590 | 3300009545 | Bacteria | 50564 |
| 132 | Ga0105237_10006331 | 3300009545 | Bacteria | 13155 |
| 133 | Ga0105237_10055825 | 3300009545 | Bacteria | 3955 |
| 134 | Ga0105237_10167008 | 3300009545 | Bacteria | 2200 |
| 135 | Ga0105237_10210199 | 3300009545 | Bacteria | 1946 |
| 136 | Ga0105237_10215892 | 3300009545 | Bacteria | 1918 |
| 137 | Ga0105238_10000197 | 3300009551 | Bacteria | 66637 |
| 138 | Ga0105238_10000509 | 3300009551 | Bacteria | 40868 |
| 139 | Ga0105238_10054460 | 3300009551 | Bacteria | 4017 |
| 140 | Ga0105238_10111078 | 3300009551 | Bacteria | 2721 |
| 141 | Ga0105238_10207045 | 3300009551 | Unclassified | 1938 |
| 142 | Ga0105238_10309477 | 3300009551 | Bacteria | 1564 |
| 143 | Ga0105238_10556750 | 3300009551 | Bacteria | 1151 |
| 144 | Ga0105238_10996964 | 3300009551 | Bacteria | 858 |
| 145 | Ga0105238_11025474 | 3300009551 | Bacteria | 846 |
| 146 | Ga0105249_10003449 | 3300009553 | Bacteria | 13698 |
| 147 | Ga0105239_10001533 | 3300010375 | Bacteria | 30534 |
| 148 | Ga0105239_10003046 | 3300010375 | Bacteria | 20836 |
| 149 | Ga0105239_10047654 | 3300010375 | Bacteria | 4696 |
| 150 | Ga0105239_10129889 | 3300010375 | Bacteria | 2801 |
| 151 | Ga0105246_10001192 | 3300011119 | Bacteria | 15150 |
| 152 | Ga0157373_10273517 | 3300013100 | Unclassified | 1196 |
| 153 | Ga0157371_10118539 | 3300013102 | Bacteria | 1882 |
| 154 | Ga0157371_10321687 | 3300013102 | Bacteria | 1123 |
| 155 | Ga0157370_10013763 | 3300013104 | Bacteria | 8313 |
| 156 | Ga0157370_10056931 | 3300013104 | Bacteria | 3720 |
| 157 | Ga0157370_10143683 | 3300013104 | Bacteria | 2223 |
| 158 | Ga0157370_10144774 | 3300013104 | Unclassified | 2213 |
| 159 | Ga0157370_10150526 | 3300013104 | Bacteria | 2165 |
| 160 | Ga0157370_10337514 | 3300013104 | Bacteria | 1389 |
| 161 | Ga0157369_10000085 | 3300013105 | Bacteria | 129025 |
| 162 | Ga0157369_10000430 | 3300013105 | Bacteria | 55736 |
| 163 | Ga0157369_10002421 | 3300013105 | Bacteria | 22423 |
| 164 | Ga0157369_10009218 | 3300013105 | Bacteria | 11289 |
| 165 | Ga0157369_10010533 | 3300013105 | Bacteria | 10523 |
| 166 | Ga0157369_10012659 | 3300013105 | Bacteria | 9566 |
| 167 | Ga0157369_10069226 | 3300013105 | Bacteria | 3791 |
| 168 | Ga0157369_10187110 | 3300013105 | Bacteria | 2177 |
| 169 | Ga0157369_10247562 | 3300013105 | Bacteria | 1861 |
| 170 | Ga0157369_10330569 | 3300013105 | Bacteria | 1584 |
| 171 | Ga0157369_10373773 | 3300013105 | Bacteria | 1480 |
| 172 | Ga0157369_10399786 | 3300013105 | Bacteria | 1425 |
| 173 | Ga0157369_10446063 | 3300013105 | Bacteria | 1340 |
| 174 | Ga0157369_10591061 | 3300013105 | Bacteria | 1146 |
| 175 | Ga0157374_10023020 | 3300013296 | Bacteria | 5565 |
| 176 | Ga0157374_10035016 | 3300013296 | Bacteria | 4591 |
| 177 | Ga0157374_10083746 | 3300013296 | Bacteria | 3030 |
| 178 | Ga0157374_10652418 | 3300013296 | Bacteria | 1064 |
| 179 | Ga0157374_10652854 | 3300013296 | Unclassified | 1064 |
| 180 | Ga0157378_10004251 | 3300013297 | Bacteria | 12630 |
| 181 | Ga0157378_10117504 | 3300013297 | Bacteria | 2447 |
| 182 | Ga0157378_10340671 | 3300013297 | Bacteria | 1462 |
| 183 | Ga0163162_10043334 | 3300013306 | Bacteria | 4506 |
| 184 | Ga0163162_10115403 | 3300013306 | Unclassified | 2785 |
| 185 | Ga0163162_10692608 | 3300013306 | Bacteria | 1141 |
| 186 | Ga0157372_10000217 | 3300013307 | Bacteria | 63667 |
| 187 | Ga0157372_10020181 | 3300013307 | Bacteria | 7185 |
| 188 | Ga0157372_10072143 | 3300013307 | Bacteria | 3890 |
| 189 | Ga0157372_10106002 | 3300013307 | Bacteria | 3215 |
| 190 | Ga0157372_10117248 | 3300013307 | Bacteria | 3054 |
| 191 | Ga0157372_10226977 | 3300013307 | Bacteria | 2165 |
| 192 | Ga0157372_10300417 | 3300013307 | Unclassified | 1867 |
| 193 | Ga0157372_10308318 | 3300013307 | Bacteria | 1842 |
| 194 | Ga0157372_10312122 | 3300013307 | Bacteria | 1830 |
| 195 | Ga0157372_10320090 | 3300013307 | Bacteria | 1806 |
| 196 | Ga0157372_10373289 | 3300013307 | Bacteria | 1662 |
| 197 | Ga0157372_10835314 | 3300013307 | Bacteria | 1070 |
| 198 | Ga0157375_10067022 | 3300013308 | Bacteria | 3586 |
| 199 | Ga0157375_10157485 | 3300013308 | Bacteria | 2411 |
| 200 | Ga0157375_10518255 | 3300013308 | Bacteria | 1356 |
| 201 | Ga0163163_10001161 | 3300014325 | Bacteria | 22403 |
| 202 | Ga0163163_10017757 | 3300014325 | Bacteria | 6641 |
| 203 | Ga0163163_10020844 | 3300014325 | Bacteria | 6179 |
| 204 | Ga0163163_10192750 | 3300014325 | Bacteria | 2086 |
| 205 | Ga0182008_10170467 | 3300014497 | Bacteria | 1099 |
| 206 | Ga0157379_10002312 | 3300014968 | Bacteria | 15882 |
| 207 | Ga0157379_10157854 | 3300014968 | Bacteria | 2047 |
| 208 | Ga0157379_10606583 | 3300014968 | Unclassified | 1022 |
| 209 | Ga0157376_10000296 | 3300014969 | Bacteria | 33604 |
| 210 | Ga0157376_10023888 | 3300014969 | Bacteria | 4793 |
| 211 | Ga0157376_10032166 | 3300014969 | Bacteria | 4209 |
| 212 | Ga0157376_11002475 | 3300014969 | Bacteria | 858 |
| 213 | Ga0154015_1016114 | 3300020610 | Unclassified | 947 |
| 214 | Ga0228598_1028824 | 3300024227 | Bacteria | 1092 |
| 215 | Ga0209437_108001 | 3300025233 | Bacteria | 1699 |
| 216 | Ga0209233_1001442 | 3300025261 | Bacteria | 9385 |
| 217 | Ga0207656_10021009 | 3300025321 | Unclassified | 2602 |
| 218 | Ga0207656_10056823 | 3300025321 | Unclassified | 1707 |
| 219 | Ga0207656_10165533 | 3300025321 | Bacteria | 1054 |
| 220 | Ga0207647_10014872 | 3300025904 | Bacteria | 5351 |
| 221 | Ga0207705_10000021 | 3300025909 | Bacteria | 309436 |
| 222 | Ga0207705_10002125 | 3300025909 | Bacteria | 15376 |
| 223 | Ga0207705_10027435 | 3300025909 | Bacteria | 4060 |
| 224 | Ga0207705_10032912 | 3300025909 | Bacteria | 3705 |
| 225 | Ga0207705_10041847 | 3300025909 | Bacteria | 3287 |
| 226 | Ga0207705_10080943 | 3300025909 | Bacteria | 2367 |
| 227 | Ga0207705_10167344 | 3300025909 | Unclassified | 1654 |
| 228 | Ga0207705_10205584 | 3300025909 | Bacteria | 1492 |
| 229 | Ga0207654_10000054 | 3300025911 | Bacteria | 82347 |
| 230 | Ga0207654_10026092 | 3300025911 | Bacteria | 3160 |
| 231 | Ga0207654_10122981 | 3300025911 | Unclassified | 1632 |
| 232 | Ga0207654_10156579 | 3300025911 | Unclassified | 1468 |
| 233 | Ga0207707_10085789 | 3300025912 | Bacteria | 2751 |
| 234 | Ga0207707_10337448 | 3300025912 | Bacteria | 1300 |
| 235 | Ga0207707_10572265 | 3300025912 | Unclassified | 958 |
| 236 | Ga0207695_10000080 | 3300025913 | Bacteria | 287868 |
| 237 | Ga0207695_10000113 | 3300025913 | Bacteria | 247240 |
| 238 | Ga0207695_10000167 | 3300025913 | Bacteria | 194371 |
| 239 | Ga0207695_10000263 | 3300025913 | Bacteria | 132894 |
| 240 | Ga0207695_10033351 | 3300025913 | Bacteria | 5617 |
| 241 | Ga0207695_10105111 | 3300025913 | Unclassified | 2811 |
| 242 | Ga0207695_10138447 | 3300025913 | Bacteria | 2386 |
| 243 | Ga0207695_10188139 | 3300025913 | Bacteria | 1983 |
| 244 | Ga0207695_10607515 | 3300025913 | Bacteria | 975 |
| 245 | Ga0207671_10000065 | 3300025914 | Bacteria | 166743 |
| 246 | Ga0207671_10000123 | 3300025914 | Bacteria | 119385 |
| 247 | Ga0207671_10000139 | 3300025914 | Bacteria | 111786 |
| 248 | Ga0207671_10068441 | 3300025914 | Bacteria | 2645 |
| 249 | Ga0207671_10380688 | 3300025914 | Bacteria | 1121 |
| 250 | Ga0207693_10540728 | 3300025915 | Bacteria | 909 |
| 251 | Ga0207660_10039132 | 3300025917 | Bacteria | 3314 |
| 252 | Ga0207660_10047824 | 3300025917 | Bacteria | 3026 |
| 253 | Ga0207657_10020248 | 3300025919 | Bacteria | 6293 |
| 254 | Ga0207657_10022299 | 3300025919 | Bacteria | 5931 |
| 255 | Ga0207657_10114026 | 3300025919 | Bacteria | 2229 |
| 256 | Ga0207649_10054539 | 3300025920 | Bacteria | 2488 |
| 257 | Ga0207649_10171445 | 3300025920 | Bacteria | 1512 |
| 258 | Ga0207652_10041920 | 3300025921 | Bacteria | 3893 |
| 259 | Ga0207652_10115347 | 3300025921 | Bacteria | 2386 |
| 260 | Ga0207652_10285488 | 3300025921 | Bacteria | 1489 |
| 261 | Ga0207694_10000248 | 3300025924 | Bacteria | 51461 |
| 262 | Ga0207694_10000711 | 3300025924 | Bacteria | 29920 |
| 263 | Ga0207694_10086769 | 3300025924 | Bacteria | 2464 |
| 264 | Ga0207694_10177601 | 3300025924 | Unclassified | 1725 |
| 265 | Ga0207694_10245121 | 3300025924 | Unclassified | 1465 |
| 266 | Ga0207694_10248546 | 3300025924 | Bacteria | 1455 |
| 267 | Ga0207650_10141600 | 3300025925 | Bacteria | 1891 |
| 268 | Ga0207650_10552744 | 3300025925 | Unclassified | 965 |
| 269 | Ga0207687_10000978 | 3300025927 | Bacteria | 19404 |
| 270 | Ga0207700_10381105 | 3300025928 | Bacteria | 1233 |
| 271 | Ga0207700_10506661 | 3300025928 | Bacteria | 1068 |
| 272 | Ga0207664_10017916 | 3300025929 | Bacteria | 5203 |
| 273 | Ga0207664_10064130 | 3300025929 | Bacteria | 2937 |
| 274 | Ga0207644_10004420 | 3300025931 | Bacteria | 9123 |
| 275 | Ga0207644_10215112 | 3300025931 | Bacteria | 1521 |
| 276 | Ga0207690_10084349 | 3300025932 | Bacteria | 2227 |
| 277 | Ga0207709_10017040 | 3300025935 | Bacteria | 4050 |
| 278 | Ga0207711_10014059 | 3300025941 | Bacteria | 6649 |
| 279 | Ga0207711_10043809 | 3300025941 | Bacteria | 3819 |
| 280 | Ga0207711_10058450 | 3300025941 | Bacteria | 3318 |
| 281 | Ga0207711_10155934 | 3300025941 | Bacteria | 2063 |
| 282 | Ga0207711_10903978 | 3300025941 | Bacteria | 821 |
| 283 | Ga0207689_10000724 | 3300025942 | Bacteria | 31641 |
| 284 | Ga0207661_10001283 | 3300025944 | Bacteria | 16799 |
| 285 | Ga0207661_10059682 | 3300025944 | Bacteria | 3075 |
| 286 | Ga0207661_10138935 | 3300025944 | Unclassified | 2089 |
| 287 | Ga0207661_10314799 | 3300025944 | Bacteria | 1406 |
| 288 | Ga0207661_10433514 | 3300025944 | Unclassified | 1195 |
| 289 | Ga0207679_10061885 | 3300025945 | Bacteria | 2788 |
| 290 | Ga0207667_10006194 | 3300025949 | Bacteria | 14522 |
| 291 | Ga0207667_10007633 | 3300025949 | Bacteria | 12958 |
| 292 | Ga0207667_10009516 | 3300025949 | Bacteria | 11434 |
| 293 | Ga0207667_10012818 | 3300025949 | Bacteria | 9632 |
| 294 | Ga0207667_10025432 | 3300025949 | Bacteria | 6479 |
| 295 | Ga0207667_10026234 | 3300025949 | Bacteria | 6368 |
| 296 | Ga0207667_10035816 | 3300025949 | Bacteria | 5323 |
| 297 | Ga0207667_10073432 | 3300025949 | Bacteria | 3554 |
| 298 | Ga0207667_10212215 | 3300025949 | Bacteria | 1984 |
| 299 | Ga0207712_10030122 | 3300025961 | Bacteria | 3646 |
| 300 | Ga0207640_10000028 | 3300025981 | Bacteria | 135727 |
| 301 | Ga0207640_10020918 | 3300025981 | Bacteria | 3891 |
| 302 | Ga0207640_10354319 | 3300025981 | Unclassified | 1180 |
| 303 | Ga0207658_10003428 | 3300025986 | Bacteria | 11222 |
| 304 | Ga0207677_10000143 | 3300026023 | Bacteria | 58337 |
| 305 | Ga0207677_10585248 | 3300026023 | Bacteria | 977 |
| 306 | Ga0207703_10004820 | 3300026035 | Bacteria | 10980 |
| 307 | Ga0207639_10000088 | 3300026041 | Bacteria | 78742 |
| 308 | Ga0207639_10000371 | 3300026041 | Bacteria | 31074 |
| 309 | Ga0207639_10016992 | 3300026041 | Bacteria | 5155 |
| 310 | Ga0207639_10102623 | 3300026041 | Bacteria | 2315 |
| 311 | Ga0207639_10194100 | 3300026041 | Bacteria | 1736 |
| 312 | Ga0207639_10259218 | 3300026041 | Bacteria | 1520 |
| 313 | Ga0207639_10339955 | 3300026041 | Unclassified | 1338 |
| 314 | Ga0207678_10003339 | 3300026067 | Bacteria | 14471 |
| 315 | Ga0207678_10017744 | 3300026067 | Bacteria | 6250 |
| 316 | Ga0207678_10056161 | 3300026067 | Bacteria | 3390 |
| 317 | Ga0207678_10149736 | 3300026067 | Bacteria | 1992 |
| 318 | Ga0207702_10001334 | 3300026078 | Bacteria | 24682 |
| 319 | Ga0207702_10002672 | 3300026078 | Bacteria | 16738 |
| 320 | Ga0207702_10084650 | 3300026078 | Bacteria | 2762 |
| 321 | Ga0207641_10383631 | 3300026088 | Bacteria | 1346 |
| 322 | Ga0207676_10002595 | 3300026095 | Bacteria | 12891 |
| 323 | Ga0207676_10052862 | 3300026095 | Bacteria | 3177 |
| 324 | Ga0207676_10495121 | 3300026095 | Bacteria | 1160 |
| 325 | Ga0207674_10000669 | 3300026116 | Bacteria | 44573 |
| 326 | Ga0207674_10005472 | 3300026116 | Bacteria | 15089 |
| 327 | Ga0207674_10048839 | 3300026116 | Bacteria | 4330 |
| 328 | Ga0207674_10430583 | 3300026116 | Bacteria | 1275 |
| 329 | Ga0207674_10705703 | 3300026116 | Bacteria | 974 |
| 330 | Ga0207698_10000003 | 3300026142 | Bacteria | 321303 |
| 331 | Ga0207698_10000708 | 3300026142 | Bacteria | 19330 |
| 332 | Ga0207698_10099445 | 3300026142 | Bacteria | 2406 |
| 333 | Ga0207698_10105923 | 3300026142 | Bacteria | 2344 |
| 334 | Ga0207698_10144796 | 3300026142 | Unclassified | 2053 |
| 335 | Ga0268266_10005265 | 3300028379 | Bacteria | 12146 |
| 336 | Ga0268266_10006399 | 3300028379 | Bacteria | 10792 |
| 337 | Ga0268266_10008807 | 3300028379 | Bacteria | 8937 |
| 338 | Ga0268264_10000598 | 3300028381 | Bacteria | 43640 |
| 339 | Ga0265338_10017734 | 3300028800 | Bacteria | 7656 |
| 340 | Ga0265338_10117655 | 3300028800 | Bacteria | 2126 |
| 341 | Ga0265338_10225494 | 3300028800 | Bacteria | 1397 |
| 342 | Ga0265324_10009104 | 3300029957 | Bacteria | 3896 |
| 343 | Ga0265760_10133851 | 3300031090 | Unclassified | 803 |
| 344 | Ga0265330_10000273 | 3300031235 | Bacteria | 38107 |
| 345 | Ga0265330_10116345 | 3300031235 | Bacteria | 1140 |
| 346 | Ga0265328_10005053 | 3300031239 | Bacteria | 5684 |
| 347 | Ga0265328_10049572 | 3300031239 | Unclassified | 1542 |
| 348 | Ga0265325_10000266 | 3300031241 | Bacteria | 37071 |
| 349 | Ga0265325_10023750 | 3300031241 | Bacteria | 3342 |
| 350 | Ga0265325_10024784 | 3300031241 | Bacteria | 3259 |
| 351 | Ga0265340_10012505 | 3300031247 | Bacteria | 4481 |
| 352 | Ga0265339_10000124 | 3300031249 | Bacteria | 64124 |
| 353 | Ga0265339_10000194 | 3300031249 | Bacteria | 50375 |
| 354 | Ga0265339_10009288 | 3300031249 | Bacteria | 6193 |
| 355 | Ga0265316_10003105 | 3300031344 | Bacteria | 16919 |
| 356 | Ga0265316_10006699 | 3300031344 | Bacteria | 10976 |
| 357 | Ga0265316_10012685 | 3300031344 | Bacteria | 7543 |
| 358 | Ga0265313_10002216 | 3300031595 | Bacteria | 17122 |
| 359 | Ga0265313_10005380 | 3300031595 | Bacteria | 9445 |
| 360 | Ga0265313_10021496 | 3300031595 | Bacteria | 3528 |
| 361 | Ga0265313_10093326 | 3300031595 | Bacteria | 1347 |
| 362 | Ga0265314_10002987 | 3300031711 | Bacteria | 16745 |
| 363 | Ga0265314_10021888 | 3300031711 | Bacteria | 4904 |
| 364 | Ga0265342_10000225 | 3300031712 | Bacteria | 63822 |
| 365 | Ga0265342_10001536 | 3300031712 | Bacteria | 21355 |
| 366 | Ga0265342_10027916 | 3300031712 | Bacteria | 3520 |
| 367 | Ga0265342_10181726 | 3300031712 | Bacteria | 1151 |
| 368 | Ga0307510_10071107 | 3300033180 | Bacteria | 3468 |
| 369 | Ga0307510_10094785 | 3300033180 | Bacteria | 2808 |
| 370 | Ga0373956_0021847 | 3300035119 | Bacteria | 2732 |
| 371 | Ga0373955_0007147 | 3300035172 | Bacteria | 5117 |
| 372 | Ga0373937_0019961 | 3300036401 | Bacteria | 6002 |
| 373 | Ga0373937_0180871 | 3300036401 | Unclassified | 1980 |
| 374 | Ga0373937_0266593 | 3300036401 | Bacteria | 1616 |
| 375 | Ga0373937_0297238 | 3300036401 | Bacteria | 1526 |
| 376 | Ga0373925_0401553 | 3300037068 | Bacteria | 1118 |
| 377 | Ga0395900_0025848 | 3300037418 | Bacteria | 6011 |
| 378 | Ga0395898_0027814 | 3300037466 | Bacteria | 5670 |
| 379 | Ga0395898_0459394 | 3300037466 | Bacteria | 1212 |
| 380 | Ga0439448_0015255 | 3300042005 | Bacteria | 2326 |
| 381 | Ga0466969_0024581 | 3300044656 | Bacteria | 3100 |
| 382 | Ga0466966_0040099 | 3300044684 | Bacteria | 3014 |
| 383 | Ga0466966_0256512 | 3300044684 | Bacteria | 1053 |
| 384 | Ga0466966_0382439 | 3300044684 | Unclassified | 846 |
| 385 | Ga0466961_0122066 | 3300044693 | Unclassified | 1635 |
| 386 | Ga0466961_0305674 | 3300044693 | Bacteria | 971 |
| 387 | Ga0466963_0000494 | 3300044694 | Bacteria | 18341 |
| 388 | Ga0466963_0010164 | 3300044694 | Bacteria | 5690 |
| 389 | Ga0466963_0098713 | 3300044694 | Bacteria | 1997 |
| 390 | Ga0466963_0215755 | 3300044694 | Bacteria | 1343 |
| 391 | Ga0466958_0007910 | 3300045836 | Bacteria | 5877 |
| 392 | Ga0466958_0219357 | 3300045836 | Bacteria | 1213 |
| 393 | Ga0466967_0001401 | 3300045976 | Bacteria | 13938 |
| 394 | Ga0466967_0001893 | 3300045976 | Bacteria | 12641 |
| 395 | Ga0466967_0046813 | 3300045976 | Bacteria | 3768 |
| 396 | Ga0495592_0418821 | 3300046454 | Bacteria | 845 |
| 397 | Ga0495603_0009924 | 3300046455 | Bacteria | 5763 |
| 398 | Ga0495629_0011020 | 3300046459 | Bacteria | 6567 |
| 399 | Ga0495629_0092572 | 3300046459 | Bacteria | 2110 |
| 400 | Ga0495629_0190528 | 3300046459 | Bacteria | 1419 |
| 401 | Ga0495651_0290033 | 3300046462 | Bacteria | 1102 |
| 402 | Ga0495650_0000038 | 3300046471 | Bacteria | 377530 |
| 403 | Ga0495650_0002342 | 3300046471 | Bacteria | 15659 |
| 404 | Ga0495580_0089761 | 3300046472 | Bacteria | 2140 |
| 405 | Ga0495580_0103353 | 3300046472 | Bacteria | 1980 |
| 406 | Ga0495580_0320237 | 3300046472 | Unclassified | 1054 |
| 407 | Ga0495580_0447252 | 3300046472 | Bacteria | 867 |
| 408 | Ga0495582_0001853 | 3300046473 | Bacteria | 11921 |
| 409 | Ga0495582_0067225 | 3300046473 | Bacteria | 1980 |
| 410 | Ga0495582_0080396 | 3300046473 | Bacteria | 1810 |
| 411 | Ga0495639_0004538 | 3300046475 | Bacteria | 5952 |
| 412 | Ga0495662_0006308 | 3300046476 | Bacteria | 5928 |
| 413 | Ga0495664_0001348 | 3300046477 | Bacteria | 12929 |
| 414 | Ga0495664_0049296 | 3300046477 | Bacteria | 2500 |
| 415 | Ga0495664_0065290 | 3300046477 | Unclassified | 2169 |
| 416 | Ga0495585_0025037 | 3300046492 | Bacteria | 3420 |
| 417 | Ga0495594_0001190 | 3300046499 | Bacteria | 13614 |
| 418 | Ga0495594_0004431 | 3300046499 | Bacteria | 7222 |
| 419 | Ga0495594_0043704 | 3300046499 | Bacteria | 2456 |
| 420 | Ga0495594_0056792 | 3300046499 | Bacteria | 2161 |
| 421 | Ga0495596_0116450 | 3300046500 | Bacteria | 1038 |
| 422 | Ga0495606_0024321 | 3300046507 | Bacteria | 4368 |
| 423 | Ga0495606_0026137 | 3300046507 | Bacteria | 4164 |
| 424 | Ga0495618_0037508 | 3300046514 | Bacteria | 3044 |
| 425 | Ga0495628_0015738 | 3300046516 | Bacteria | 6314 |
| 426 | Ga0495628_0033438 | 3300046516 | Bacteria | 4145 |
| 427 | Ga0495631_0010490 | 3300046518 | Bacteria | 4581 |
| 428 | Ga0495631_0038676 | 3300046518 | Bacteria | 2120 |
| 429 | Ga0495644_0000048 | 3300046523 | Bacteria | 57696 |
| 430 | Ga0495648_0228481 | 3300046524 | Bacteria | 913 |
| 431 | Ga0495666_0024917 | 3300046526 | Bacteria | 2955 |
| 432 | Ga0495652_0006640 | 3300046529 | Bacteria | 10742 |
| 433 | Ga0495652_0020698 | 3300046529 | Bacteria | 5848 |
| 434 | Ga0495665_0009651 | 3300046531 | Bacteria | 5228 |
| 435 | Ga0495665_0194702 | 3300046531 | Bacteria | 1052 |
| 436 | Ga0495640_0004801 | 3300046533 | Bacteria | 10760 |
| 437 | Ga0495640_0270223 | 3300046533 | Bacteria | 1060 |
| 438 | Ga0495586_0019711 | 3300046535 | Bacteria | 3591 |
| 439 | Ga0495587_0007267 | 3300046536 | Bacteria | 7183 |
| 440 | Ga0495609_0048103 | 3300046538 | Bacteria | 1907 |
| 441 | Ga0495645_0004272 | 3300046543 | Bacteria | 9760 |
| 442 | Ga0495645_0014554 | 3300046543 | Bacteria | 5584 |
| 443 | Ga0495645_0039222 | 3300046543 | Bacteria | 3455 |
| 444 | Ga0495645_0120435 | 3300046543 | Bacteria | 1848 |
| 445 | Ga0495622_0112645 | 3300046557 | Bacteria | 1245 |
| 446 | Ga0495633_0013243 | 3300046558 | Bacteria | 4354 |
| 447 | Ga0495667_0015039 | 3300046559 | Bacteria | 5223 |
| 448 | Ga0495667_0161695 | 3300046559 | Bacteria | 1440 |
| 449 | Ga0495634_0006225 | 3300046642 | Bacteria | 9093 |
| 450 | Ga0495611_0005877 | 3300046648 | Bacteria | 5236 |
| 451 | Ga0495625_0000985 | 3300046660 | Bacteria | 37750 |
| 452 | Ga0495625_0017473 | 3300046660 | Bacteria | 5617 |
| 453 | Ga0495625_0026175 | 3300046660 | Bacteria | 4411 |
| 454 | Ga0495635_0002836 | 3300046663 | Bacteria | 11904 |
| 455 | Ga0495635_0197292 | 3300046663 | Bacteria | 1366 |
| 456 | Ga0495635_0396171 | 3300046663 | Unclassified | 917 |
| 457 | Ga0495661_0021941 | 3300046665 | Bacteria | 4156 |
| 458 | Ga0495588_0068626 | 3300046674 | Bacteria | 1842 |
| 459 | Ga0495599_0037006 | 3300046678 | Bacteria | 3066 |
| 460 | Ga0495599_0163875 | 3300046678 | Bacteria | 1373 |
| 461 | Ga0495623_0073201 | 3300046679 | Bacteria | 2130 |
| 462 | Ga0495646_0013211 | 3300046680 | Bacteria | 5247 |
| 463 | Ga0495646_0087913 | 3300046680 | Bacteria | 1800 |
| 464 | Ga0495646_0115119 | 3300046680 | Bacteria | 1527 |
| 465 | Ga0495669_0015601 | 3300046684 | Bacteria | 3254 |
| 466 | Ga0495613_0003966 | 3300046689 | Bacteria | 11081 |
| 467 | Ga0495613_0048075 | 3300046689 | Bacteria | 3150 |
| 468 | Ga0495613_0164464 | 3300046689 | Bacteria | 1577 |
| 469 | Ga0495649_0200934 | 3300046694 | Bacteria | 1035 |
| 470 | Ga0495600_0012858 | 3300046809 | Bacteria | 5243 |
| 471 | Ga0495600_0126930 | 3300046809 | Bacteria | 1659 |
| 472 | Ga0495600_0292340 | 3300046809 | Bacteria | 1029 |
| 473 | Ga0495581_0001976 | 3300047315 | Bacteria | 11495 |
| 474 | Ga0495581_0044298 | 3300047315 | Bacteria | 2573 |
| 475 | Ga0495604_0009666 | 3300047317 | Bacteria | 7624 |
| 476 | Ga0495604_0032429 | 3300047317 | Bacteria | 4140 |
| 477 | Ga0495636_0118561 | 3300047318 | Bacteria | 1169 |
| 478 | Ga0495674_0011368 | 3300047319 | Bacteria | 8401 |
| 479 | Ga0495674_0014334 | 3300047319 | Bacteria | 7423 |
| 480 | Ga0495674_0410310 | 3300047319 | Bacteria | 1092 |
| 481 | Ga0495672_0021506 | 3300047320 | Bacteria | 4206 |
| 482 | Ga0495672_0051848 | 3300047320 | Bacteria | 2414 |
| 483 | Ga0495676_0008961 | 3300047321 | Bacteria | 9134 |
| 484 | Ga0495680_0017467 | 3300047322 | Bacteria | 6127 |
| 485 | Ga0495683_0112571 | 3300047323 | Bacteria | 1298 |
| 486 | Ga0495675_0079836 | 3300047444 | Bacteria | 2060 |
| 487 | Ga0495685_085712 | 3300047447 | Bacteria | 1047 |
| 488 | Ga0495684_0087091 | 3300047471 | Unclassified | 2367 |
| 489 | Ga0495684_0114087 | 3300047471 | Bacteria | 2037 |
| 490 | Ga0495686_0000178 | 3300047472 | Bacteria | 121468 |
| 491 | Ga0495686_0001621 | 3300047472 | Bacteria | 23566 |
| 492 | Ga0495686_0016441 | 3300047472 | Bacteria | 5016 |
| 493 | Ga0495686_0022023 | 3300047472 | Bacteria | 4220 |
| 494 | Ga0495686_0062732 | 3300047472 | Bacteria | 2304 |
| 495 | Ga0495686_0096671 | 3300047472 | Unclassified | 1787 |
| 496 | Ga0495686_0107665 | 3300047472 | Bacteria | 1675 |
| 497 | Ga0495593_0061551 | 3300047673 | Bacteria | 1963 |
| 498 | Ga0495602_0446209 | 3300048088 | Unclassified | 914 |
| 499 | Ga0495614_0000972 | 3300048089 | Bacteria | 12208 |
| 500 | Ga0495614_0009178 | 3300048089 | Bacteria | 4382 |
| 501 | Ga0496100_0062884 | 3300048903 | Bacteria | 2451 |
| 502 | Ga0496104_0000053 | 3300048907 | Bacteria | 135895 |
| 503 | Ga0496104_0187129 | 3300048907 | Bacteria | 1981 |
| 504 | Ga0496105_0063911 | 3300048908 | Bacteria | 3037 |
| 505 | Ga0496106_0042478 | 3300048909 | Bacteria | 3410 |
| 506 | Ga0496106_0141941 | 3300048909 | Unclassified | 1890 |
| 507 | Ga0496107_0250908 | 3300048910 | Bacteria | 1317 |
| 508 | Ga0496108_0226841 | 3300048911 | Bacteria | 1624 |
| 509 | Ga0496112_0021005 | 3300048915 | Bacteria | 6201 |
| 510 | Ga0496113_0102885 | 3300048916 | Bacteria | 2215 |
| 511 | Ga0496114_0203080 | 3300048917 | Bacteria | 1736 |
| 512 | Ga0496114_0410947 | 3300048917 | Bacteria | 1199 |
| 513 | Ga0496114_0523799 | 3300048917 | Bacteria | 1048 |
| 514 | Ga0496115_0240623 | 3300048918 | Unclassified | 1491 |
| 515 | Ga0496115_0444936 | 3300048918 | Bacteria | 1047 |
| 516 | Ga0496118_0174174 | 3300048921 | Bacteria | 1310 |
| 517 | Ga0496126_0000014 | 3300048929 | Bacteria | 686881 |
| 518 | Ga0496126_0000100 | 3300048929 | Bacteria | 203706 |
| 519 | Ga0496126_0000154 | 3300048929 | Bacteria | 159983 |
| 520 | Ga0496126_0018324 | 3300048929 | Bacteria | 6942 |
| 521 | Ga0496126_0032919 | 3300048929 | Bacteria | 4878 |
| 522 | Ga0496126_0742955 | 3300048929 | Unclassified | 758 |
| 523 | Ga0495682_0028164 | 3300049460 | Bacteria | 2083 |
| 524 | Ga0495682_0046605 | 3300049460 | Bacteria | 1582 |
| 525 | Ga0495682_0184060 | 3300049460 | Unclassified | 742 |
| 526 | Ga0501031_0152929 | 3300049568 | Bacteria | 1508 |
| 527 | Ga0501032_0001912 | 3300049569 | Bacteria | 16446 |
| 528 | Ga0501033_0060607 | 3300049570 | Bacteria | 2791 |
| 529 | Ga0501034_0169330 | 3300049571 | Bacteria | 2152 |
| 530 | Ga0501036_0081969 | 3300049572 | Bacteria | 2726 |
| 531 | Ga0501036_0775796 | 3300049572 | Bacteria | 790 |
| 532 | Ga0501037_0193654 | 3300049573 | Bacteria | 1439 |
| 533 | Ga0501038_0005281 | 3300049574 | Bacteria | 12013 |
| 534 | Ga0501043_0003983 | 3300049579 | Bacteria | 12094 |
| 535 | Ga0501043_0083888 | 3300049579 | Bacteria | 2505 |
| 536 | Ga0501046_0000056 | 3300049580 | Bacteria | 129342 |
| 537 | Ga0501047_0008947 | 3300049581 | Bacteria | 9454 |
| 538 | Ga0501047_0011287 | 3300049581 | Bacteria | 8456 |
| 539 | Ga0501047_0773248 | 3300049581 | Bacteria | 776 |
| 540 | Ga0501048_0041932 | 3300049582 | Bacteria | 3279 |
| 541 | Ga0501070_0068724 | 3300049586 | Bacteria | 2933 |
| 542 | Ga0501070_0334038 | 3300049586 | Bacteria | 1231 |
| 543 | Ga0501070_0403480 | 3300049586 | Bacteria | 1105 |
| 544 | Ga0501073_0018854 | 3300049589 | Bacteria | 4986 |
| 545 | Ga0501073_0039812 | 3300049589 | Bacteria | 3329 |
| 546 | Ga0501080_0014166 | 3300049742 | Bacteria | 7339 |
| 547 | Ga0501035_0168491 | 3300049822 | Bacteria | 1893 |
| 548 | Ga0501035_0182448 | 3300049822 | Bacteria | 1808 |
| 549 | Ga0501044_0027240 | 3300049823 | Bacteria | 6042 |
| 550 | Ga0501044_0061163 | 3300049823 | Bacteria | 3853 |
| 551 | Ga0495601_0461962 | 3300053077 | Unclassified | 821 |
| 552 | Ga0495619_0197192 | 3300053085 | Bacteria | 1394 |
| 553 | Ga0500651_0000005 | 3300053093 | Bacteria | 384761 |
| 554 | Ga0500595_000004 | 3300053119 | Bacteria | 410922 |
| 555 | Ga0500595_007997 | 3300053119 | Bacteria | 4343 |
| 556 | Ga0500661_002167 | 3300055283 | Bacteria | 3705 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0092572 | Ga0495629_0092572_1532_2089 | 185 |
| 2 | 3300046472 | Ga0495580_0320237 | Ga0495580_0320237_479_1036 | 185 |
| 3 | 3300048929 | Ga0496126_0742955 | Ga0496126_0742955_45_611 | 188 |
| 4 | 3300044694 | Ga0466963_0010164 | Ga0466963_0010164_1120_1800 | 197 |
| 5 | 3300045976 | Ga0466967_0001893 | Ga0466967_0001893_10660_11340 | 197 |
| 6 | 3300053077 | Ga0495601_0461962 | Ga0495601_0461962_177_809 | 208 |
| 7 | 3300005436 | Ga0070713_100140660 | Ga0070713_1001406602 | 215 |
| 8 | 3300048918 | Ga0496115_0444936 | Ga0496115_0444936_44_715 | 215 |
| 9 | 3300003323 | rootH1_10212810 | rootH1_102128101 | 216 |
| 10 | 3300005327 | Ga0070658_10000121 | Ga0070658_100001214 | 216 |
| 11 | 3300005327 | Ga0070658_10016394 | Ga0070658_100163944 | 216 |
| 12 | 3300005327 | Ga0070658_10024939 | Ga0070658_100249396 | 216 |
| 13 | 3300005327 | Ga0070658_10251170 | Ga0070658_102511702 | 216 |
| 14 | 3300005329 | Ga0070683_100045076 | Ga0070683_1000450764 | 216 |
| 15 | 3300005331 | Ga0070670_100348337 | Ga0070670_1003483371 | 216 |
| 16 | 3300005339 | Ga0070660_100029979 | Ga0070660_1000299793 | 216 |
| 17 | 3300005339 | Ga0070660_100153157 | Ga0070660_1001531572 | 216 |
| 18 | 3300005344 | Ga0070661_100078552 | Ga0070661_1000785522 | 216 |
| 19 | 3300005366 | Ga0070659_100039546 | Ga0070659_1000395462 | 216 |
| 20 | 3300005458 | Ga0070681_10178163 | Ga0070681_101781632 | 216 |
| 21 | 3300005530 | Ga0070679_100092454 | Ga0070679_1000924543 | 216 |
| 22 | 3300005530 | Ga0070679_100106995 | Ga0070679_1001069953 | 216 |
| 23 | 3300005530 | Ga0070679_100754701 | Ga0070679_1007547011 | 216 |
| 24 | 3300005535 | Ga0070684_100294775 | Ga0070684_1002947751 | 216 |
| 25 | 3300005539 | Ga0068853_100000367 | Ga0068853_10000036720 | 216 |
| 26 | 3300005563 | Ga0068855_100011915 | Ga0068855_1000119156 | 216 |
| 27 | 3300005563 | Ga0068855_100035334 | Ga0068855_1000353347 | 216 |
| 28 | 3300005563 | Ga0068855_100052910 | Ga0068855_1000529102 | 216 |
| 29 | 3300005564 | Ga0070664_100058239 | Ga0070664_1000582393 | 216 |
| 30 | 3300005578 | Ga0068854_100000019 | Ga0068854_10000001992 | 216 |
| 31 | 3300005578 | Ga0068854_100130839 | Ga0068854_1001308392 | 216 |
| 32 | 3300005616 | Ga0068852_100286115 | Ga0068852_1002861152 | 216 |
| 33 | 3300005618 | Ga0068864_100403628 | Ga0068864_1004036282 | 216 |
| 34 | 3300005841 | Ga0068863_100315699 | Ga0068863_1003156991 | 216 |
| 35 | 3300006914 | Ga0075436_100009109 | Ga0075436_1000091096 | 216 |
| 36 | 3300009093 | Ga0105240_10010838 | Ga0105240_100108382 | 216 |
| 37 | 3300009093 | Ga0105240_10132371 | Ga0105240_101323713 | 216 |
| 38 | 3300009093 | Ga0105240_10379291 | Ga0105240_103792912 | 216 |
| 39 | 3300009093 | Ga0105240_10663251 | Ga0105240_106632512 | 216 |
| 40 | 3300009174 | Ga0105241_10139161 | Ga0105241_101391612 | 216 |
| 41 | 3300009545 | Ga0105237_10210199 | Ga0105237_102101992 | 216 |
| 42 | 3300009551 | Ga0105238_10996964 | Ga0105238_109969642 | 216 |
| 43 | 3300013104 | Ga0157370_10013763 | Ga0157370_100137636 | 216 |
| 44 | 3300013104 | Ga0157370_10056931 | Ga0157370_100569314 | 216 |
| 45 | 3300013104 | Ga0157370_10144774 | Ga0157370_101447742 | 216 |
| 46 | 3300013104 | Ga0157370_10150526 | Ga0157370_101505262 | 216 |
| 47 | 3300013105 | Ga0157369_10002421 | Ga0157369_1000242119 | 216 |
| 48 | 3300013105 | Ga0157369_10187110 | Ga0157369_101871102 | 216 |
| 49 | 3300013105 | Ga0157369_10247562 | Ga0157369_102475622 | 216 |
| 50 | 3300013105 | Ga0157369_10446063 | Ga0157369_104460632 | 216 |
| 51 | 3300013296 | Ga0157374_10083746 | Ga0157374_100837463 | 216 |
| 52 | 3300013296 | Ga0157374_10652418 | Ga0157374_106524181 | 216 |
| 53 | 3300013307 | Ga0157372_10106002 | Ga0157372_101060023 | 216 |
| 54 | 3300013307 | Ga0157372_10312122 | Ga0157372_103121221 | 216 |
| 55 | 3300013307 | Ga0157372_10320090 | Ga0157372_103200902 | 216 |
| 56 | 3300014325 | Ga0163163_10017757 | Ga0163163_100177575 | 216 |
| 57 | 3300014325 | Ga0163163_10020844 | Ga0163163_100208445 | 216 |
| 58 | 3300020610 | Ga0154015_1016114 | Ga0154015_10161142 | 216 |
| 59 | 3300025904 | Ga0207647_10014872 | Ga0207647_100148726 | 216 |
| 60 | 3300025909 | Ga0207705_10000021 | Ga0207705_10000021238 | 216 |
| 61 | 3300025909 | Ga0207705_10002125 | Ga0207705_100021258 | 216 |
| 62 | 3300025909 | Ga0207705_10027435 | Ga0207705_100274357 | 216 |
| 63 | 3300025909 | Ga0207705_10032912 | Ga0207705_100329124 | 216 |
| 64 | 3300025909 | Ga0207705_10205584 | Ga0207705_102055842 | 216 |
| 65 | 3300025911 | Ga0207654_10156579 | Ga0207654_101565792 | 216 |
| 66 | 3300025912 | Ga0207707_10085789 | Ga0207707_100857893 | 216 |
| 67 | 3300025912 | Ga0207707_10572265 | Ga0207707_105722652 | 216 |
| 68 | 3300025913 | Ga0207695_10033351 | Ga0207695_100333512 | 216 |
| 69 | 3300025913 | Ga0207695_10138447 | Ga0207695_101384472 | 216 |
| 70 | 3300025917 | Ga0207660_10039132 | Ga0207660_100391321 | 216 |
| 71 | 3300025917 | Ga0207660_10047824 | Ga0207660_100478243 | 216 |
| 72 | 3300025919 | Ga0207657_10020248 | Ga0207657_100202485 | 216 |
| 73 | 3300025919 | Ga0207657_10022299 | Ga0207657_100222994 | 216 |
| 74 | 3300025920 | Ga0207649_10054539 | Ga0207649_100545393 | 216 |
| 75 | 3300025921 | Ga0207652_10041920 | Ga0207652_100419204 | 216 |
| 76 | 3300025924 | Ga0207694_10245121 | Ga0207694_102451211 | 216 |
| 77 | 3300025925 | Ga0207650_10141600 | Ga0207650_101416003 | 216 |
| 78 | 3300025929 | Ga0207664_10064130 | Ga0207664_100641302 | 216 |
| 79 | 3300025944 | Ga0207661_10059682 | Ga0207661_100596822 | 216 |
| 80 | 3300025945 | Ga0207679_10061885 | Ga0207679_100618853 | 216 |
| 81 | 3300025949 | Ga0207667_10012818 | Ga0207667_100128187 | 216 |
| 82 | 3300025949 | Ga0207667_10026234 | Ga0207667_100262341 | 216 |
| 83 | 3300025949 | Ga0207667_10073432 | Ga0207667_100734322 | 216 |
| 84 | 3300025949 | Ga0207667_10212215 | Ga0207667_102122153 | 216 |
| 85 | 3300025981 | Ga0207640_10000028 | Ga0207640_1000002824 | 216 |
| 86 | 3300026041 | Ga0207639_10000371 | Ga0207639_1000037115 | 216 |
| 87 | 3300026041 | Ga0207639_10102623 | Ga0207639_101026233 | 216 |
| 88 | 3300026067 | Ga0207678_10003339 | Ga0207678_100033392 | 216 |
| 89 | 3300026067 | Ga0207678_10149736 | Ga0207678_101497364 | 216 |
| 90 | 3300026088 | Ga0207641_10383631 | Ga0207641_103836311 | 216 |
| 91 | 3300026095 | Ga0207676_10495121 | Ga0207676_104951211 | 216 |
| 92 | 3300026116 | Ga0207674_10005472 | Ga0207674_100054722 | 216 |
| 93 | 3300026116 | Ga0207674_10705703 | Ga0207674_107057032 | 216 |
| 94 | 3300028800 | Ga0265338_10017734 | Ga0265338_100177342 | 216 |
| 95 | 3300029957 | Ga0265324_10009104 | Ga0265324_100091042 | 216 |
| 96 | 3300031239 | Ga0265328_10005053 | Ga0265328_100050532 | 216 |
| 97 | 3300031249 | Ga0265339_10000124 | Ga0265339_1000012420 | 216 |
| 98 | 3300031344 | Ga0265316_10006699 | Ga0265316_100066996 | 216 |
| 99 | 3300031595 | Ga0265313_10093326 | Ga0265313_100933262 | 216 |
| 100 | 3300031711 | Ga0265314_10002987 | Ga0265314_100029876 | 216 |
| 101 | 3300031712 | Ga0265342_10027916 | Ga0265342_100279162 | 216 |
| 102 | 3300035119 | Ga0373956_0021847 | Ga0373956_0021847_451_1131 | 216 |
| 103 | 3300035172 | Ga0373955_0007147 | Ga0373955_0007147_676_1356 | 216 |
| 104 | 3300036401 | Ga0373937_0019961 | Ga0373937_0019961_721_1401 | 216 |
| 105 | 3300036401 | Ga0373937_0266593 | Ga0373937_0266593_377_1057 | 216 |
| 106 | 3300037418 | Ga0395900_0025848 | Ga0395900_0025848_850_1524 | 216 |
| 107 | 3300037466 | Ga0395898_0027814 | Ga0395898_0027814_2462_3136 | 216 |
| 108 | 3300037466 | Ga0395898_0459394 | Ga0395898_0459394_240_914 | 216 |
| 109 | 3300044684 | Ga0466966_0256512 | Ga0466966_0256512_336_1010 | 216 |
| 110 | 3300044693 | Ga0466961_0305674 | Ga0466961_0305674_243_917 | 216 |
| 111 | 3300045836 | Ga0466958_0007910 | Ga0466958_0007910_3197_3871 | 216 |
| 112 | 3300045836 | Ga0466958_0219357 | Ga0466958_0219357_191_865 | 216 |
| 113 | 3300045976 | Ga0466967_0046813 | Ga0466967_0046813_2383_3057 | 216 |
| 114 | 3300046472 | Ga0495580_0089761 | Ga0495580_0089761_483_1163 | 216 |
| 115 | 3300046473 | Ga0495582_0080396 | Ga0495582_0080396_259_939 | 216 |
| 116 | 3300046499 | Ga0495594_0056792 | Ga0495594_0056792_892_1572 | 216 |
| 117 | 3300046559 | Ga0495667_0161695 | Ga0495667_0161695_248_928 | 216 |
| 118 | 3300046663 | Ga0495635_0197292 | Ga0495635_0197292_230_910 | 216 |
| 119 | 3300047472 | Ga0495686_0016441 | Ga0495686_0016441_1133_1807 | 216 |
| 120 | 3300048909 | Ga0496106_0042478 | Ga0496106_0042478_393_1073 | 216 |
| 121 | 3300048910 | Ga0496107_0250908 | Ga0496107_0250908_113_793 | 216 |
| 122 | 3300048915 | Ga0496112_0021005 | Ga0496112_0021005_2454_3134 | 216 |
| 123 | 3300048916 | Ga0496113_0102885 | Ga0496113_0102885_866_1546 | 216 |
| 124 | 3300049460 | Ga0495682_0184060 | Ga0495682_0184060_55_729 | 216 |
| 125 | 3300053085 | Ga0495619_0197192 | Ga0495619_0197192_481_1161 | 216 |
| 126 | 3300005327 | Ga0070658_10079725 | Ga0070658_100797252 | 217 |
| 127 | 3300005329 | Ga0070683_100002041 | Ga0070683_1000020417 | 217 |
| 128 | 3300005329 | Ga0070683_100019183 | Ga0070683_1000191836 | 217 |
| 129 | 3300005329 | Ga0070683_100060569 | Ga0070683_1000605692 | 217 |
| 130 | 3300005334 | Ga0068869_100001577 | Ga0068869_10000157711 | 217 |
| 131 | 3300005338 | Ga0068868_100000066 | Ga0068868_10000006625 | 217 |
| 132 | 3300005344 | Ga0070661_100026342 | Ga0070661_1000263425 | 217 |
| 133 | 3300005344 | Ga0070661_100035316 | Ga0070661_1000353164 | 217 |
| 134 | 3300005344 | Ga0070661_100240572 | Ga0070661_1002405722 | 217 |
| 135 | 3300005355 | Ga0070671_100007733 | Ga0070671_1000077332 | 217 |
| 136 | 3300005355 | Ga0070671_100198513 | Ga0070671_1001985131 | 217 |
| 137 | 3300005367 | Ga0070667_100046288 | Ga0070667_1000462885 | 217 |
| 138 | 3300005435 | Ga0070714_100002654 | Ga0070714_10000265412 | 217 |
| 139 | 3300005436 | Ga0070713_100262209 | Ga0070713_1002622092 | 217 |
| 140 | 3300005535 | Ga0070684_100043733 | Ga0070684_1000437332 | 217 |
| 141 | 3300005535 | Ga0070684_100117871 | Ga0070684_1001178712 | 217 |
| 142 | 3300005539 | Ga0068853_100000222 | Ga0068853_10000022229 | 217 |
| 143 | 3300005539 | Ga0068853_100107800 | Ga0068853_1001078003 | 217 |
| 144 | 3300005539 | Ga0068853_100115336 | Ga0068853_1001153362 | 217 |
| 145 | 3300005539 | Ga0068853_100449619 | Ga0068853_1004496191 | 217 |
| 146 | 3300005548 | Ga0070665_100005637 | Ga0070665_1000056378 | 217 |
| 147 | 3300005563 | Ga0068855_100000277 | Ga0068855_10000027724 | 217 |
| 148 | 3300005563 | Ga0068855_100002688 | Ga0068855_10000268811 | 217 |
| 149 | 3300005563 | Ga0068855_100060121 | Ga0068855_1000601212 | 217 |
| 150 | 3300005577 | Ga0068857_100003191 | Ga0068857_1000031917 | 217 |
| 151 | 3300005577 | Ga0068857_100048791 | Ga0068857_1000487913 | 217 |
| 152 | 3300005577 | Ga0068857_100114600 | Ga0068857_1001146002 | 217 |
| 153 | 3300005578 | Ga0068854_100437872 | Ga0068854_1004378722 | 217 |
| 154 | 3300005614 | Ga0068856_100003529 | Ga0068856_10000352910 | 217 |
| 155 | 3300005614 | Ga0068856_100041779 | Ga0068856_1000417794 | 217 |
| 156 | 3300005616 | Ga0068852_100000019 | Ga0068852_10000001981 | 217 |
| 157 | 3300005616 | Ga0068852_100000097 | Ga0068852_10000009733 | 217 |
| 158 | 3300005616 | Ga0068852_100032008 | Ga0068852_1000320082 | 217 |
| 159 | 3300005618 | Ga0068864_100000625 | Ga0068864_1000006254 | 217 |
| 160 | 3300005834 | Ga0068851_10085117 | Ga0068851_100851172 | 217 |
| 161 | 3300005841 | Ga0068863_100001753 | Ga0068863_1000017539 | 217 |
| 162 | 3300005842 | Ga0068858_100014586 | Ga0068858_1000145866 | 217 |
| 163 | 3300005843 | Ga0068860_100000689 | Ga0068860_1000006899 | 217 |
| 164 | 3300006237 | Ga0097621_100000349 | Ga0097621_10000034915 | 217 |
| 165 | 3300006358 | Ga0068871_100002325 | Ga0068871_1000023259 | 217 |
| 166 | 3300009093 | Ga0105240_10000372 | Ga0105240_1000037259 | 217 |
| 167 | 3300009093 | Ga0105240_10000496 | Ga0105240_1000049658 | 217 |
| 168 | 3300009093 | Ga0105240_10030875 | Ga0105240_100308754 | 217 |
| 169 | 3300009093 | Ga0105240_10064615 | Ga0105240_100646155 | 217 |
| 170 | 3300009093 | Ga0105240_10087131 | Ga0105240_100871311 | 217 |
| 171 | 3300009098 | Ga0105245_10000486 | Ga0105245_1000048626 | 217 |
| 172 | 3300009098 | Ga0105245_10504514 | Ga0105245_105045142 | 217 |
| 173 | 3300009101 | Ga0105247_10002346 | Ga0105247_100023467 | 217 |
| 174 | 3300009174 | Ga0105241_10000026 | Ga0105241_1000002622 | 217 |
| 175 | 3300009174 | Ga0105241_10000121 | Ga0105241_1000012112 | 217 |
| 176 | 3300009174 | Ga0105241_10002032 | Ga0105241_100020322 | 217 |
| 177 | 3300009174 | Ga0105241_10179856 | Ga0105241_101798562 | 217 |
| 178 | 3300009177 | Ga0105248_10007017 | Ga0105248_1000701713 | 217 |
| 179 | 3300009177 | Ga0105248_10029618 | Ga0105248_100296186 | 217 |
| 180 | 3300009545 | Ga0105237_10000590 | Ga0105237_100005906 | 217 |
| 181 | 3300009545 | Ga0105237_10006331 | Ga0105237_1000633112 | 217 |
| 182 | 3300009545 | Ga0105237_10167008 | Ga0105237_101670082 | 217 |
| 183 | 3300009545 | Ga0105237_10215892 | Ga0105237_102158922 | 217 |
| 184 | 3300009551 | Ga0105238_10000197 | Ga0105238_1000019723 | 217 |
| 185 | 3300009551 | Ga0105238_10000509 | Ga0105238_1000050925 | 217 |
| 186 | 3300009551 | Ga0105238_10054460 | Ga0105238_100544604 | 217 |
| 187 | 3300009551 | Ga0105238_10207045 | Ga0105238_102070452 | 217 |
| 188 | 3300009551 | Ga0105238_11025474 | Ga0105238_110254741 | 217 |
| 189 | 3300010375 | Ga0105239_10001533 | Ga0105239_1000153327 | 217 |
| 190 | 3300010375 | Ga0105239_10003046 | Ga0105239_1000304620 | 217 |
| 191 | 3300010375 | Ga0105239_10047654 | Ga0105239_100476544 | 217 |
| 192 | 3300010375 | Ga0105239_10129889 | Ga0105239_101298894 | 217 |
| 193 | 3300011119 | Ga0105246_10001192 | Ga0105246_1000119211 | 217 |
| 194 | 3300013100 | Ga0157373_10273517 | Ga0157373_102735172 | 217 |
| 195 | 3300013105 | Ga0157369_10000085 | Ga0157369_1000008580 | 217 |
| 196 | 3300013105 | Ga0157369_10000430 | Ga0157369_1000043031 | 217 |
| 197 | 3300013105 | Ga0157369_10069226 | Ga0157369_100692263 | 217 |
| 198 | 3300013296 | Ga0157374_10023020 | Ga0157374_100230205 | 217 |
| 199 | 3300013296 | Ga0157374_10652854 | Ga0157374_106528541 | 217 |
| 200 | 3300013297 | Ga0157378_10004251 | Ga0157378_1000425111 | 217 |
| 201 | 3300013297 | Ga0157378_10117504 | Ga0157378_101175042 | 217 |
| 202 | 3300013297 | Ga0157378_10340671 | Ga0157378_103406712 | 217 |
| 203 | 3300013306 | Ga0163162_10115403 | Ga0163162_101154032 | 217 |
| 204 | 3300013307 | Ga0157372_10000217 | Ga0157372_1000021749 | 217 |
| 205 | 3300013307 | Ga0157372_10020181 | Ga0157372_100201817 | 217 |
| 206 | 3300013307 | Ga0157372_10117248 | Ga0157372_101172482 | 217 |
| 207 | 3300013307 | Ga0157372_10300417 | Ga0157372_103004172 | 217 |
| 208 | 3300013307 | Ga0157372_10373289 | Ga0157372_103732892 | 217 |
| 209 | 3300013308 | Ga0157375_10067022 | Ga0157375_100670222 | 217 |
| 210 | 3300013308 | Ga0157375_10518255 | Ga0157375_105182552 | 217 |
| 211 | 3300014325 | Ga0163163_10001161 | Ga0163163_100011617 | 217 |
| 212 | 3300014497 | Ga0182008_10170467 | Ga0182008_101704672 | 217 |
| 213 | 3300014968 | Ga0157379_10002312 | Ga0157379_100023126 | 217 |
| 214 | 3300014968 | Ga0157379_10606583 | Ga0157379_106065831 | 217 |
| 215 | 3300014969 | Ga0157376_10000296 | Ga0157376_100002962 | 217 |
| 216 | 3300025321 | Ga0207656_10021009 | Ga0207656_100210092 | 217 |
| 217 | 3300025321 | Ga0207656_10056823 | Ga0207656_100568232 | 217 |
| 218 | 3300025321 | Ga0207656_10165533 | Ga0207656_101655332 | 217 |
| 219 | 3300025911 | Ga0207654_10000054 | Ga0207654_1000005456 | 217 |
| 220 | 3300025911 | Ga0207654_10026092 | Ga0207654_100260923 | 217 |
| 221 | 3300025911 | Ga0207654_10122981 | Ga0207654_101229812 | 217 |
| 222 | 3300025913 | Ga0207695_10000080 | Ga0207695_10000080201 | 217 |
| 223 | 3300025913 | Ga0207695_10000113 | Ga0207695_10000113159 | 217 |
| 224 | 3300025913 | Ga0207695_10000167 | Ga0207695_10000167107 | 217 |
| 225 | 3300025913 | Ga0207695_10105111 | Ga0207695_101051114 | 217 |
| 226 | 3300025914 | Ga0207671_10000065 | Ga0207671_1000006575 | 217 |
| 227 | 3300025914 | Ga0207671_10000123 | Ga0207671_1000012390 | 217 |
| 228 | 3300025914 | Ga0207671_10000139 | Ga0207671_1000013958 | 217 |
| 229 | 3300025914 | Ga0207671_10380688 | Ga0207671_103806882 | 217 |
| 230 | 3300025920 | Ga0207649_10171445 | Ga0207649_101714452 | 217 |
| 231 | 3300025924 | Ga0207694_10000248 | Ga0207694_1000024831 | 217 |
| 232 | 3300025924 | Ga0207694_10000711 | Ga0207694_100007112 | 217 |
| 233 | 3300025924 | Ga0207694_10177601 | Ga0207694_101776012 | 217 |
| 234 | 3300025925 | Ga0207650_10552744 | Ga0207650_105527441 | 217 |
| 235 | 3300025927 | Ga0207687_10000978 | Ga0207687_1000097812 | 217 |
| 236 | 3300025928 | Ga0207700_10506661 | Ga0207700_105066612 | 217 |
| 237 | 3300025929 | Ga0207664_10017916 | Ga0207664_100179167 | 217 |
| 238 | 3300025931 | Ga0207644_10004420 | Ga0207644_100044207 | 217 |
| 239 | 3300025931 | Ga0207644_10215112 | Ga0207644_102151122 | 217 |
| 240 | 3300025941 | Ga0207711_10043809 | Ga0207711_100438093 | 217 |
| 241 | 3300025942 | Ga0207689_10000724 | Ga0207689_1000072428 | 217 |
| 242 | 3300025944 | Ga0207661_10001283 | Ga0207661_100012839 | 217 |
| 243 | 3300025944 | Ga0207661_10138935 | Ga0207661_101389352 | 217 |
| 244 | 3300025944 | Ga0207661_10433514 | Ga0207661_104335143 | 217 |
| 245 | 3300025949 | Ga0207667_10006194 | Ga0207667_1000619410 | 217 |
| 246 | 3300025949 | Ga0207667_10009516 | Ga0207667_1000951611 | 217 |
| 247 | 3300025949 | Ga0207667_10035816 | Ga0207667_100358166 | 217 |
| 248 | 3300025981 | Ga0207640_10020918 | Ga0207640_100209183 | 217 |
| 249 | 3300025981 | Ga0207640_10354319 | Ga0207640_103543192 | 217 |
| 250 | 3300025986 | Ga0207658_10003428 | Ga0207658_100034289 | 217 |
| 251 | 3300026023 | Ga0207677_10000143 | Ga0207677_1000014325 | 217 |
| 252 | 3300026023 | Ga0207677_10585248 | Ga0207677_105852482 | 217 |
| 253 | 3300026035 | Ga0207703_10004820 | Ga0207703_100048209 | 217 |
| 254 | 3300026041 | Ga0207639_10000088 | Ga0207639_1000008814 | 217 |
| 255 | 3300026041 | Ga0207639_10016992 | Ga0207639_100169925 | 217 |
| 256 | 3300026041 | Ga0207639_10339955 | Ga0207639_103399552 | 217 |
| 257 | 3300026078 | Ga0207702_10001334 | Ga0207702_100013346 | 217 |
| 258 | 3300026078 | Ga0207702_10002672 | Ga0207702_100026722 | 217 |
| 259 | 3300026078 | Ga0207702_10084650 | Ga0207702_100846502 | 217 |
| 260 | 3300026095 | Ga0207676_10002595 | Ga0207676_100025953 | 217 |
| 261 | 3300026116 | Ga0207674_10000669 | Ga0207674_1000066914 | 217 |
| 262 | 3300026116 | Ga0207674_10048839 | Ga0207674_100488394 | 217 |
| 263 | 3300026116 | Ga0207674_10430583 | Ga0207674_104305831 | 217 |
| 264 | 3300026142 | Ga0207698_10000003 | Ga0207698_10000003234 | 217 |
| 265 | 3300026142 | Ga0207698_10000708 | Ga0207698_100007086 | 217 |
| 266 | 3300026142 | Ga0207698_10099445 | Ga0207698_100994452 | 217 |
| 267 | 3300026142 | Ga0207698_10105923 | Ga0207698_101059233 | 217 |
| 268 | 3300026142 | Ga0207698_10144796 | Ga0207698_101447962 | 217 |
| 269 | 3300028379 | Ga0268266_10008807 | Ga0268266_100088074 | 217 |
| 270 | 3300028381 | Ga0268264_10000598 | Ga0268264_1000059822 | 217 |
| 271 | 3300028800 | Ga0265338_10117655 | Ga0265338_101176552 | 217 |
| 272 | 3300028800 | Ga0265338_10225494 | Ga0265338_102254942 | 217 |
| 273 | 3300031090 | Ga0265760_10133851 | Ga0265760_101338511 | 217 |
| 274 | 3300031235 | Ga0265330_10000273 | Ga0265330_1000027329 | 217 |
| 275 | 3300031235 | Ga0265330_10116345 | Ga0265330_101163452 | 217 |
| 276 | 3300031241 | Ga0265325_10000266 | Ga0265325_1000026627 | 217 |
| 277 | 3300031241 | Ga0265325_10023750 | Ga0265325_100237504 | 217 |
| 278 | 3300031241 | Ga0265325_10024784 | Ga0265325_100247843 | 217 |
| 279 | 3300031247 | Ga0265340_10012505 | Ga0265340_100125052 | 217 |
| 280 | 3300031249 | Ga0265339_10000194 | Ga0265339_1000019413 | 217 |
| 281 | 3300031249 | Ga0265339_10009288 | Ga0265339_100092885 | 217 |
| 282 | 3300031344 | Ga0265316_10003105 | Ga0265316_100031057 | 217 |
| 283 | 3300031344 | Ga0265316_10012685 | Ga0265316_100126856 | 217 |
| 284 | 3300031595 | Ga0265313_10002216 | Ga0265313_1000221612 | 217 |
| 285 | 3300031595 | Ga0265313_10005380 | Ga0265313_100053802 | 217 |
| 286 | 3300031595 | Ga0265313_10021496 | Ga0265313_100214962 | 217 |
| 287 | 3300031711 | Ga0265314_10021888 | Ga0265314_100218882 | 217 |
| 288 | 3300031712 | Ga0265342_10000225 | Ga0265342_1000022529 | 217 |
| 289 | 3300031712 | Ga0265342_10001536 | Ga0265342_100015369 | 217 |
| 290 | 3300031712 | Ga0265342_10181726 | Ga0265342_101817262 | 217 |
| 291 | 3300036401 | Ga0373937_0297238 | Ga0373937_0297238_69_746 | 217 |
| 292 | 3300044694 | Ga0466963_0000494 | Ga0466963_0000494_9897_10574 | 217 |
| 293 | 3300044694 | Ga0466963_0215755 | Ga0466963_0215755_247_930 | 217 |
| 294 | 3300045976 | Ga0466967_0001401 | Ga0466967_0001401_9809_10486 | 217 |
| 295 | 3300046689 | Ga0495613_0164464 | Ga0495613_0164464_814_1491 | 217 |
| 296 | 3300048088 | Ga0495602_0446209 | Ga0495602_0446209_138_815 | 217 |
| 297 | 3300048903 | Ga0496100_0062884 | Ga0496100_0062884_1485_2162 | 217 |
| 298 | 3300048907 | Ga0496104_0187129 | Ga0496104_0187129_162_839 | 217 |
| 299 | 3300048909 | Ga0496106_0141941 | Ga0496106_0141941_546_1223 | 217 |
| 300 | 3300048917 | Ga0496114_0203080 | Ga0496114_0203080_644_1321 | 217 |
| 301 | 3300048917 | Ga0496114_0523799 | Ga0496114_0523799_81_758 | 217 |
| 302 | 3300048918 | Ga0496115_0240623 | Ga0496115_0240623_347_1024 | 217 |
| 303 | 3300048929 | Ga0496126_0032919 | Ga0496126_0032919_1305_1982 | 217 |
| 304 | 3300014969 | Ga0157376_10023888 | Ga0157376_100238885 | 219 |
| 305 | 3300048921 | Ga0496118_0174174 | Ga0496118_0174174_282_965 | 219 |
| 306 | 3300005614 | Ga0068856_100730844 | Ga0068856_1007308442 | 220 |
| 307 | 3300005983 | Ga0081540_1004351 | Ga0081540_10043516 | 220 |
| 308 | 3300009148 | Ga0105243_10008481 | Ga0105243_100084815 | 220 |
| 309 | 3300009177 | Ga0105248_10006539 | Ga0105248_100065399 | 220 |
| 310 | 3300025913 | Ga0207695_10188139 | Ga0207695_101881392 | 220 |
| 311 | 3300025935 | Ga0207709_10017040 | Ga0207709_100170404 | 220 |
| 312 | 3300025941 | Ga0207711_10014059 | Ga0207711_100140597 | 220 |
| 313 | 3300044656 | Ga0466969_0024581 | Ga0466969_0024581_2145_2831 | 220 |
| 314 | 3300044684 | Ga0466966_0382439 | Ga0466966_0382439_146_832 | 220 |
| 315 | 3300044693 | Ga0466961_0122066 | Ga0466961_0122066_781_1467 | 220 |
| 316 | 3300031239 | Ga0265328_10049572 | Ga0265328_100495723 | 221 |
| 317 | 3300014968 | Ga0157379_10157854 | Ga0157379_101578543 | 222 |
| 318 | 3300003320 | rootH2_10009426 | rootH2_1000942611 | 224 |
| 319 | 3300000546 | LJNas_1005829 | LJNas_10058292 | 225 |
| 320 | 3300005327 | Ga0070658_10237104 | Ga0070658_102371041 | 225 |
| 321 | 3300005327 | Ga0070658_10345814 | Ga0070658_103458141 | 225 |
| 322 | 3300005329 | Ga0070683_100397430 | Ga0070683_1003974301 | 225 |
| 323 | 3300005337 | Ga0070682_100088991 | Ga0070682_1000889912 | 225 |
| 324 | 3300005339 | Ga0070660_100080584 | Ga0070660_1000805843 | 225 |
| 325 | 3300005355 | Ga0070671_100019026 | Ga0070671_1000190264 | 225 |
| 326 | 3300005355 | Ga0070671_100474754 | Ga0070671_1004747542 | 225 |
| 327 | 3300005366 | Ga0070659_100125529 | Ga0070659_1001255293 | 225 |
| 328 | 3300005435 | Ga0070714_100243936 | Ga0070714_1002439362 | 225 |
| 329 | 3300005436 | Ga0070713_100202201 | Ga0070713_1002022012 | 225 |
| 330 | 3300005455 | Ga0070663_100088869 | Ga0070663_1000888692 | 225 |
| 331 | 3300005530 | Ga0070679_100083871 | Ga0070679_1000838712 | 225 |
| 332 | 3300005535 | Ga0070684_100378336 | Ga0070684_1003783362 | 225 |
| 333 | 3300005539 | Ga0068853_100067118 | Ga0068853_1000671183 | 225 |
| 334 | 3300005539 | Ga0068853_100429508 | Ga0068853_1004295082 | 225 |
| 335 | 3300005548 | Ga0070665_100035648 | Ga0070665_1000356484 | 225 |
| 336 | 3300005548 | Ga0070665_100303206 | Ga0070665_1003032063 | 225 |
| 337 | 3300005563 | Ga0068855_100010384 | Ga0068855_1000103845 | 225 |
| 338 | 3300005563 | Ga0068855_100110833 | Ga0068855_1001108333 | 225 |
| 339 | 3300005563 | Ga0068855_100127193 | Ga0068855_1001271933 | 225 |
| 340 | 3300005563 | Ga0068855_100187371 | Ga0068855_1001873711 | 225 |
| 341 | 3300005563 | Ga0068855_100264509 | Ga0068855_1002645092 | 225 |
| 342 | 3300005614 | Ga0068856_100062110 | Ga0068856_1000621101 | 225 |
| 343 | 3300005616 | Ga0068852_100068135 | Ga0068852_1000681352 | 225 |
| 344 | 3300005616 | Ga0068852_100259189 | Ga0068852_1002591892 | 225 |
| 345 | 3300005616 | Ga0068852_100264972 | Ga0068852_1002649722 | 225 |
| 346 | 3300005618 | Ga0068864_100086854 | Ga0068864_1000868542 | 225 |
| 347 | 3300005841 | Ga0068863_100001814 | Ga0068863_1000018146 | 225 |
| 348 | 3300006028 | Ga0070717_10523552 | Ga0070717_105235521 | 225 |
| 349 | 3300006175 | Ga0070712_100658460 | Ga0070712_1006584601 | 225 |
| 350 | 3300009093 | Ga0105240_10009346 | Ga0105240_100093469 | 225 |
| 351 | 3300009093 | Ga0105240_10244112 | Ga0105240_102441121 | 225 |
| 352 | 3300009093 | Ga0105240_11152276 | Ga0105240_111522761 | 225 |
| 353 | 3300009177 | Ga0105248_10016372 | Ga0105248_1001637212 | 225 |
| 354 | 3300009177 | Ga0105248_10039332 | Ga0105248_100393322 | 225 |
| 355 | 3300009177 | Ga0105248_10108464 | Ga0105248_101084642 | 225 |
| 356 | 3300009177 | Ga0105248_10131792 | Ga0105248_101317923 | 225 |
| 357 | 3300009545 | Ga0105237_10055825 | Ga0105237_100558253 | 225 |
| 358 | 3300009551 | Ga0105238_10111078 | Ga0105238_101110782 | 225 |
| 359 | 3300009551 | Ga0105238_10309477 | Ga0105238_103094772 | 225 |
| 360 | 3300009551 | Ga0105238_10556750 | Ga0105238_105567502 | 225 |
| 361 | 3300009553 | Ga0105249_10003449 | Ga0105249_100034499 | 225 |
| 362 | 3300013102 | Ga0157371_10118539 | Ga0157371_101185392 | 225 |
| 363 | 3300013102 | Ga0157371_10321687 | Ga0157371_103216872 | 225 |
| 364 | 3300013104 | Ga0157370_10143683 | Ga0157370_101436832 | 225 |
| 365 | 3300013104 | Ga0157370_10337514 | Ga0157370_103375142 | 225 |
| 366 | 3300013105 | Ga0157369_10009218 | Ga0157369_1000921811 | 225 |
| 367 | 3300013105 | Ga0157369_10010533 | Ga0157369_100105333 | 225 |
| 368 | 3300013105 | Ga0157369_10012659 | Ga0157369_100126591 | 225 |
| 369 | 3300013105 | Ga0157369_10330569 | Ga0157369_103305692 | 225 |
| 370 | 3300013105 | Ga0157369_10373773 | Ga0157369_103737733 | 225 |
| 371 | 3300013105 | Ga0157369_10399786 | Ga0157369_103997861 | 225 |
| 372 | 3300013105 | Ga0157369_10591061 | Ga0157369_105910613 | 225 |
| 373 | 3300013296 | Ga0157374_10035016 | Ga0157374_100350164 | 225 |
| 374 | 3300013306 | Ga0163162_10043334 | Ga0163162_100433342 | 225 |
| 375 | 3300013306 | Ga0163162_10692608 | Ga0163162_106926081 | 225 |
| 376 | 3300013307 | Ga0157372_10072143 | Ga0157372_100721435 | 225 |
| 377 | 3300013307 | Ga0157372_10226977 | Ga0157372_102269772 | 225 |
| 378 | 3300013307 | Ga0157372_10308318 | Ga0157372_103083182 | 225 |
| 379 | 3300013307 | Ga0157372_10835314 | Ga0157372_108353142 | 225 |
| 380 | 3300013308 | Ga0157375_10157485 | Ga0157375_101574853 | 225 |
| 381 | 3300014325 | Ga0163163_10192750 | Ga0163163_101927502 | 225 |
| 382 | 3300014969 | Ga0157376_10032166 | Ga0157376_100321663 | 225 |
| 383 | 3300014969 | Ga0157376_11002475 | Ga0157376_110024751 | 225 |
| 384 | 3300024227 | Ga0228598_1028824 | Ga0228598_10288241 | 225 |
| 385 | 3300025233 | Ga0209437_108001 | Ga0209437_1080012 | 225 |
| 386 | 3300025261 | Ga0209233_1001442 | Ga0209233_10014429 | 225 |
| 387 | 3300025909 | Ga0207705_10041847 | Ga0207705_100418472 | 225 |
| 388 | 3300025909 | Ga0207705_10080943 | Ga0207705_100809432 | 225 |
| 389 | 3300025909 | Ga0207705_10167344 | Ga0207705_101673442 | 225 |
| 390 | 3300025912 | Ga0207707_10337448 | Ga0207707_103374481 | 225 |
| 391 | 3300025913 | Ga0207695_10000263 | Ga0207695_1000026321 | 225 |
| 392 | 3300025913 | Ga0207695_10607515 | Ga0207695_106075151 | 225 |
| 393 | 3300025914 | Ga0207671_10068441 | Ga0207671_100684413 | 225 |
| 394 | 3300025915 | Ga0207693_10540728 | Ga0207693_105407281 | 225 |
| 395 | 3300025919 | Ga0207657_10114026 | Ga0207657_101140261 | 225 |
| 396 | 3300025921 | Ga0207652_10115347 | Ga0207652_101153471 | 225 |
| 397 | 3300025921 | Ga0207652_10285488 | Ga0207652_102854881 | 225 |
| 398 | 3300025924 | Ga0207694_10086769 | Ga0207694_100867691 | 225 |
| 399 | 3300025924 | Ga0207694_10248546 | Ga0207694_102485462 | 225 |
| 400 | 3300025928 | Ga0207700_10381105 | Ga0207700_103811052 | 225 |
| 401 | 3300025932 | Ga0207690_10084349 | Ga0207690_100843493 | 225 |
| 402 | 3300025941 | Ga0207711_10058450 | Ga0207711_100584502 | 225 |
| 403 | 3300025941 | Ga0207711_10155934 | Ga0207711_101559342 | 225 |
| 404 | 3300025941 | Ga0207711_10903978 | Ga0207711_109039781 | 225 |
| 405 | 3300025944 | Ga0207661_10314799 | Ga0207661_103147992 | 225 |
| 406 | 3300025949 | Ga0207667_10007633 | Ga0207667_1000763315 | 225 |
| 407 | 3300025949 | Ga0207667_10025432 | Ga0207667_100254324 | 225 |
| 408 | 3300025961 | Ga0207712_10030122 | Ga0207712_100301223 | 225 |
| 409 | 3300026041 | Ga0207639_10194100 | Ga0207639_101941001 | 225 |
| 410 | 3300026041 | Ga0207639_10259218 | Ga0207639_102592181 | 225 |
| 411 | 3300026067 | Ga0207678_10017744 | Ga0207678_100177444 | 225 |
| 412 | 3300026067 | Ga0207678_10056161 | Ga0207678_100561613 | 225 |
| 413 | 3300026095 | Ga0207676_10052862 | Ga0207676_100528623 | 225 |
| 414 | 3300028379 | Ga0268266_10005265 | Ga0268266_1000526514 | 225 |
| 415 | 3300028379 | Ga0268266_10006399 | Ga0268266_100063992 | 225 |
| 416 | 3300033180 | Ga0307510_10071107 | Ga0307510_100711073 | 225 |
| 417 | 3300033180 | Ga0307510_10094785 | Ga0307510_100947852 | 225 |
| 418 | 3300036401 | Ga0373937_0180871 | Ga0373937_0180871_1179_1931 | 225 |
| 419 | 3300037068 | Ga0373925_0401553 | Ga0373925_0401553_398_1102 | 225 |
| 420 | 3300042005 | Ga0439448_0015255 | Ga0439448_0015255_305_1006 | 225 |
| 421 | 3300044684 | Ga0466966_0040099 | Ga0466966_0040099_989_1690 | 225 |
| 422 | 3300044694 | Ga0466963_0098713 | Ga0466963_0098713_1115_1816 | 225 |
| 423 | 3300046454 | Ga0495592_0418821 | Ga0495592_0418821_62_766 | 225 |
| 424 | 3300046455 | Ga0495603_0009924 | Ga0495603_0009924_1094_1771 | 225 |
| 425 | 3300046459 | Ga0495629_0011020 | Ga0495629_0011020_1624_2301 | 225 |
| 426 | 3300046459 | Ga0495629_0190528 | Ga0495629_0190528_575_1252 | 225 |
| 427 | 3300046462 | Ga0495651_0290033 | Ga0495651_0290033_230_907 | 225 |
| 428 | 3300046471 | Ga0495650_0000038 | Ga0495650_0000038_186789_187466 | 225 |
| 429 | 3300046471 | Ga0495650_0002342 | Ga0495650_0002342_13077_13778 | 225 |
| 430 | 3300046472 | Ga0495580_0103353 | Ga0495580_0103353_215_892 | 225 |
| 431 | 3300046472 | Ga0495580_0447252 | Ga0495580_0447252_93_794 | 225 |
| 432 | 3300046473 | Ga0495582_0001853 | Ga0495582_0001853_5042_5719 | 225 |
| 433 | 3300046473 | Ga0495582_0067225 | Ga0495582_0067225_1279_1956 | 225 |
| 434 | 3300046475 | Ga0495639_0004538 | Ga0495639_0004538_4172_4849 | 225 |
| 435 | 3300046476 | Ga0495662_0006308 | Ga0495662_0006308_664_1341 | 225 |
| 436 | 3300046477 | Ga0495664_0001348 | Ga0495664_0001348_5836_6513 | 225 |
| 437 | 3300046477 | Ga0495664_0049296 | Ga0495664_0049296_1735_2412 | 225 |
| 438 | 3300046477 | Ga0495664_0065290 | Ga0495664_0065290_1248_2000 | 225 |
| 439 | 3300046492 | Ga0495585_0025037 | Ga0495585_0025037_1178_1855 | 225 |
| 440 | 3300046499 | Ga0495594_0001190 | Ga0495594_0001190_7003_7680 | 225 |
| 441 | 3300046499 | Ga0495594_0004431 | Ga0495594_0004431_3810_4487 | 225 |
| 442 | 3300046499 | Ga0495594_0043704 | Ga0495594_0043704_758_1435 | 225 |
| 443 | 3300046500 | Ga0495596_0116450 | Ga0495596_0116450_261_938 | 225 |
| 444 | 3300046507 | Ga0495606_0024321 | Ga0495606_0024321_2841_3545 | 225 |
| 445 | 3300046507 | Ga0495606_0026137 | Ga0495606_0026137_2724_3401 | 225 |
| 446 | 3300046514 | Ga0495618_0037508 | Ga0495618_0037508_1183_1860 | 225 |
| 447 | 3300046516 | Ga0495628_0015738 | Ga0495628_0015738_1302_2054 | 225 |
| 448 | 3300046516 | Ga0495628_0033438 | Ga0495628_0033438_2565_3242 | 225 |
| 449 | 3300046518 | Ga0495631_0010490 | Ga0495631_0010490_2922_3599 | 225 |
| 450 | 3300046518 | Ga0495631_0038676 | Ga0495631_0038676_659_1360 | 225 |
| 451 | 3300046523 | Ga0495644_0000048 | Ga0495644_0000048_36880_37557 | 225 |
| 452 | 3300046524 | Ga0495648_0228481 | Ga0495648_0228481_146_823 | 225 |
| 453 | 3300046526 | Ga0495666_0024917 | Ga0495666_0024917_329_1033 | 225 |
| 454 | 3300046529 | Ga0495652_0006640 | Ga0495652_0006640_6223_6900 | 225 |
| 455 | 3300046529 | Ga0495652_0020698 | Ga0495652_0020698_4996_5748 | 225 |
| 456 | 3300046531 | Ga0495665_0009651 | Ga0495665_0009651_2996_3673 | 225 |
| 457 | 3300046531 | Ga0495665_0194702 | Ga0495665_0194702_266_970 | 225 |
| 458 | 3300046533 | Ga0495640_0004801 | Ga0495640_0004801_5779_6456 | 225 |
| 459 | 3300046533 | Ga0495640_0270223 | Ga0495640_0270223_294_998 | 225 |
| 460 | 3300046535 | Ga0495586_0019711 | Ga0495586_0019711_67_744 | 225 |
| 461 | 3300046536 | Ga0495587_0007267 | Ga0495587_0007267_2000_2752 | 225 |
| 462 | 3300046538 | Ga0495609_0048103 | Ga0495609_0048103_725_1402 | 225 |
| 463 | 3300046543 | Ga0495645_0004272 | Ga0495645_0004272_3026_3778 | 225 |
| 464 | 3300046543 | Ga0495645_0014554 | Ga0495645_0014554_4852_5529 | 225 |
| 465 | 3300046543 | Ga0495645_0039222 | Ga0495645_0039222_2700_3404 | 225 |
| 466 | 3300046543 | Ga0495645_0120435 | Ga0495645_0120435_297_998 | 225 |
| 467 | 3300046557 | Ga0495622_0112645 | Ga0495622_0112645_527_1204 | 225 |
| 468 | 3300046558 | Ga0495633_0013243 | Ga0495633_0013243_1144_1821 | 225 |
| 469 | 3300046559 | Ga0495667_0015039 | Ga0495667_0015039_4332_5009 | 225 |
| 470 | 3300046642 | Ga0495634_0006225 | Ga0495634_0006225_6779_7456 | 225 |
| 471 | 3300046648 | Ga0495611_0005877 | Ga0495611_0005877_1363_2040 | 225 |
| 472 | 3300046660 | Ga0495625_0000985 | Ga0495625_0000985_28953_29654 | 225 |
| 473 | 3300046660 | Ga0495625_0017473 | Ga0495625_0017473_1262_1939 | 225 |
| 474 | 3300046660 | Ga0495625_0026175 | Ga0495625_0026175_114_791 | 225 |
| 475 | 3300046663 | Ga0495635_0002836 | Ga0495635_0002836_6480_7157 | 225 |
| 476 | 3300046663 | Ga0495635_0396171 | Ga0495635_0396171_129_833 | 225 |
| 477 | 3300046665 | Ga0495661_0021941 | Ga0495661_0021941_2610_3287 | 225 |
| 478 | 3300046674 | Ga0495588_0068626 | Ga0495588_0068626_145_822 | 225 |
| 479 | 3300046678 | Ga0495599_0037006 | Ga0495599_0037006_207_911 | 225 |
| 480 | 3300046678 | Ga0495599_0163875 | Ga0495599_0163875_68_745 | 225 |
| 481 | 3300046679 | Ga0495623_0073201 | Ga0495623_0073201_1100_1852 | 225 |
| 482 | 3300046680 | Ga0495646_0013211 | Ga0495646_0013211_4249_4953 | 225 |
| 483 | 3300046680 | Ga0495646_0087913 | Ga0495646_0087913_220_897 | 225 |
| 484 | 3300046680 | Ga0495646_0115119 | Ga0495646_0115119_402_1154 | 225 |
| 485 | 3300046684 | Ga0495669_0015601 | Ga0495669_0015601_538_1215 | 225 |
| 486 | 3300046689 | Ga0495613_0003966 | Ga0495613_0003966_7785_8462 | 225 |
| 487 | 3300046689 | Ga0495613_0048075 | Ga0495613_0048075_1682_2359 | 225 |
| 488 | 3300046694 | Ga0495649_0200934 | Ga0495649_0200934_222_926 | 225 |
| 489 | 3300046809 | Ga0495600_0012858 | Ga0495600_0012858_4277_4954 | 225 |
| 490 | 3300046809 | Ga0495600_0126930 | Ga0495600_0126930_124_801 | 225 |
| 491 | 3300046809 | Ga0495600_0292340 | Ga0495600_0292340_280_957 | 225 |
| 492 | 3300047315 | Ga0495581_0001976 | Ga0495581_0001976_4562_5239 | 225 |
| 493 | 3300047315 | Ga0495581_0044298 | Ga0495581_0044298_1342_2019 | 225 |
| 494 | 3300047317 | Ga0495604_0009666 | Ga0495604_0009666_664_1341 | 225 |
| 495 | 3300047317 | Ga0495604_0032429 | Ga0495604_0032429_1397_2074 | 225 |
| 496 | 3300047318 | Ga0495636_0118561 | Ga0495636_0118561_478_1155 | 225 |
| 497 | 3300047319 | Ga0495674_0011368 | Ga0495674_0011368_5421_6098 | 225 |
| 498 | 3300047319 | Ga0495674_0014334 | Ga0495674_0014334_330_1007 | 225 |
| 499 | 3300047319 | Ga0495674_0410310 | Ga0495674_0410310_59_763 | 225 |
| 500 | 3300047320 | Ga0495672_0021506 | Ga0495672_0021506_3115_3816 | 225 |
| 501 | 3300047320 | Ga0495672_0051848 | Ga0495672_0051848_997_1698 | 225 |
| 502 | 3300047321 | Ga0495676_0008961 | Ga0495676_0008961_6460_7137 | 225 |
| 503 | 3300047322 | Ga0495680_0017467 | Ga0495680_0017467_2038_2715 | 225 |
| 504 | 3300047323 | Ga0495683_0112571 | Ga0495683_0112571_34_711 | 225 |
| 505 | 3300047444 | Ga0495675_0079836 | Ga0495675_0079836_936_1613 | 225 |
| 506 | 3300047447 | Ga0495685_085712 | Ga0495685_085712_268_945 | 225 |
| 507 | 3300047471 | Ga0495684_0087091 | Ga0495684_0087091_1491_2243 | 225 |
| 508 | 3300047471 | Ga0495684_0114087 | Ga0495684_0114087_1194_1871 | 225 |
| 509 | 3300047472 | Ga0495686_0000178 | Ga0495686_0000178_42693_43394 | 225 |
| 510 | 3300047472 | Ga0495686_0001621 | Ga0495686_0001621_15450_16151 | 225 |
| 511 | 3300047472 | Ga0495686_0022023 | Ga0495686_0022023_2783_3484 | 225 |
| 512 | 3300047472 | Ga0495686_0062732 | Ga0495686_0062732_813_1514 | 225 |
| 513 | 3300047472 | Ga0495686_0096671 | Ga0495686_0096671_20_697 | 225 |
| 514 | 3300047472 | Ga0495686_0107665 | Ga0495686_0107665_870_1571 | 225 |
| 515 | 3300047673 | Ga0495593_0061551 | Ga0495593_0061551_1150_1827 | 225 |
| 516 | 3300048089 | Ga0495614_0000972 | Ga0495614_0000972_7849_8526 | 225 |
| 517 | 3300048089 | Ga0495614_0009178 | Ga0495614_0009178_3086_3763 | 225 |
| 518 | 3300048907 | Ga0496104_0000053 | Ga0496104_0000053_130784_131485 | 225 |
| 519 | 3300048908 | Ga0496105_0063911 | Ga0496105_0063911_1703_2380 | 225 |
| 520 | 3300048911 | Ga0496108_0226841 | Ga0496108_0226841_398_1099 | 225 |
| 521 | 3300048917 | Ga0496114_0410947 | Ga0496114_0410947_416_1093 | 225 |
| 522 | 3300048929 | Ga0496126_0000014 | Ga0496126_0000014_606861_607583 | 225 |
| 523 | 3300048929 | Ga0496126_0000100 | Ga0496126_0000100_83073_83774 | 225 |
| 524 | 3300048929 | Ga0496126_0000154 | Ga0496126_0000154_110723_111424 | 225 |
| 525 | 3300048929 | Ga0496126_0018324 | Ga0496126_0018324_727_1428 | 225 |
| 526 | 3300049460 | Ga0495682_0028164 | Ga0495682_0028164_980_1657 | 225 |
| 527 | 3300049460 | Ga0495682_0046605 | Ga0495682_0046605_400_1101 | 225 |
| 528 | 3300049568 | Ga0501031_0152929 | Ga0501031_0152929_686_1363 | 225 |
| 529 | 3300049569 | Ga0501032_0001912 | Ga0501032_0001912_3913_4590 | 225 |
| 530 | 3300049570 | Ga0501033_0060607 | Ga0501033_0060607_2048_2776 | 225 |
| 531 | 3300049571 | Ga0501034_0169330 | Ga0501034_0169330_254_931 | 225 |
| 532 | 3300049572 | Ga0501036_0081969 | Ga0501036_0081969_1473_2150 | 225 |
| 533 | 3300049572 | Ga0501036_0775796 | Ga0501036_0775796_52_729 | 225 |
| 534 | 3300049573 | Ga0501037_0193654 | Ga0501037_0193654_472_1149 | 225 |
| 535 | 3300049574 | Ga0501038_0005281 | Ga0501038_0005281_119_796 | 225 |
| 536 | 3300049579 | Ga0501043_0003983 | Ga0501043_0003983_6388_7065 | 225 |
| 537 | 3300049579 | Ga0501043_0083888 | Ga0501043_0083888_824_1552 | 225 |
| 538 | 3300049580 | Ga0501046_0000056 | Ga0501046_0000056_44113_44790 | 225 |
| 539 | 3300049581 | Ga0501047_0008947 | Ga0501047_0008947_7527_8204 | 225 |
| 540 | 3300049581 | Ga0501047_0011287 | Ga0501047_0011287_2370_3098 | 225 |
| 541 | 3300049581 | Ga0501047_0773248 | Ga0501047_0773248_25_702 | 225 |
| 542 | 3300049582 | Ga0501048_0041932 | Ga0501048_0041932_488_1165 | 225 |
| 543 | 3300049586 | Ga0501070_0068724 | Ga0501070_0068724_270_947 | 225 |
| 544 | 3300049586 | Ga0501070_0334038 | Ga0501070_0334038_470_1198 | 225 |
| 545 | 3300049586 | Ga0501070_0403480 | Ga0501070_0403480_257_934 | 225 |
| 546 | 3300049589 | Ga0501073_0018854 | Ga0501073_0018854_291_1019 | 225 |
| 547 | 3300049589 | Ga0501073_0039812 | Ga0501073_0039812_1115_1792 | 225 |
| 548 | 3300049742 | Ga0501080_0014166 | Ga0501080_0014166_2711_3388 | 225 |
| 549 | 3300049822 | Ga0501035_0168491 | Ga0501035_0168491_695_1372 | 225 |
| 550 | 3300049822 | Ga0501035_0182448 | Ga0501035_0182448_501_1229 | 225 |
| 551 | 3300049823 | Ga0501044_0027240 | Ga0501044_0027240_3597_4274 | 225 |
| 552 | 3300049823 | Ga0501044_0061163 | Ga0501044_0061163_1445_2173 | 225 |
| 553 | 3300053093 | Ga0500651_0000005 | Ga0500651_0000005_172244_172921 | 225 |
| 554 | 3300053119 | Ga0500595_000004 | Ga0500595_000004_238373_239050 | 225 |
| 555 | 3300053119 | Ga0500595_007997 | Ga0500595_007997_3654_4331 | 225 |
| 556 | 3300055283 | Ga0500661_002167 | Ga0500661_002167_2391_3092 | 225 |
| 557 | iso_pu_bacteria | 2884215851 | 2884217804 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tdm-assembly2.cif.gz_C | computationally designed tim-barrel protein, halfflr | 0.8814 | 121 | 220 |
| 3tdn-assembly1.cif.gz_A | computationally designed two-fold symmetric tim-barrel protein, flr | 0.876 | 121 | 222 |
| 4tx9-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sviceus with degraded profar | 0.8713 | 1 | 223 |
| 5a5w-assembly1.cif.gz_A | crystal structure of salmonella enterica hisa d7n d176a with profar | 0.8607 | 1 | 223 |
| 4u28-assembly1.cif.gz_A | crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 | 0.8567 | 1 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9216 | 1 | 224 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8899 | 1 | 224 | 3.20.20.70 |
| af_Q2FUU2_4_232_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8853 | 1 | 217 | 3.20.20.70 |
| 3tdnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.876 | 121 | 222 | 3.40.50.12600 |
| af_P10371_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8713 | 1 | 224 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3QSG6-F1-model_v4 | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 0.9947 | 1 | 225 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A2V9PB54-F1-model_v4 | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 0.9931 | 118 | 225 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A2V9U255-F1-model_v4 | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 0.9929 | 124 | 223 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A6L7WT22-F1-model_v4 | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 0.9835 | 107 | 224 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A2V8BMN4-F1-model_v4 | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 0.9809 | 109 | 209 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar