F463300

General Info

Members Datasets Scaffolds Average Seq Length
557 292 553 320

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100132805|Ga0075430_1001328052
Length 355
Sequence VPRQVLTARQAEQALPLGPPTAMFAAVFSPTESHRLMAMNFLEFEQPIAELEAKIDELKFVTSDAEVNIGEEISRLRAKSRALTTSIFSNLTQWQIAQLARHPQRPYTLDYISAVFTDFQELHGDRMYADDHAIVAGPARLDGQPVMIVGQQKGRDTKERVRRNYGMPKPEGYRKALRLMHMAEKFKMPLITLIDTAGAYPGVGAEERGQSEAIARNLFEMAQLKVPIVCVVIGEGGSGGALAIGVGDKLLMLQYSIYSVISPEGCAGILWRSADKKDLAAEAMGVSAERIAKLGLVDEVIKEPLGGAHRDPQVMADDVKAAIKRNLEELQSLSTEQLLARRQERLRSFGVYSEA

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
3 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
4 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
170 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
184 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
185 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
195 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
196 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
201 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
202 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
282 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
283 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
284 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
285 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
288 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
289 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.18
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0.18
Rhizoplane 4.67
Rhizosphere 87.97
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1011485 3300002070 Bacteria 1165
2 JGI24751J29686_10013169 3300002459 Bacteria 1706
3 rootH2_10024292 3300003320 Bacteria 5636
4 Ga0065715_10207317 3300005293 Bacteria 1330
5 Ga0065707_10082014 3300005295 Bacteria 24747
6 Ga0065707_10084331 3300005295 Bacteria 7341
7 Ga0070658_10462966 3300005327 Bacteria 1093
8 Ga0070676_10094023 3300005328 Bacteria 1841
9 Ga0070683_100147954 3300005329 Bacteria 2226
10 Ga0070690_100031958 3300005330 Bacteria 3283
11 Ga0070670_100100035 3300005331 Bacteria 2495
12 Ga0070670_100236711 3300005331 Bacteria 1589
13 Ga0070677_10005739 3300005333 Bacteria 4102
14 Ga0068869_100004285 3300005334 Bacteria 8858
15 Ga0068869_100012967 3300005334 Bacteria 5526
16 Ga0070680_100058466 3300005336 Bacteria 3153
17 Ga0070680_100069075 3300005336 Bacteria 2901
18 Ga0068868_100010735 3300005338 Bacteria 6640
19 Ga0070660_100022157 3300005339 Bacteria 4694
20 Ga0070689_100037509 3300005340 Bacteria 3705
21 Ga0070689_100041679 3300005340 Bacteria 3524
22 Ga0070687_100011039 3300005343 Bacteria 3935
23 Ga0070661_100041720 3300005344 Bacteria 3348
24 Ga0070661_100090762 3300005344 Bacteria 2262
25 Ga0070661_100130104 3300005344 Bacteria 1890
26 Ga0070668_100043094 3300005347 Bacteria 3460
27 Ga0070669_100019225 3300005353 Bacteria 4878
28 Ga0070675_100009949 3300005354 Bacteria 7416
29 Ga0070675_100036845 3300005354 Bacteria 3982
30 Ga0070671_100019517 3300005355 Bacteria 5519
31 Ga0070671_100153139 3300005355 Bacteria 1947
32 Ga0070674_100043941 3300005356 Bacteria 3043
33 Ga0070674_100321148 3300005356 Bacteria 1241
34 Ga0070673_100001418 3300005364 Bacteria 14008
35 Ga0070673_100028403 3300005364 Bacteria 4160
36 Ga0070673_100071260 3300005364 Bacteria 2792
37 Ga0070688_100003326 3300005365 Bacteria 8240
38 Ga0070688_100005825 3300005365 Bacteria 6524
39 Ga0070659_100059507 3300005366 Bacteria 3016
40 Ga0070659_100308366 3300005366 Bacteria 1321
41 Ga0070667_100045854 3300005367 Bacteria 3677
42 Ga0070700_100066894 3300005441 Bacteria 2282
43 Ga0070700_100086468 3300005441 Bacteria 2036
44 Ga0070663_100008065 3300005455 Bacteria 6458
45 Ga0070678_100024760 3300005456 Bacteria 4025
46 Ga0070662_100000067 3300005457 Bacteria 56806
47 Ga0070662_100182702 3300005457 Bacteria 1654
48 Ga0070662_100256388 3300005457 Bacteria 1408
49 Ga0070681_10212275 3300005458 Bacteria 1851
50 Ga0068867_100121607 3300005459 Bacteria 2018
51 Ga0070685_10025917 3300005466 Bacteria 3230
52 Ga0070685_10037074 3300005466 Bacteria 2759
53 Ga0070699_100164981 3300005518 Bacteria 1962
54 Ga0070679_100039525 3300005530 Bacteria 4688
55 Ga0070679_100315778 3300005530 Bacteria 1512
56 Ga0070679_100412904 3300005530 Bacteria 1295
57 Ga0070684_100024702 3300005535 Bacteria 5043
58 Ga0070684_100052895 3300005535 Bacteria 3533
59 Ga0070672_100051991 3300005543 Bacteria 3197
60 Ga0070672_100067904 3300005543 Bacteria 2826
61 Ga0070672_100233573 3300005543 Bacteria 1545
62 Ga0070686_100010989 3300005544 Bacteria 5126
63 Ga0070686_100094842 3300005544 Bacteria 2003
64 Ga0070665_100015281 3300005548 Bacteria 7707
65 Ga0070665_100036844 3300005548 Bacteria 4918
66 Ga0070665_100055889 3300005548 Bacteria 3958
67 Ga0068855_100002858 3300005563 Bacteria 21214
68 Ga0068855_100008013 3300005563 Bacteria 12761
69 Ga0070664_100050762 3300005564 Bacteria 3511
70 Ga0070664_100229510 3300005564 Bacteria 1664
71 Ga0068857_100003771 3300005577 Bacteria 12745
72 Ga0068854_100004880 3300005578 Bacteria 8461
73 Ga0068854_100027260 3300005578 Bacteria 3936
74 Ga0068856_100000655 3300005614 Bacteria 37541
75 Ga0068856_100016351 3300005614 Bacteria 7178
76 Ga0070702_100002192 3300005615 Bacteria 8323
77 Ga0068852_100081076 3300005616 Bacteria 2879
78 Ga0068852_100280358 3300005616 Bacteria 1606
79 Ga0068859_100000949 3300005617 Bacteria 29651
80 Ga0068864_100010108 3300005618 Bacteria 7792
81 Ga0068866_10000017 3300005718 Bacteria 66409
82 Ga0068866_10005527 3300005718 Bacteria 5219
83 Ga0068861_100007784 3300005719 Bacteria 7362
84 Ga0068861_100011501 3300005719 Bacteria 6156
85 Ga0068861_100046462 3300005719 Bacteria 3273
86 Ga0068861_100140942 3300005719 Bacteria 1967
87 Ga0068851_10015417 3300005834 Bacteria 3641
88 Ga0068870_10003791 3300005840 Bacteria 6432
89 Ga0068870_10008071 3300005840 Bacteria 4717
90 Ga0068858_100183473 3300005842 Unclassified 1976
91 Ga0068858_100272250 3300005842 Unclassified 1611
92 Ga0068858_100336596 3300005842 Bacteria 1444
93 Ga0068862_100003513 3300005844 Bacteria 13458
94 Ga0068862_100006444 3300005844 Bacteria 9755
95 Ga0068862_100068242 3300005844 Bacteria 3067
96 Ga0068862_100157540 3300005844 Bacteria 2025
97 Ga0068862_100305314 3300005844 Bacteria 1465
98 Ga0075363_100000228 3300006048 Bacteria 15710
99 Ga0075364_10000033 3300006051 Bacteria 48757
100 Ga0075362_10000010 3300006177 Bacteria 109823
101 Ga0075367_10086374 3300006178 Bacteria 1904
102 Ga0075370_10000845 3300006353 Bacteria 12403
103 Ga0075428_100004267 3300006844 Bacteria 15730
104 Ga0075428_100006560 3300006844 Bacteria 12938
105 Ga0075428_100014641 3300006844 Bacteria 8710
106 Ga0075428_100023966 3300006844 Bacteria 6753
107 Ga0075428_100080644 3300006844 Bacteria 3551
108 Ga0075428_100105858 3300006844 Bacteria 3067
109 Ga0075430_100003519 3300006846 Bacteria 13106
110 Ga0075430_100040450 3300006846 Bacteria 3946
111 Ga0075430_100132805 3300006846 Bacteria 2075
112 Ga0075431_100000318 3300006847 Bacteria 37976
113 Ga0075431_100019561 3300006847 Bacteria 6907
114 Ga0075431_100128391 3300006847 Bacteria 2616
115 Ga0075433_10000324 3300006852 Bacteria 29260
116 Ga0075433_10007382 3300006852 Bacteria 8726
117 Ga0075434_100007659 3300006871 Bacteria 9990
118 Ga0075434_100123192 3300006871 Bacteria 2608
119 Ga0075429_100003585 3300006880 Bacteria 13225
120 Ga0075429_100020127 3300006880 Bacteria 5786
121 Ga0068865_100094673 3300006881 Bacteria 2174
122 Ga0068865_100125713 3300006881 Bacteria 1914
123 Ga0075436_100222517 3300006914 Bacteria 1340
124 Ga0097620_100000949 3300006931 Bacteria 29651
125 Ga0105250_10000031 3300009092 Bacteria 170328
126 Ga0105240_10001142 3300009093 Bacteria 46493
127 Ga0105240_10260074 3300009093 Bacteria 2003
128 Ga0111539_10002735 3300009094 Bacteria 23404
129 Ga0111539_10004487 3300009094 Bacteria 18254
130 Ga0111539_10007684 3300009094 Bacteria 13772
131 Ga0111539_10142127 3300009094 Bacteria 2809
132 Ga0111539_10145648 3300009094 Bacteria 2773
133 Ga0111539_10151594 3300009094 Bacteria 2713
134 Ga0111539_10166258 3300009094 Bacteria 2579
135 Ga0111539_10519599 3300009094 Bacteria 1387
136 Ga0114129_10003161 3300009147 Bacteria 23102
137 Ga0114129_10243269 3300009147 Bacteria 2418
138 Ga0114129_10887469 3300009147 Bacteria 1131
139 Ga0105243_10024597 3300009148 Bacteria 4594
140 Ga0105242_10000079 3300009176 Bacteria 66416
141 Ga0105242_10001122 3300009176 Bacteria 21087
142 Ga0105242_10027613 3300009176 Bacteria 4510
143 Ga0105242_10064137 3300009176 Bacteria 3027
144 Ga0105242_10080189 3300009176 Bacteria 2728
145 Ga0105248_10127210 3300009177 Bacteria 2874
146 Ga0105238_10038294 3300009551 Bacteria 4870
147 Ga0105238_10185332 3300009551 Bacteria 2057
148 Ga0105249_10002062 3300009553 Bacteria 17412
149 Ga0105249_10009313 3300009553 Bacteria 8589
150 Ga0105249_10011737 3300009553 Bacteria 7702
151 Ga0105249_10094206 3300009553 Bacteria 2806
152 Ga0105239_10000363 3300010375 Bacteria 66416
153 Ga0105239_10442113 3300010375 Bacteria 1474
154 Ga0157371_10000750 3300013102 Bacteria 37558
155 Ga0157370_10043391 3300013104 Bacteria 4328
156 Ga0157369_10094104 3300013105 Bacteria 3199
157 Ga0157369_10239194 3300013105 Bacteria 1897
158 Ga0157378_10439434 3300013297 Bacteria 1293
159 Ga0163162_10192761 3300013306 Bacteria 2166
160 Ga0163162_10396983 3300013306 Bacteria 1512
161 Ga0157372_10001241 3300013307 Bacteria 27552
162 Ga0157375_10038449 3300013308 Bacteria 4595
163 Ga0157375_10329980 3300013308 Bacteria 1690
164 Ga0157375_10922781 3300013308 Bacteria 1016
165 Ga0163163_10007180 3300014325 Bacteria 9807
166 Ga0157380_10006554 3300014326 Bacteria 8212
167 Ga0157380_10009308 3300014326 Bacteria 7035
168 Ga0157380_10016863 3300014326 Bacteria 5393
169 Ga0157380_10095225 3300014326 Bacteria 2466
170 Ga0157377_10011442 3300014745 Bacteria 4429
171 Ga0157377_10079238 3300014745 Bacteria 1916
172 Ga0157379_10000077 3300014968 Bacteria 63713
173 Ga0157379_10116647 3300014968 Bacteria 2401
174 Ga0157379_10119018 3300014968 Bacteria 2376
175 Ga0157379_10309568 3300014968 Bacteria 1441
176 Ga0157376_10143807 3300014969 Bacteria 2143
177 Ga0163161_10135821 3300017792 Bacteria 1859
178 Ga0213872_10001678 3300021361 Bacteria 13932
179 Ga0213876_10180398 3300021384 Bacteria 1123
180 Ga0207673_1004870 3300025290 Bacteria 1619
181 Ga0207697_10000171 3300025315 Bacteria 33072
182 Ga0207656_10007073 3300025321 Bacteria 4074
183 Ga0207696_1000125 3300025711 Bacteria 138603
184 Ga0207682_10004237 3300025893 Bacteria 6058
185 Ga0207682_10052242 3300025893 Bacteria 1693
186 Ga0207642_10000037 3300025899 Bacteria 38746
187 Ga0207688_10014127 3300025901 Bacteria 4343
188 Ga0207680_10099213 3300025903 Bacteria 1868
189 Ga0207645_10000328 3300025907 Bacteria 39622
190 Ga0207645_10038676 3300025907 Bacteria 3058
191 Ga0207643_10000103 3300025908 Bacteria 57285
192 Ga0207695_10007489 3300025913 Bacteria 13868
193 Ga0207671_10007939 3300025914 Bacteria 9098
194 Ga0207660_10054846 3300025917 Bacteria 2846
195 Ga0207660_10063527 3300025917 Bacteria 2662
196 Ga0207662_10004626 3300025918 Bacteria 7257
197 Ga0207657_10005331 3300025919 Bacteria 13469
198 Ga0207657_10073143 3300025919 Bacteria 2898
199 Ga0207649_10050220 3300025920 Bacteria 2579
200 Ga0207649_10073938 3300025920 Bacteria 2185
201 Ga0207652_10011827 3300025921 Bacteria 7042
202 Ga0207652_10258098 3300025921 Bacteria 1572
203 Ga0207681_10005027 3300025923 Bacteria 8129
204 Ga0207681_10037475 3300025923 Bacteria 3205
205 Ga0207681_10038908 3300025923 Bacteria 3154
206 Ga0207681_10224575 3300025923 Bacteria 1454
207 Ga0207681_10283403 3300025923 Bacteria 1305
208 Ga0207694_10255706 3300025924 Bacteria 1434
209 Ga0207650_10031354 3300025925 Bacteria 3838
210 Ga0207650_10076652 3300025925 Bacteria 2526
211 Ga0207650_10081194 3300025925 Bacteria 2459
212 Ga0207659_10039510 3300025926 Bacteria 3292
213 Ga0207644_10045228 3300025931 Bacteria 3131
214 Ga0207706_10000202 3300025933 Bacteria 65888
215 Ga0207706_10000476 3300025933 Bacteria 42949
216 Ga0207706_10005393 3300025933 Bacteria 11921
217 Ga0207706_10132159 3300025933 Bacteria 2195
218 Ga0207686_10000056 3300025934 Bacteria 106309
219 Ga0207686_10005280 3300025934 Bacteria 6930
220 Ga0207686_10013854 3300025934 Bacteria 4473
221 Ga0207709_10106720 3300025935 Bacteria 1863
222 Ga0207670_10042957 3300025936 Bacteria 2982
223 Ga0207704_10148573 3300025938 Bacteria 1650
224 Ga0207691_10000632 3300025940 Bacteria 34796
225 Ga0207691_10003113 3300025940 Bacteria 16197
226 Ga0207691_10026837 3300025940 Bacteria 5404
227 Ga0207711_10022292 3300025941 Bacteria 5295
228 Ga0207711_10223449 3300025941 Bacteria 1723
229 Ga0207689_10017857 3300025942 Bacteria 5993
230 Ga0207689_10022250 3300025942 Bacteria 5330
231 Ga0207661_10195066 3300025944 Bacteria 1777
232 Ga0207679_10002843 3300025945 Bacteria 10734
233 Ga0207667_10001108 3300025949 Bacteria 33994
234 Ga0207667_10026946 3300025949 Bacteria 6270
235 Ga0207651_10013272 3300025960 Bacteria 4706
236 Ga0207651_10029855 3300025960 Bacteria 3462
237 Ga0207712_10003871 3300025961 Bacteria 9453
238 Ga0207668_10094928 3300025972 Bacteria 2200
239 Ga0207640_10040229 3300025981 Bacteria 2964
240 Ga0207640_10207330 3300025981 Bacteria 1490
241 Ga0207677_10055404 3300026023 Bacteria 2711
242 Ga0207703_10025563 3300026035 Bacteria 4644
243 Ga0207703_10199038 3300026035 Bacteria 1779
244 Ga0207703_10249535 3300026035 Unclassified 1599
245 Ga0207703_10481588 3300026035 Bacteria 1163
246 Ga0207678_10001836 3300026067 Bacteria 19481
247 Ga0207678_10006513 3300026067 Bacteria 10358
248 Ga0207708_10014135 3300026075 Bacteria 5968
249 Ga0207708_10014149 3300026075 Bacteria 5965
250 Ga0207708_10029365 3300026075 Bacteria 4167
251 Ga0207702_10000428 3300026078 Bacteria 48274
252 Ga0207641_10020703 3300026088 Bacteria 5404
253 Ga0207641_10143926 3300026088 Bacteria 2154
254 Ga0207641_10289426 3300026088 Bacteria 1544
255 Ga0207648_10000334 3300026089 Bacteria 51629
256 Ga0207648_10008751 3300026089 Bacteria 9756
257 Ga0207648_10016990 3300026089 Bacteria 6632
258 Ga0207676_10002007 3300026095 Bacteria 14826
259 Ga0207676_10070867 3300026095 Bacteria 2796
260 Ga0207674_10035461 3300026116 Bacteria 5206
261 Ga0207674_10036342 3300026116 Bacteria 5135
262 Ga0207675_100000130 3300026118 Bacteria 63098
263 Ga0207675_100003625 3300026118 Bacteria 15060
264 Ga0207675_100004174 3300026118 Bacteria 13984
265 Ga0207675_100009816 3300026118 Bacteria 8961
266 Ga0207675_100072528 3300026118 Bacteria 3220
267 Ga0207675_100144489 3300026118 Bacteria 2261
268 Ga0207683_10011326 3300026121 Bacteria 7608
269 Ga0207683_10097450 3300026121 Bacteria 2623
270 Ga0207683_10342163 3300026121 Bacteria 1372
271 Ga0207698_10225102 3300026142 Bacteria 1698
272 Ga0209982_1002614 3300027552 Bacteria 2536
273 Ga0209983_1005792 3300027665 Bacteria 2552
274 Ga0209971_1001106 3300027682 Bacteria 6844
275 Ga0209998_10000179 3300027717 Bacteria 23068
276 Ga0209974_10003308 3300027876 Bacteria 5820
277 Ga0207428_10024858 3300027907 Bacteria 5024
278 Ga0207428_10075062 3300027907 Bacteria 2650
279 Ga0207428_10156188 3300027907 Bacteria 1735
280 Ga0207428_10179060 3300027907 Bacteria 1602
281 Ga0268266_10045604 3300028379 Bacteria 3750
282 Ga0268266_10101589 3300028379 Bacteria 2535
283 Ga0268265_10000723 3300028380 Bacteria 32332
284 Ga0268265_10019069 3300028380 Bacteria 4762
285 Ga0268265_10121626 3300028380 Bacteria 2152
286 Ga0268265_10300459 3300028380 Bacteria 1445
287 Ga0268265_10317806 3300028380 Bacteria 1409
288 Ga0265318_10021318 3300028577 Bacteria 2602
289 Ga0265336_10011608 3300028666 Bacteria 2988
290 Ga0265336_10022375 3300028666 Bacteria 2013
291 Ga0307515_10009179 3300028794 Bacteria 19164
292 Ga0265338_10007418 3300028800 Bacteria 13614
293 Ga0265338_10120413 3300028800 Bacteria 2093
294 Ga0265330_10042904 3300031235 Bacteria 2003
295 Ga0265332_10006879 3300031238 Bacteria 5156
296 Ga0265332_10143023 3300031238 Bacteria 1002
297 Ga0265328_10014559 3300031239 Bacteria 3097
298 Ga0265331_10089166 3300031250 Bacteria 1426
299 Ga0265316_10015427 3300031344 Bacteria 6681
300 Ga0307513_10090857 3300031456 Bacteria 3113
301 Ga0307509_10000675 3300031507 Bacteria 58150
302 Ga0307408_100030515 3300031548 Bacteria 3744
303 Ga0307514_10002133 3300031649 Bacteria 21325
304 Ga0316575_10039490 3300031665 Bacteria 1863
305 Ga0316575_10084575 3300031665 Bacteria 1281
306 Ga0316579_10001070 3300031691 Bacteria 9675
307 Ga0316579_10001665 3300031691 Bacteria 8154
308 Ga0316579_10005725 3300031691 Bacteria 5034
309 Ga0316579_10012515 3300031691 Bacteria 3632
310 Ga0316579_10031534 3300031691 Bacteria 2427
311 Ga0316579_10144817 3300031691 Bacteria 1146
312 Ga0265314_10089959 3300031711 Bacteria 2001
313 Ga0265342_10006773 3300031712 Bacteria 8488
314 Ga0316576_10001779 3300031727 Bacteria 11915
315 Ga0316576_10014175 3300031727 Bacteria 5320
316 Ga0316576_10020823 3300031727 Bacteria 4524
317 Ga0316576_10153537 3300031727 Bacteria 1735
318 Ga0316576_10155332 3300031727 Bacteria 1725
319 Ga0316578_10004886 3300031728 Bacteria 6408
320 Ga0316578_10019580 3300031728 Bacteria 3728
321 Ga0316578_10021434 3300031728 Bacteria 3586
322 Ga0316578_10053234 3300031728 Bacteria 2371
323 Ga0316578_10105689 3300031728 Bacteria 1689
324 Ga0316578_10182048 3300031728 Bacteria 1266
325 Ga0316578_10189610 3300031728 Bacteria 1238
326 Ga0307516_10001981 3300031730 Bacteria 28061
327 Ga0316577_10024504 3300031733 Bacteria 3356
328 Ga0316577_10025454 3300031733 Bacteria 3291
329 Ga0316577_10039244 3300031733 Bacteria 2649
330 Ga0316577_10042952 3300031733 Bacteria 2529
331 Ga0316577_10090808 3300031733 Bacteria 1710
332 Ga0316577_10122455 3300031733 Bacteria 1461
333 Ga0307410_10411651 3300031852 Bacteria 1095
334 Ga0307407_10000159 3300031903 Bacteria 20916
335 Ga0307407_10088099 3300031903 Bacteria 1896
336 Ga0307409_100326474 3300031995 Bacteria 1438
337 Ga0307416_100055145 3300032002 Bacteria 3199
338 Ga0307416_100284961 3300032002 Bacteria 1631
339 Ga0307411_10150272 3300032005 Bacteria 1730
340 Ga0307411_10279099 3300032005 Bacteria 1329
341 Ga0307415_100246368 3300032126 Bacteria 1449
342 Ga0307415_100280364 3300032126 Bacteria 1370
343 Ga0316583_10001094 3300032133 Bacteria 8812
344 Ga0316583_10007990 3300032133 Bacteria 3812
345 Ga0316583_10010960 3300032133 Bacteria 3265
346 Ga0316583_10011041 3300032133 Bacteria 3254
347 Ga0316583_10045789 3300032133 Bacteria 1544
348 Ga0316585_10047630 3300032137 Bacteria 1372
349 Ga0316596_1022362 3300033541 Bacteria 1616
350 Ga0373936_0020803 3300035113 Bacteria 2551
351 Ga0373962_0006701 3300035242 Bacteria 2795
352 Ga0316574_0000329 3300035398 Bacteria 18187
353 Ga0316574_0002786 3300035398 Bacteria 8876
354 Ga0316574_0015151 3300035398 Bacteria 4471
355 Ga0316574_0111482 3300035398 Bacteria 1754
356 Ga0316574_0142845 3300035398 Bacteria 1542
357 Ga0316574_0143032 3300035398 Bacteria 1541
358 Ga0316574_0152343 3300035398 Bacteria 1490
359 Ga0316574_0319309 3300035398 Bacteria 986
360 Ga0373937_0105250 3300036401 Bacteria 2622
361 Ga0373937_0122637 3300036401 Bacteria 2423
362 Ga0316582_0022605 3300036647 Bacteria 3736
363 Ga0316582_0029636 3300036647 Bacteria 3326
364 Ga0316582_0053939 3300036647 Bacteria 2558
365 Ga0316582_0058595 3300036647 Bacteria 2463
366 Ga0316582_0060818 3300036647 Bacteria 2422
367 Ga0316582_0081452 3300036647 Bacteria 2114
368 Ga0316582_0173401 3300036647 Bacteria 1465
369 Ga0316584_0008527 3300036712 Bacteria 7064
370 Ga0316584_0009729 3300036712 Bacteria 6688
371 Ga0316584_0018123 3300036712 Bacteria 5076
372 Ga0316584_0069960 3300036712 Bacteria 2631
373 Ga0316584_0073505 3300036712 Bacteria 2562
374 Ga0316584_0083231 3300036712 Bacteria 2396
375 Ga0316584_0098882 3300036712 Bacteria 2185
376 Ga0316584_0101950 3300036712 Bacteria 2149
377 Ga0316584_0103170 3300036712 Bacteria 2135
378 Ga0316584_0120532 3300036712 Bacteria 1960
379 Ga0316584_0332847 3300036712 Bacteria 1093
380 Ga0373925_0071756 3300037068 Bacteria 2620
381 Ga0373925_0076016 3300037068 Bacteria 2546
382 Ga0373925_0400756 3300037068 Bacteria 1119
383 Ga0395905_0043801 3300037471 Bacteria 4198
384 Ga0316581_0000182 3300037588 Bacteria 10296
385 Ga0400490_58235 3300038726 Bacteria 6672
386 Ga0400483_264974 3300039062 Bacteria 1443
387 Ga0436365_0617032 3300039437 Bacteria 2014
388 Ga0436365_1496504 3300039437 Unclassified 2839
389 Ga0436361_0403612 3300039447 Bacteria 27836
390 Ga0436361_0757428 3300039447 Bacteria 38736
391 Ga0451807_2137144 3300041486 Bacteria 1227
392 Ga0451845_0281783 3300041501 Bacteria 3398
393 Ga0450888_008362 3300042126 Bacteria 1164
394 Ga0439459_0018020 3300042438 Bacteria 1323
395 Ga0451577_0001014 3300042876 Bacteria 40843
396 Ga0451577_0003000 3300042876 Bacteria 19232
397 Ga0451577_0009807 3300042876 Bacteria 9176
398 Ga0451577_0020574 3300042876 Bacteria 6052
399 Ga0451577_0033205 3300042876 Bacteria 4651
400 Ga0451577_0134886 3300042876 Bacteria 2216
401 Ga0451577_0192953 3300042876 Bacteria 1838
402 Ga0451577_0253051 3300042876 Bacteria 1594
403 Ga0466969_0000065 3300044656 Bacteria 54697
404 Ga0453683_0005987 3300044673 Bacteria 8382
405 Ga0453683_0042852 3300044673 Bacteria 2841
406 Ga0466965_0073140 3300044683 Bacteria 1726
407 Ga0466966_0022221 3300044684 Bacteria 4164
408 Ga0453684_0000004 3300044712 Bacteria 1469893
409 Ga0453684_0005071 3300044712 Bacteria 26618
410 Ga0453684_0006822 3300044712 Bacteria 21476
411 Ga0453684_0039333 3300044712 Bacteria 6448
412 Ga0453684_0042797 3300044712 Bacteria 6098
413 Ga0453684_0064164 3300044712 Bacteria 4693
414 Ga0453684_0166183 3300044712 Bacteria 2604
415 Ga0453684_0186082 3300044712 Bacteria 2434
416 Ga0453684_0281852 3300044712 Bacteria 1895
417 Ga0453684_0305306 3300044712 Bacteria 1808
418 Ga0453684_0360823 3300044712 Bacteria 1636
419 Ga0453684_0399622 3300044712 Unclassified 1539
420 Ga0453684_0466131 3300044712 Bacteria 1404
421 Ga0451576_0003991 3300045051 Bacteria 19645
422 Ga0451576_0024379 3300045051 Bacteria 6534
423 Ga0451576_0041436 3300045051 Bacteria 4868
424 Ga0451576_0235671 3300045051 Bacteria 1911
425 Ga0451576_0371788 3300045051 Bacteria 1498
426 Ga0495629_0050523 3300046459 Bacteria 2912
427 Ga0495638_0005220 3300046460 Bacteria 9703
428 Ga0495638_0122711 3300046460 Bacteria 1534
429 Ga0495650_0017519 3300046471 Bacteria 3590
430 Ga0495580_0000222 3300046472 Bacteria 44042
431 Ga0495582_0014686 3300046473 Bacteria 4303
432 Ga0495594_0002829 3300046499 Bacteria 9022
433 Ga0495618_0000493 3300046514 Bacteria 28254
434 Ga0495642_0061772 3300046528 Bacteria 1555
435 Ga0495621_0027832 3300046539 Bacteria 1917
436 Ga0495622_0039488 3300046557 Bacteria 2198
437 Ga0495625_0015664 3300046660 Bacteria 5995
438 Ga0495635_0146020 3300046663 Bacteria 1610
439 Ga0495658_0083689 3300046683 Bacteria 1877
440 Ga0495672_0121092 3300047320 Bacteria 1391
441 Ga0496100_0083223 3300048903 Bacteria 2166
442 Ga0496100_0167870 3300048903 Bacteria 1578
443 Ga0496101_0075870 3300048904 Bacteria 2475
444 Ga0496101_0433492 3300048904 Bacteria 1036
445 Ga0496102_0007859 3300048905 Bacteria 9113
446 Ga0496102_0208547 3300048905 Bacteria 1842
447 Ga0496103_0094883 3300048906 Bacteria 1885
448 Ga0496103_0144430 3300048906 Bacteria 1523
449 Ga0496104_0161356 3300048907 Bacteria 2150
450 Ga0496106_0000437 3300048909 Bacteria 29708
451 Ga0496106_0015205 3300048909 Bacteria 5695
452 Ga0496106_0136015 3300048909 Bacteria 1930
453 Ga0496107_0002090 3300048910 Bacteria 12789
454 Ga0496107_0077212 3300048910 Bacteria 2426
455 Ga0496107_0305553 3300048910 Bacteria 1184
456 Ga0496108_0022330 3300048911 Bacteria 5202
457 Ga0496108_0122731 3300048911 Bacteria 2229
458 Ga0496109_0041369 3300048912 Bacteria 4174
459 Ga0496109_0108010 3300048912 Bacteria 2586
460 Ga0496110_0061872 3300048913 Bacteria 3305
461 Ga0496110_0088381 3300048913 Bacteria 2768
462 Ga0496111_0245999 3300048914 Bacteria 1328
463 Ga0496112_0025579 3300048915 Bacteria 5669
464 Ga0496114_0158906 3300048917 Bacteria 1964
465 Ga0496115_0407368 3300048918 Bacteria 1103
466 Ga0496116_0014892 3300048919 Bacteria 6178
467 Ga0496117_0000217 3300048920 Bacteria 111598
468 Ga0496117_0002449 3300048920 Bacteria 23386
469 Ga0496118_0000005 3300048921 Bacteria 697350
470 Ga0496119_0018502 3300048922 Bacteria 5180
471 Ga0496121_0061401 3300048924 Bacteria 3084
472 Ga0496124_0123606 3300048927 Bacteria 2064
473 Ga0496125_0054486 3300048928 Bacteria 3268
474 Ga0496126_0201103 3300048929 Bacteria 1682
475 Ga0501031_0018241 3300049568 Bacteria 4566
476 Ga0501031_0025733 3300049568 Bacteria 3839
477 Ga0501031_0090224 3300049568 Bacteria 1999
478 Ga0501032_0127723 3300049569 Bacteria 1678
479 Ga0501034_0221392 3300049571 Bacteria 1845
480 Ga0501036_0080828 3300049572 Bacteria 2747
481 Ga0501036_0112288 3300049572 Bacteria 2303
482 Ga0501038_0082063 3300049574 Bacteria 2715
483 Ga0501039_0068810 3300049575 Bacteria 2748
484 Ga0501039_0142770 3300049575 Bacteria 1881
485 Ga0501039_0358116 3300049575 Bacteria 1146
486 Ga0501040_0027763 3300049576 Bacteria 3812
487 Ga0501040_0069225 3300049576 Bacteria 2435
488 Ga0501040_0318510 3300049576 Bacteria 1112
489 Ga0501041_0009966 3300049577 Bacteria 5598
490 Ga0501042_0127219 3300049578 Bacteria 1835
491 Ga0501046_0056101 3300049580 Bacteria 3094
492 Ga0501046_0118060 3300049580 Bacteria 2020
493 Ga0501047_0080172 3300049581 Bacteria 3138
494 Ga0501048_0011793 3300049582 Bacteria 6515
495 Ga0501071_0017183 3300049587 Bacteria 4986
496 Ga0501071_0235068 3300049587 Bacteria 1381
497 Ga0501071_0409014 3300049587 Bacteria 1036
498 Ga0501072_0043585 3300049588 Bacteria 3526
499 Ga0501074_0032521 3300049590 Bacteria 3779
500 Ga0501076_0084094 3300049592 Bacteria 2556
501 Ga0501077_0055593 3300049593 Bacteria 2513
502 Ga0501079_0031420 3300049741 Bacteria 4081
503 Ga0501079_0036949 3300049741 Bacteria 3762
504 Ga0501080_0060229 3300049742 Bacteria 3533
505 Ga0501081_0002687 3300049743 Bacteria 11237
506 Ga0501081_0005664 3300049743 Bacteria 8083
507 Ga0501081_0097038 3300049743 Bacteria 2079
508 Ga0501044_0414410 3300049823 Bacteria 1258
509 Ga0501045_0114801 3300049824 Bacteria 1997
510 nmdc:mga03683_5_c1 3300050489 Bacteria 157897
511 nmdc:mga03n38_2101_c1 3300050490 Bacteria 6040
512 nmdc:mga00v17_57_c1 3300050491 Bacteria 70460
513 nmdc:mga06z11_159611_c1 3300050494 Unclassified 1288
514 nmdc:mga07m45_3628_c1 3300050496 Bacteria 3673
515 nmdc:mga05p37_163798_c1 3300050507 Bacteria 2714
516 nmdc:mga05p37_4965_c1 3300050507 Bacteria 15585
517 nmdc:mga05p37_719453_c1 3300050507 Bacteria 1106
518 nmdc:mga09592_1229_c1 3300050508 Bacteria 20503
519 nmdc:mga09592_3011_c1 3300050508 Bacteria 13659
520 nmdc:mga09592_445312_c1 3300050508 Bacteria 1118
521 nmdc:mga0qj67_1329_c1 3300050509 Bacteria 17391
522 nmdc:mga0qj67_47182_c1 3300050509 Bacteria 3402
523 nmdc:mga0qj67_67469_c1 3300050509 Bacteria 2850
524 nmdc:mga06r32_115895_c1 3300050510 Bacteria 2639
525 nmdc:mga06r32_1564_c1 3300050510 Bacteria 20649
526 nmdc:mga06r32_1754_c1 3300050510 Bacteria 19484
527 nmdc:mga06r32_23_c1 3300050510 Bacteria 93533
528 nmdc:mga06r32_36592_c1 3300050510 Bacteria 4640
529 nmdc:mga08y16_1796_c1 3300050511 Bacteria 21750
530 nmdc:mga08y16_182959_c1 3300050511 Bacteria 2175
531 nmdc:mga08y16_192566_c1 3300050511 Bacteria 2115
532 nmdc:mga08y16_203444_c1 3300050511 Bacteria 2052
533 nmdc:mga08y16_21767_c1 3300050511 Bacteria 6765
534 nmdc:mga08y16_372997_c1 3300050511 Bacteria 1464
535 nmdc:mga0n895_151967_c1 3300050512 Bacteria 2346
536 nmdc:mga0n895_71773_c1 3300050512 Bacteria 3434
537 nmdc:mga0a205_25254_c1 3300050515 Bacteria 5659
538 nmdc:mga0a205_3923_c1 3300050515 Bacteria 13314
539 Ga0495619_0102243 3300053085 Bacteria 1952
540 Ga0500583_0047109 3300053092 Bacteria 1986
541 Ga0500556_0046748 3300053104 Bacteria 1550
542 Ga0500595_000030 3300053119 Bacteria 117206
543 Ga0500588_0002719 3300053146 Bacteria 3639
544 Ga0500589_027766 3300053147 Bacteria 2629
545 Ga0500616_0109872 3300053153 Bacteria 1333
546 Ga0500622_0028628 3300053156 Bacteria 2932
547 Ga0500638_000025 3300053162 Bacteria 58648
548 Ga0500637_0003613 3300053178 Bacteria 7186
549 Ga0501084_0051387 3300054114 Bacteria 3449
550 Ga0501084_0092141 3300054114 Bacteria 2544
551 Ga0501082_0024730 3300060353 Bacteria 5177
552 Ga0530510_0009577 3300061734 Bacteria 6796
553 Ga0530510_0013175 3300061734 Bacteria 5815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028666 Ga0265336_10011608 Ga0265336_100116083 270
2 3300031727 Ga0316576_10155332 Ga0316576_101553322 280
3 3300031733 Ga0316577_10024504 Ga0316577_100245043 280
4 3300036712 Ga0316584_0101950 Ga0316584_0101950_161_1111 280
5 3300050494 nmdc:mga06z11_159611_c1 nmdc:mga06z11_159611_c1_416_1270 280
6 3300005564 Ga0070664_100229510 Ga0070664_1002295102 285
7 3300026118 Ga0207675_100144489 Ga0207675_1001444892 287
8 3300021384 Ga0213876_10180398 Ga0213876_101803981 289
9 3300039437 Ga0436365_0617032 Ga0436365_0617032_98_973 289
10 3300042876 Ga0451577_0020574 Ga0451577_0020574_2417_3376 291
11 3300045051 Ga0451576_0003991 Ga0451576_0003991_6304_7263 291
12 3300039437 Ga0436365_1496504 Ga0436365_1496504_624_1505 292
13 3300044673 Ga0453683_0042852 Ga0453683_0042852_23_982 292
14 3300005441 Ga0070700_100086468 Ga0070700_1000864682 295
15 3300025893 Ga0207682_10052242 Ga0207682_100522422 296
16 3300014745 Ga0157377_10011442 Ga0157377_100114423 297
17 3300044712 Ga0453684_0039333 Ga0453684_0039333_1597_2586 297
18 3300009094 Ga0111539_10142127 Ga0111539_101421272 299
19 3300027907 Ga0207428_10075062 Ga0207428_100750623 299
20 3300050511 nmdc:mga08y16_203444_c1 nmdc:mga08y16_203444_c1_668_1630 299
21 3300036712 Ga0316584_0098882 Ga0316584_0098882_287_1237 300
22 3300031691 Ga0316579_10005725 Ga0316579_100057253 301
23 3300031728 Ga0316578_10189610 Ga0316578_101896101 301
24 3300031733 Ga0316577_10025454 Ga0316577_100254542 301
25 3300032133 Ga0316583_10011041 Ga0316583_100110413 301
26 3300036647 Ga0316582_0060818 Ga0316582_0060818_1231_2193 301
27 3300044712 Ga0453684_0305306 Ga0453684_0305306_573_1514 301
28 3300044712 Ga0453684_0466131 Ga0453684_0466131_180_1184 301
29 3300021361 Ga0213872_10001678 Ga0213872_100016785 303
30 3300039447 Ga0436361_0403612 Ga0436361_0403612_19359_20324 303
31 3300044712 Ga0453684_0006822 Ga0453684_0006822_10329_11291 303
32 3300048906 Ga0496103_0094883 Ga0496103_0094883_619_1584 303
33 3300048919 Ga0496116_0014892 Ga0496116_0014892_4106_5071 303
34 3300048920 Ga0496117_0002449 Ga0496117_0002449_6478_7443 303
35 3300048921 Ga0496118_0000005 Ga0496118_0000005_88898_89863 303
36 3300048922 Ga0496119_0018502 Ga0496119_0018502_2704_3669 303
37 3300048927 Ga0496124_0123606 Ga0496124_0123606_407_1372 303
38 3300048928 Ga0496125_0054486 Ga0496125_0054486_1288_2253 303
39 3300048929 Ga0496126_0201103 Ga0496126_0201103_242_1207 303
40 3300049569 Ga0501032_0127723 Ga0501032_0127723_735_1655 304
41 3300009551 Ga0105238_10185332 Ga0105238_101853322 305
42 3300025924 Ga0207694_10255706 Ga0207694_102557061 305
43 3300031727 Ga0316576_10001779 Ga0316576_100017793 305
44 3300031728 Ga0316578_10004886 Ga0316578_100048862 305
45 3300031733 Ga0316577_10122455 Ga0316577_101224552 305
46 3300033541 Ga0316596_1022362 Ga0316596_10223622 305
47 3300036647 Ga0316582_0053939 Ga0316582_0053939_1378_2334 305
48 3300036712 Ga0316584_0069960 Ga0316584_0069960_774_1730 305
49 3300006852 Ga0075433_10007382 Ga0075433_100073822 306
50 3300006871 Ga0075434_100007659 Ga0075434_1000076595 306
51 3300009094 Ga0111539_10519599 Ga0111539_105195992 306
52 3300046459 Ga0495629_0050523 Ga0495629_0050523_1965_2900 306
53 3300050512 nmdc:mga0n895_151967_c1 nmdc:mga0n895_151967_c1_767_1747 306
54 3300050515 nmdc:mga0a205_25254_c1 nmdc:mga0a205_25254_c1_244_1224 306
55 3300005718 Ga0068866_10000017 Ga0068866_1000001712 308
56 3300005842 Ga0068858_100272250 Ga0068858_1002722502 308
57 3300025913 Ga0207695_10007489 Ga0207695_100074893 308
58 3300026035 Ga0207703_10249535 Ga0207703_102495352 308
59 3300044712 Ga0453684_0399622 Ga0453684_0399622_83_1033 309
60 3300028666 Ga0265336_10022375 Ga0265336_100223752 310
61 3300031238 Ga0265332_10143023 Ga0265332_101430231 310
62 3300028800 Ga0265338_10120413 Ga0265338_101204132 311
63 3300026088 Ga0207641_10143926 Ga0207641_101439262 313
64 3300005842 Ga0068858_100183473 Ga0068858_1001834732 314
65 3300009093 Ga0105240_10001142 Ga0105240_1000114240 314
66 3300009176 Ga0105242_10000079 Ga0105242_1000007911 314
67 3300009176 Ga0105242_10080189 Ga0105242_100801892 314
68 3300009553 Ga0105249_10002062 Ga0105249_100020622 314
69 3300010375 Ga0105239_10000363 Ga0105239_1000036311 314
70 3300014968 Ga0157379_10119018 Ga0157379_101190182 314
71 3300025899 Ga0207642_10000037 Ga0207642_100000372 314
72 3300025934 Ga0207686_10000056 Ga0207686_10000056107 314
73 3300025961 Ga0207712_10003871 Ga0207712_100038712 314
74 3300026035 Ga0207703_10481588 Ga0207703_104815881 314
75 3300037068 Ga0373925_0076016 Ga0373925_0076016_888_1847 314
76 3300053119 Ga0500595_000030 Ga0500595_000030_57656_58606 314
77 3300005458 Ga0070681_10212275 Ga0070681_102122751 315
78 3300005530 Ga0070679_100039525 Ga0070679_1000395255 315
79 3300006048 Ga0075363_100000228 Ga0075363_1000002283 315
80 3300006353 Ga0075370_10000845 Ga0075370_100008455 315
81 3300014968 Ga0157379_10309568 Ga0157379_103095682 315
82 3300025921 Ga0207652_10011827 Ga0207652_100118275 315
83 3300031903 Ga0307407_10000159 Ga0307407_100001595 315
84 3300032002 Ga0307416_100284961 Ga0307416_1002849612 315
85 3300050490 nmdc:mga03n38_2101_c1 nmdc:mga03n38_2101_c1_2118_3083 315
86 3300006178 Ga0075367_10086374 Ga0075367_100863742 316
87 3300025914 Ga0207671_10007939 Ga0207671_100079396 316
88 3300028577 Ga0265318_10021318 Ga0265318_100213182 316
89 3300031235 Ga0265330_10042904 Ga0265330_100429042 316
90 3300031238 Ga0265332_10006879 Ga0265332_100068792 316
91 3300031250 Ga0265331_10089166 Ga0265331_100891662 316
92 3300031344 Ga0265316_10015427 Ga0265316_100154275 316
93 3300031711 Ga0265314_10089959 Ga0265314_100899592 316
94 3300031712 Ga0265342_10006773 Ga0265342_100067738 316
95 3300031727 Ga0316576_10153537 Ga0316576_101535372 316
96 3300031728 Ga0316578_10053234 Ga0316578_100532342 316
97 3300042876 Ga0451577_0001014 Ga0451577_0001014_10384_11334 316
98 3300044712 Ga0453684_0000004 Ga0453684_0000004_1324900_1325850 316
99 3300003320 rootH2_10024292 rootH2_100242925 317
100 3300005295 Ga0065707_10084331 Ga0065707_100843314 317
101 3300005334 Ga0068869_100004285 Ga0068869_1000042853 317
102 3300005336 Ga0070680_100058466 Ga0070680_1000584663 317
103 3300005336 Ga0070680_100069075 Ga0070680_1000690754 317
104 3300005340 Ga0070689_100037509 Ga0070689_1000375093 317
105 3300005344 Ga0070661_100130104 Ga0070661_1001301042 317
106 3300005347 Ga0070668_100043094 Ga0070668_1000430942 317
107 3300005353 Ga0070669_100019225 Ga0070669_1000192252 317
108 3300005354 Ga0070675_100009949 Ga0070675_1000099493 317
109 3300005364 Ga0070673_100001418 Ga0070673_1000014184 317
110 3300005365 Ga0070688_100005825 Ga0070688_1000058252 317
111 3300005367 Ga0070667_100045854 Ga0070667_1000458542 317
112 3300005441 Ga0070700_100066894 Ga0070700_1000668942 317
113 3300005456 Ga0070678_100024760 Ga0070678_1000247602 317
114 3300005457 Ga0070662_100256388 Ga0070662_1002563882 317
115 3300005459 Ga0068867_100121607 Ga0068867_1001216072 317
116 3300005466 Ga0070685_10025917 Ga0070685_100259172 317
117 3300005530 Ga0070679_100315778 Ga0070679_1003157782 317
118 3300005535 Ga0070684_100024702 Ga0070684_1000247022 317
119 3300005544 Ga0070686_100010989 Ga0070686_1000109892 317
120 3300009092 Ga0105250_10000031 Ga0105250_1000003164 317
121 3300009177 Ga0105248_10127210 Ga0105248_101272102 317
122 3300009553 Ga0105249_10011737 Ga0105249_100117378 317
123 3300013306 Ga0163162_10192761 Ga0163162_101927611 317
124 3300013306 Ga0163162_10396983 Ga0163162_103969832 317
125 3300013308 Ga0157375_10038449 Ga0157375_100384492 317
126 3300013308 Ga0157375_10329980 Ga0157375_103299802 317
127 3300014325 Ga0163163_10007180 Ga0163163_100071802 317
128 3300014968 Ga0157379_10000077 Ga0157379_1000007752 317
129 3300014969 Ga0157376_10143807 Ga0157376_101438072 317
130 3300025711 Ga0207696_1000125 Ga0207696_100012530 317
131 3300025901 Ga0207688_10014127 Ga0207688_100141272 317
132 3300025917 Ga0207660_10063527 Ga0207660_100635271 317
133 3300025921 Ga0207652_10258098 Ga0207652_102580982 317
134 3300031507 Ga0307509_10000675 Ga0307509_1000067515 317
135 3300031995 Ga0307409_100326474 Ga0307409_1003264742 317
136 3300035242 Ga0373962_0006701 Ga0373962_0006701_1749_2702 317
137 3300038726 Ga0400490_58235 Ga0400490_58235_287_1282 317
138 3300041501 Ga0451845_0281783 Ga0451845_0281783_2146_3099 317
139 3300042876 Ga0451577_0003000 Ga0451577_0003000_9077_10060 317
140 3300044712 Ga0453684_0281852 Ga0453684_0281852_711_1694 317
141 3300045051 Ga0451576_0235671 Ga0451576_0235671_619_1572 317
142 3300048909 Ga0496106_0015205 Ga0496106_0015205_532_1485 317
143 3300048910 Ga0496107_0305553 Ga0496107_0305553_134_1087 317
144 3300048911 Ga0496108_0122731 Ga0496108_0122731_1246_2199 317
145 3300048912 Ga0496109_0108010 Ga0496109_0108010_139_1092 317
146 3300048913 Ga0496110_0061872 Ga0496110_0061872_1749_2702 317
147 3300048914 Ga0496111_0245999 Ga0496111_0245999_345_1298 317
148 3300048915 Ga0496112_0025579 Ga0496112_0025579_3727_4680 317
149 3300048917 Ga0496114_0158906 Ga0496114_0158906_831_1784 317
150 3300048920 Ga0496117_0000217 Ga0496117_0000217_4747_5700 317
151 3300053162 Ga0500638_000025 Ga0500638_000025_12714_13712 317
152 iso_pu_bacteria 2547132103 2547371871 317
153 iso_pu_bacteria 2843690924 2843693783 317
154 iso_pu_bacteria 2846033681 2846034687 317
155 3300005327 Ga0070658_10462966 Ga0070658_104629661 318
156 3300005356 Ga0070674_100321148 Ga0070674_1003211482 318
157 3300005842 Ga0068858_100336596 Ga0068858_1003365962 318
158 3300005844 Ga0068862_100157540 Ga0068862_1001575401 318
159 3300005844 Ga0068862_100305314 Ga0068862_1003053142 318
160 3300006051 Ga0075364_10000033 Ga0075364_100000336 318
161 3300006177 Ga0075362_10000010 Ga0075362_100000106 318
162 3300006844 Ga0075428_100105858 Ga0075428_1001058584 318
163 3300009147 Ga0114129_10887469 Ga0114129_108874691 318
164 3300009176 Ga0105242_10001122 Ga0105242_100011227 318
165 3300010375 Ga0105239_10442113 Ga0105239_104421132 318
166 3300025934 Ga0207686_10005280 Ga0207686_100052802 318
167 3300028380 Ga0268265_10121626 Ga0268265_101216262 318
168 3300028380 Ga0268265_10300459 Ga0268265_103004591 318
169 3300032005 Ga0307411_10279099 Ga0307411_102790992 318
170 3300035398 Ga0316574_0111482 Ga0316574_0111482_387_1343 318
171 3300036712 Ga0316584_0332847 Ga0316584_0332847_50_1006 318
172 3300046472 Ga0495580_0000222 Ga0495580_0000222_4846_5817 318
173 3300046473 Ga0495582_0014686 Ga0495582_0014686_2178_3149 318
174 3300046499 Ga0495594_0002829 Ga0495594_0002829_6841_7812 318
175 3300046557 Ga0495622_0039488 Ga0495622_0039488_353_1324 318
176 3300046683 Ga0495658_0083689 Ga0495658_0083689_875_1846 318
177 3300049568 Ga0501031_0018241 Ga0501031_0018241_3438_4400 318
178 3300050489 nmdc:mga03683_5_c1 nmdc:mga03683_5_c1_152605_153612 318
179 3300050491 nmdc:mga00v17_57_c1 nmdc:mga00v17_57_c1_8969_9976 318
180 3300050507 nmdc:mga05p37_719453_c1 nmdc:mga05p37_719453_c1_107_1063 318
181 3300005295 Ga0065707_10082014 Ga0065707_100820145 319
182 3300005328 Ga0070676_10094023 Ga0070676_100940232 319
183 3300005331 Ga0070670_100100035 Ga0070670_1001000352 319
184 3300005344 Ga0070661_100090762 Ga0070661_1000907622 319
185 3300005354 Ga0070675_100036845 Ga0070675_1000368454 319
186 3300005355 Ga0070671_100153139 Ga0070671_1001531392 319
187 3300005356 Ga0070674_100043941 Ga0070674_1000439413 319
188 3300005364 Ga0070673_100028403 Ga0070673_1000284032 319
189 3300005543 Ga0070672_100051991 Ga0070672_1000519912 319
190 3300005548 Ga0070665_100036844 Ga0070665_1000368443 319
191 3300005563 Ga0068855_100008013 Ga0068855_10000801310 319
192 3300005564 Ga0070664_100050762 Ga0070664_1000507623 319
193 3300005614 Ga0068856_100016351 Ga0068856_1000163515 319
194 3300005617 Ga0068859_100000949 Ga0068859_10000094928 319
195 3300005618 Ga0068864_100010108 Ga0068864_1000101083 319
196 3300005719 Ga0068861_100007784 Ga0068861_1000077842 319
197 3300005719 Ga0068861_100011501 Ga0068861_1000115013 319
198 3300005719 Ga0068861_100046462 Ga0068861_1000464623 319
199 3300005719 Ga0068861_100140942 Ga0068861_1001409422 319
200 3300005840 Ga0068870_10008071 Ga0068870_100080712 319
201 3300005844 Ga0068862_100003513 Ga0068862_10000351313 319
202 3300005844 Ga0068862_100006444 Ga0068862_1000064443 319
203 3300006844 Ga0075428_100004267 Ga0075428_10000426711 319
204 3300006844 Ga0075428_100006560 Ga0075428_1000065604 319
205 3300006844 Ga0075428_100014641 Ga0075428_1000146412 319
206 3300006844 Ga0075428_100023966 Ga0075428_1000239665 319
207 3300006844 Ga0075428_100080644 Ga0075428_1000806443 319
208 3300006846 Ga0075430_100003519 Ga0075430_1000035193 319
209 3300006846 Ga0075430_100040450 Ga0075430_1000404503 319
210 3300006846 Ga0075430_100132805 Ga0075430_1001328052 319
211 3300006847 Ga0075431_100000318 Ga0075431_10000031835 319
212 3300006847 Ga0075431_100019561 Ga0075431_1000195616 319
213 3300006847 Ga0075431_100128391 Ga0075431_1001283912 319
214 3300006852 Ga0075433_10000324 Ga0075433_1000032424 319
215 3300006871 Ga0075434_100123192 Ga0075434_1001231923 319
216 3300006880 Ga0075429_100003585 Ga0075429_1000035853 319
217 3300006880 Ga0075429_100020127 Ga0075429_1000201272 319
218 3300006881 Ga0068865_100094673 Ga0068865_1000946731 319
219 3300006881 Ga0068865_100125713 Ga0068865_1001257132 319
220 3300006914 Ga0075436_100222517 Ga0075436_1002225172 319
221 3300006931 Ga0097620_100000949 Ga0097620_1000009495 319
222 3300009093 Ga0105240_10260074 Ga0105240_102600742 319
223 3300009094 Ga0111539_10002735 Ga0111539_1000273514 319
224 3300009094 Ga0111539_10004487 Ga0111539_100044873 319
225 3300009094 Ga0111539_10007684 Ga0111539_100076848 319
226 3300009094 Ga0111539_10145648 Ga0111539_101456483 319
227 3300009094 Ga0111539_10151594 Ga0111539_101515942 319
228 3300009094 Ga0111539_10166258 Ga0111539_101662582 319
229 3300009147 Ga0114129_10003161 Ga0114129_1000316121 319
230 3300009147 Ga0114129_10243269 Ga0114129_102432693 319
231 3300009148 Ga0105243_10024597 Ga0105243_100245972 319
232 3300009551 Ga0105238_10038294 Ga0105238_100382943 319
233 3300009553 Ga0105249_10009313 Ga0105249_100093138 319
234 3300009553 Ga0105249_10094206 Ga0105249_100942062 319
235 3300014326 Ga0157380_10006554 Ga0157380_100065542 319
236 3300014326 Ga0157380_10009308 Ga0157380_100093082 319
237 3300014326 Ga0157380_10095225 Ga0157380_100952252 319
238 3300025907 Ga0207645_10000328 Ga0207645_1000032826 319
239 3300025907 Ga0207645_10038676 Ga0207645_100386762 319
240 3300025917 Ga0207660_10054846 Ga0207660_100548462 319
241 3300025920 Ga0207649_10073938 Ga0207649_100739382 319
242 3300025923 Ga0207681_10005027 Ga0207681_100050271 319
243 3300025923 Ga0207681_10037475 Ga0207681_100374752 319
244 3300025923 Ga0207681_10038908 Ga0207681_100389083 319
245 3300025925 Ga0207650_10031354 Ga0207650_100313543 319
246 3300025925 Ga0207650_10076652 Ga0207650_100766522 319
247 3300025933 Ga0207706_10000476 Ga0207706_1000047618 319
248 3300025933 Ga0207706_10132159 Ga0207706_101321592 319
249 3300025935 Ga0207709_10106720 Ga0207709_101067201 319
250 3300025938 Ga0207704_10148573 Ga0207704_101485732 319
251 3300025940 Ga0207691_10000632 Ga0207691_1000063232 319
252 3300025941 Ga0207711_10022292 Ga0207711_100222923 319
253 3300025942 Ga0207689_10017857 Ga0207689_100178574 319
254 3300025945 Ga0207679_10002843 Ga0207679_100028434 319
255 3300025949 Ga0207667_10026946 Ga0207667_100269463 319
256 3300025960 Ga0207651_10013272 Ga0207651_100132722 319
257 3300025972 Ga0207668_10094928 Ga0207668_100949282 319
258 3300025981 Ga0207640_10040229 Ga0207640_100402292 319
259 3300026035 Ga0207703_10025563 Ga0207703_100255633 319
260 3300026075 Ga0207708_10014135 Ga0207708_100141352 319
261 3300026075 Ga0207708_10029365 Ga0207708_100293652 319
262 3300026088 Ga0207641_10020703 Ga0207641_100207032 319
263 3300026088 Ga0207641_10289426 Ga0207641_102894262 319
264 3300026089 Ga0207648_10000334 Ga0207648_1000033432 319
265 3300026089 Ga0207648_10016990 Ga0207648_100169904 319
266 3300026095 Ga0207676_10002007 Ga0207676_1000200714 319
267 3300026116 Ga0207674_10036342 Ga0207674_100363422 319
268 3300026118 Ga0207675_100000130 Ga0207675_10000013025 319
269 3300026118 Ga0207675_100003625 Ga0207675_10000362514 319
270 3300026118 Ga0207675_100004174 Ga0207675_10000417415 319
271 3300026118 Ga0207675_100072528 Ga0207675_1000725282 319
272 3300026121 Ga0207683_10011326 Ga0207683_100113265 319
273 3300026121 Ga0207683_10342163 Ga0207683_103421632 319
274 3300027552 Ga0209982_1002614 Ga0209982_10026141 319
275 3300027665 Ga0209983_1005792 Ga0209983_10057922 319
276 3300027682 Ga0209971_1001106 Ga0209971_10011062 319
277 3300027717 Ga0209998_10000179 Ga0209998_1000017923 319
278 3300027876 Ga0209974_10003308 Ga0209974_100033084 319
279 3300027907 Ga0207428_10024858 Ga0207428_100248584 319
280 3300027907 Ga0207428_10156188 Ga0207428_101561881 319
281 3300027907 Ga0207428_10179060 Ga0207428_101790602 319
282 3300028380 Ga0268265_10000723 Ga0268265_1000072313 319
283 3300028380 Ga0268265_10019069 Ga0268265_100190692 319
284 3300028380 Ga0268265_10317806 Ga0268265_103178062 319
285 3300031239 Ga0265328_10014559 Ga0265328_100145592 319
286 3300031456 Ga0307513_10090857 Ga0307513_100908573 319
287 3300031548 Ga0307408_100030515 Ga0307408_1000305153 319
288 3300031665 Ga0316575_10039490 Ga0316575_100394902 319
289 3300031691 Ga0316579_10144817 Ga0316579_101448171 319
290 3300031728 Ga0316578_10105689 Ga0316578_101056891 319
291 3300031733 Ga0316577_10039244 Ga0316577_100392441 319
292 3300031733 Ga0316577_10090808 Ga0316577_100908082 319
293 3300031852 Ga0307410_10411651 Ga0307410_104116512 319
294 3300032002 Ga0307416_100055145 Ga0307416_1000551452 319
295 3300032126 Ga0307415_100246368 Ga0307415_1002463681 319
296 3300032133 Ga0316583_10045789 Ga0316583_100457892 319
297 3300035113 Ga0373936_0020803 Ga0373936_0020803_1425_2384 319
298 3300035398 Ga0316574_0000329 Ga0316574_0000329_381_1340 319
299 3300035398 Ga0316574_0002786 Ga0316574_0002786_7580_8539 319
300 3300035398 Ga0316574_0015151 Ga0316574_0015151_148_1107 319
301 3300035398 Ga0316574_0142845 Ga0316574_0142845_275_1234 319
302 3300035398 Ga0316574_0143032 Ga0316574_0143032_62_1021 319
303 3300035398 Ga0316574_0152343 Ga0316574_0152343_305_1264 319
304 3300035398 Ga0316574_0319309 Ga0316574_0319309_11_970 319
305 3300036401 Ga0373937_0122637 Ga0373937_0122637_508_1578 319
306 3300036647 Ga0316582_0081452 Ga0316582_0081452_246_1205 319
307 3300036712 Ga0316584_0018123 Ga0316584_0018123_3813_4772 319
308 3300036712 Ga0316584_0083231 Ga0316584_0083231_668_1633 319
309 3300036712 Ga0316584_0103170 Ga0316584_0103170_740_1699 319
310 3300036712 Ga0316584_0120532 Ga0316584_0120532_704_1663 319
311 3300042126 Ga0450888_008362 Ga0450888_008362_135_1094 319
312 3300042438 Ga0439459_0018020 Ga0439459_0018020_177_1136 319
313 3300042876 Ga0451577_0134886 Ga0451577_0134886_576_1535 319
314 3300042876 Ga0451577_0192953 Ga0451577_0192953_680_1639 319
315 3300044683 Ga0466965_0073140 Ga0466965_0073140_588_1550 319
316 3300044712 Ga0453684_0005071 Ga0453684_0005071_4462_5421 319
317 3300046460 Ga0495638_0005220 Ga0495638_0005220_5854_6855 319
318 3300046460 Ga0495638_0122711 Ga0495638_0122711_241_1203 319
319 3300046471 Ga0495650_0017519 Ga0495650_0017519_2318_3277 319
320 3300046660 Ga0495625_0015664 Ga0495625_0015664_2876_3877 319
321 3300047320 Ga0495672_0121092 Ga0495672_0121092_85_1044 319
322 3300048924 Ga0496121_0061401 Ga0496121_0061401_400_1359 319
323 3300049568 Ga0501031_0090224 Ga0501031_0090224_979_1938 319
324 3300049571 Ga0501034_0221392 Ga0501034_0221392_450_1409 319
325 3300049572 Ga0501036_0112288 Ga0501036_0112288_926_1885 319
326 3300049574 Ga0501038_0082063 Ga0501038_0082063_458_1417 319
327 3300049575 Ga0501039_0068810 Ga0501039_0068810_1522_2481 319
328 3300049575 Ga0501039_0142770 Ga0501039_0142770_212_1171 319
329 3300049576 Ga0501040_0027763 Ga0501040_0027763_1673_2632 319
330 3300049577 Ga0501041_0009966 Ga0501041_0009966_557_1516 319
331 3300049580 Ga0501046_0056101 Ga0501046_0056101_1193_2152 319
332 3300049581 Ga0501047_0080172 Ga0501047_0080172_1664_2626 319
333 3300049587 Ga0501071_0235068 Ga0501071_0235068_184_1143 319
334 3300049587 Ga0501071_0409014 Ga0501071_0409014_32_991 319
335 3300049588 Ga0501072_0043585 Ga0501072_0043585_1064_2023 319
336 3300049593 Ga0501077_0055593 Ga0501077_0055593_1482_2441 319
337 3300049741 Ga0501079_0036949 Ga0501079_0036949_1470_2429 319
338 3300049742 Ga0501080_0060229 Ga0501080_0060229_1733_2692 319
339 3300049743 Ga0501081_0002687 Ga0501081_0002687_7204_8163 319
340 3300049743 Ga0501081_0005664 Ga0501081_0005664_3153_4112 319
341 3300049823 Ga0501044_0414410 Ga0501044_0414410_70_1032 319
342 3300049824 Ga0501045_0114801 Ga0501045_0114801_579_1538 319
343 3300050507 nmdc:mga05p37_163798_c1 nmdc:mga05p37_163798_c1_962_1921 319
344 3300050507 nmdc:mga05p37_4965_c1 nmdc:mga05p37_4965_c1_10083_11042 319
345 3300050508 nmdc:mga09592_1229_c1 nmdc:mga09592_1229_c1_14610_15569 319
346 3300050508 nmdc:mga09592_3011_c1 nmdc:mga09592_3011_c1_3742_4743 319
347 3300050508 nmdc:mga09592_445312_c1 nmdc:mga09592_445312_c1_21_1016 319
348 3300050509 nmdc:mga0qj67_1329_c1 nmdc:mga0qj67_1329_c1_5414_6373 319
349 3300050509 nmdc:mga0qj67_47182_c1 nmdc:mga0qj67_47182_c1_1212_2213 319
350 3300050509 nmdc:mga0qj67_67469_c1 nmdc:mga0qj67_67469_c1_372_1373 319
351 3300050510 nmdc:mga06r32_115895_c1 nmdc:mga06r32_115895_c1_226_1185 319
352 3300050510 nmdc:mga06r32_1564_c1 nmdc:mga06r32_1564_c1_3904_4863 319
353 3300050510 nmdc:mga06r32_1754_c1 nmdc:mga06r32_1754_c1_7248_8207 319
354 3300050510 nmdc:mga06r32_23_c1 nmdc:mga06r32_23_c1_33223_34224 319
355 3300050510 nmdc:mga06r32_36592_c1 nmdc:mga06r32_36592_c1_3132_4127 319
356 3300050511 nmdc:mga08y16_1796_c1 nmdc:mga08y16_1796_c1_3740_4741 319
357 3300050511 nmdc:mga08y16_182959_c1 nmdc:mga08y16_182959_c1_1091_2050 319
358 3300050511 nmdc:mga08y16_192566_c1 nmdc:mga08y16_192566_c1_748_1707 319
359 3300050511 nmdc:mga08y16_21767_c1 nmdc:mga08y16_21767_c1_1248_2243 319
360 3300050511 nmdc:mga08y16_372997_c1 nmdc:mga08y16_372997_c1_194_1153 319
361 3300050512 nmdc:mga0n895_71773_c1 nmdc:mga0n895_71773_c1_1022_1981 319
362 3300050515 nmdc:mga0a205_3923_c1 nmdc:mga0a205_3923_c1_1758_2717 319
363 3300053092 Ga0500583_0047109 Ga0500583_0047109_347_1363 319
364 3300053104 Ga0500556_0046748 Ga0500556_0046748_162_1124 319
365 3300053146 Ga0500588_0002719 Ga0500588_0002719_1561_2577 319
366 3300053147 Ga0500589_027766 Ga0500589_027766_1012_1974 319
367 3300053156 Ga0500622_0028628 Ga0500622_0028628_363_1325 319
368 3300053178 Ga0500637_0003613 Ga0500637_0003613_4426_5385 319
369 3300054114 Ga0501084_0051387 Ga0501084_0051387_1083_2042 319
370 3300060353 Ga0501082_0024730 Ga0501082_0024730_2847_3806 319
371 3300061734 Ga0530510_0009577 Ga0530510_0009577_1446_2405 319
372 iso_pu_bacteria 2894023352 2894026275 319
373 3300005844 Ga0068862_100068242 Ga0068862_1000682423 320
374 3300031903 Ga0307407_10088099 Ga0307407_100880991 320
375 3300032005 Ga0307411_10150272 Ga0307411_101502722 320
376 3300032126 Ga0307415_100280364 Ga0307415_1002803641 320
377 3300036647 Ga0316582_0058595 Ga0316582_0058595_1352_2362 320
378 3300036712 Ga0316584_0008527 Ga0316584_0008527_4191_5201 320
379 3300037068 Ga0373925_0071756 Ga0373925_0071756_128_1108 320
380 3300039062 Ga0400483_264974 Ga0400483_264974_241_1203 320
381 3300042876 Ga0451577_0009807 Ga0451577_0009807_165_1127 320
382 3300042876 Ga0451577_0253051 Ga0451577_0253051_356_1318 320
383 3300044712 Ga0453684_0064164 Ga0453684_0064164_2812_3774 320
384 3300044712 Ga0453684_0186082 Ga0453684_0186082_956_1918 320
385 3300044712 Ga0453684_0360823 Ga0453684_0360823_148_1110 320
386 3300045051 Ga0451576_0041436 Ga0451576_0041436_2987_3949 320
387 3300045051 Ga0451576_0371788 Ga0451576_0371788_214_1176 320
388 3300046514 Ga0495618_0000493 Ga0495618_0000493_13084_14064 320
389 3300046663 Ga0495635_0146020 Ga0495635_0146020_64_1044 320
390 3300005518 Ga0070699_100164981 Ga0070699_1001649812 321
391 3300028800 Ga0265338_10007418 Ga0265338_100074189 321
392 3300031665 Ga0316575_10084575 Ga0316575_100845752 321
393 3300031691 Ga0316579_10001070 Ga0316579_100010703 321
394 3300031691 Ga0316579_10001665 Ga0316579_100016653 321
395 3300031691 Ga0316579_10012515 Ga0316579_100125151 321
396 3300031691 Ga0316579_10031534 Ga0316579_100315342 321
397 3300031727 Ga0316576_10014175 Ga0316576_100141752 321
398 3300031727 Ga0316576_10020823 Ga0316576_100208231 321
399 3300031728 Ga0316578_10019580 Ga0316578_100195802 321
400 3300031728 Ga0316578_10021434 Ga0316578_100214342 321
401 3300031728 Ga0316578_10182048 Ga0316578_101820481 321
402 3300031733 Ga0316577_10042952 Ga0316577_100429522 321
403 3300032133 Ga0316583_10001094 Ga0316583_100010942 321
404 3300032133 Ga0316583_10007990 Ga0316583_100079903 321
405 3300032133 Ga0316583_10010960 Ga0316583_100109601 321
406 3300032137 Ga0316585_10047630 Ga0316585_100476301 321
407 3300036647 Ga0316582_0022605 Ga0316582_0022605_2289_3254 321
408 3300036647 Ga0316582_0029636 Ga0316582_0029636_289_1254 321
409 3300036647 Ga0316582_0173401 Ga0316582_0173401_195_1160 321
410 3300036712 Ga0316584_0009729 Ga0316584_0009729_2302_3267 321
411 3300036712 Ga0316584_0073505 Ga0316584_0073505_826_1791 321
412 3300037588 Ga0316581_0000182 Ga0316581_0000182_4928_5893 321
413 3300041486 Ga0451807_2137144 Ga0451807_2137144_250_1215 321
414 3300002070 JGI24750J21931_1011485 JGI24750J21931_10114851 322
415 3300002459 JGI24751J29686_10013169 JGI24751J29686_100131692 322
416 3300005293 Ga0065715_10207317 Ga0065715_102073171 322
417 3300005329 Ga0070683_100147954 Ga0070683_1001479541 322
418 3300005330 Ga0070690_100031958 Ga0070690_1000319584 322
419 3300005331 Ga0070670_100236711 Ga0070670_1002367112 322
420 3300005333 Ga0070677_10005739 Ga0070677_100057392 322
421 3300005334 Ga0068869_100012967 Ga0068869_1000129672 322
422 3300005338 Ga0068868_100010735 Ga0068868_1000107356 322
423 3300005339 Ga0070660_100022157 Ga0070660_1000221574 322
424 3300005340 Ga0070689_100041679 Ga0070689_1000416794 322
425 3300005343 Ga0070687_100011039 Ga0070687_1000110391 322
426 3300005344 Ga0070661_100041720 Ga0070661_1000417202 322
427 3300005355 Ga0070671_100019517 Ga0070671_1000195173 322
428 3300005364 Ga0070673_100071260 Ga0070673_1000712602 322
429 3300005365 Ga0070688_100003326 Ga0070688_1000033267 322
430 3300005366 Ga0070659_100059507 Ga0070659_1000595074 322
431 3300005366 Ga0070659_100308366 Ga0070659_1003083662 322
432 3300005455 Ga0070663_100008065 Ga0070663_1000080656 322
433 3300005457 Ga0070662_100000067 Ga0070662_10000006731 322
434 3300005457 Ga0070662_100182702 Ga0070662_1001827022 322
435 3300005466 Ga0070685_10037074 Ga0070685_100370742 322
436 3300005530 Ga0070679_100412904 Ga0070679_1004129042 322
437 3300005535 Ga0070684_100052895 Ga0070684_1000528953 322
438 3300005543 Ga0070672_100067904 Ga0070672_1000679042 322
439 3300005543 Ga0070672_100233573 Ga0070672_1002335732 322
440 3300005544 Ga0070686_100094842 Ga0070686_1000948422 322
441 3300005548 Ga0070665_100015281 Ga0070665_1000152812 322
442 3300005548 Ga0070665_100055889 Ga0070665_1000558894 322
443 3300005563 Ga0068855_100002858 Ga0068855_1000028583 322
444 3300005577 Ga0068857_100003771 Ga0068857_1000037714 322
445 3300005578 Ga0068854_100004880 Ga0068854_1000048806 322
446 3300005578 Ga0068854_100027260 Ga0068854_1000272601 322
447 3300005614 Ga0068856_100000655 Ga0068856_10000065527 322
448 3300005615 Ga0070702_100002192 Ga0070702_1000021921 322
449 3300005616 Ga0068852_100081076 Ga0068852_1000810763 322
450 3300005616 Ga0068852_100280358 Ga0068852_1002803582 322
451 3300005718 Ga0068866_10005527 Ga0068866_100055272 322
452 3300005834 Ga0068851_10015417 Ga0068851_100154172 322
453 3300005840 Ga0068870_10003791 Ga0068870_100037916 322
454 3300009176 Ga0105242_10027613 Ga0105242_100276133 322
455 3300009176 Ga0105242_10064137 Ga0105242_100641372 322
456 3300013102 Ga0157371_10000750 Ga0157371_100007501 322
457 3300013104 Ga0157370_10043391 Ga0157370_100433915 322
458 3300013105 Ga0157369_10094104 Ga0157369_100941042 322
459 3300013105 Ga0157369_10239194 Ga0157369_102391942 322
460 3300013297 Ga0157378_10439434 Ga0157378_104394342 322
461 3300013307 Ga0157372_10001241 Ga0157372_1000124110 322
462 3300013308 Ga0157375_10922781 Ga0157375_109227811 322
463 3300014326 Ga0157380_10016863 Ga0157380_100168635 322
464 3300014745 Ga0157377_10079238 Ga0157377_100792382 322
465 3300014968 Ga0157379_10116647 Ga0157379_101166472 322
466 3300017792 Ga0163161_10135821 Ga0163161_101358212 322
467 3300025290 Ga0207673_1004870 Ga0207673_10048701 322
468 3300025315 Ga0207697_10000171 Ga0207697_100001718 322
469 3300025321 Ga0207656_10007073 Ga0207656_100070733 322
470 3300025893 Ga0207682_10004237 Ga0207682_100042375 322
471 3300025903 Ga0207680_10099213 Ga0207680_100992132 322
472 3300025908 Ga0207643_10000103 Ga0207643_1000010315 322
473 3300025918 Ga0207662_10004626 Ga0207662_100046263 322
474 3300025919 Ga0207657_10005331 Ga0207657_100053314 322
475 3300025919 Ga0207657_10073143 Ga0207657_100731433 322
476 3300025920 Ga0207649_10050220 Ga0207649_100502203 322
477 3300025923 Ga0207681_10224575 Ga0207681_102245752 322
478 3300025923 Ga0207681_10283403 Ga0207681_102834032 322
479 3300025925 Ga0207650_10081194 Ga0207650_100811942 322
480 3300025926 Ga0207659_10039510 Ga0207659_100395104 322
481 3300025931 Ga0207644_10045228 Ga0207644_100452282 322
482 3300025933 Ga0207706_10000202 Ga0207706_1000020254 322
483 3300025933 Ga0207706_10005393 Ga0207706_100053938 322
484 3300025934 Ga0207686_10013854 Ga0207686_100138542 322
485 3300025936 Ga0207670_10042957 Ga0207670_100429573 322
486 3300025940 Ga0207691_10003113 Ga0207691_100031132 322
487 3300025940 Ga0207691_10026837 Ga0207691_100268374 322
488 3300025941 Ga0207711_10223449 Ga0207711_102234492 322
489 3300025942 Ga0207689_10022250 Ga0207689_100222504 322
490 3300025944 Ga0207661_10195066 Ga0207661_101950661 322
491 3300025949 Ga0207667_10001108 Ga0207667_100011085 322
492 3300025960 Ga0207651_10029855 Ga0207651_100298553 322
493 3300025981 Ga0207640_10207330 Ga0207640_102073301 322
494 3300026023 Ga0207677_10055404 Ga0207677_100554043 322
495 3300026035 Ga0207703_10199038 Ga0207703_101990382 322
496 3300026067 Ga0207678_10001836 Ga0207678_100018367 322
497 3300026067 Ga0207678_10006513 Ga0207678_100065137 322
498 3300026075 Ga0207708_10014149 Ga0207708_100141495 322
499 3300026078 Ga0207702_10000428 Ga0207702_1000042824 322
500 3300026089 Ga0207648_10008751 Ga0207648_100087518 322
501 3300026095 Ga0207676_10070867 Ga0207676_100708672 322
502 3300026116 Ga0207674_10035461 Ga0207674_100354612 322
503 3300026118 Ga0207675_100009816 Ga0207675_1000098163 322
504 3300026121 Ga0207683_10097450 Ga0207683_100974502 322
505 3300026142 Ga0207698_10225102 Ga0207698_102251022 322
506 3300028379 Ga0268266_10045604 Ga0268266_100456043 322
507 3300028379 Ga0268266_10101589 Ga0268266_101015892 322
508 3300028794 Ga0307515_10009179 Ga0307515_100091797 322
509 3300031649 Ga0307514_10002133 Ga0307514_1000213320 322
510 3300031730 Ga0307516_10001981 Ga0307516_1000198112 322
511 3300036401 Ga0373937_0105250 Ga0373937_0105250_124_1149 322
512 3300037068 Ga0373925_0400756 Ga0373925_0400756_98_1066 322
513 3300037471 Ga0395905_0043801 Ga0395905_0043801_2367_3338 322
514 3300039447 Ga0436361_0757428 Ga0436361_0757428_10580_11563 322
515 3300042876 Ga0451577_0033205 Ga0451577_0033205_1193_2167 322
516 3300044656 Ga0466969_0000065 Ga0466969_0000065_5944_6915 322
517 3300044673 Ga0453683_0005987 Ga0453683_0005987_6112_7086 322
518 3300044684 Ga0466966_0022221 Ga0466966_0022221_2119_3090 322
519 3300044712 Ga0453684_0042797 Ga0453684_0042797_1959_2933 322
520 3300044712 Ga0453684_0166183 Ga0453684_0166183_986_1960 322
521 3300045051 Ga0451576_0024379 Ga0451576_0024379_1769_2743 322
522 3300046528 Ga0495642_0061772 Ga0495642_0061772_55_1023 322
523 3300046539 Ga0495621_0027832 Ga0495621_0027832_625_1593 322
524 3300048903 Ga0496100_0083223 Ga0496100_0083223_122_1090 322
525 3300048903 Ga0496100_0167870 Ga0496100_0167870_302_1270 322
526 3300048904 Ga0496101_0075870 Ga0496101_0075870_770_1738 322
527 3300048904 Ga0496101_0433492 Ga0496101_0433492_26_994 322
528 3300048905 Ga0496102_0007859 Ga0496102_0007859_1466_2434 322
529 3300048905 Ga0496102_0208547 Ga0496102_0208547_282_1250 322
530 3300048906 Ga0496103_0144430 Ga0496103_0144430_55_1023 322
531 3300048907 Ga0496104_0161356 Ga0496104_0161356_341_1309 322
532 3300048909 Ga0496106_0000437 Ga0496106_0000437_25512_26480 322
533 3300048909 Ga0496106_0136015 Ga0496106_0136015_88_1056 322
534 3300048910 Ga0496107_0002090 Ga0496107_0002090_7394_8362 322
535 3300048910 Ga0496107_0077212 Ga0496107_0077212_233_1201 322
536 3300048911 Ga0496108_0022330 Ga0496108_0022330_1542_2510 322
537 3300048912 Ga0496109_0041369 Ga0496109_0041369_1490_2458 322
538 3300048913 Ga0496110_0088381 Ga0496110_0088381_797_1765 322
539 3300048918 Ga0496115_0407368 Ga0496115_0407368_94_1062 322
540 3300049568 Ga0501031_0025733 Ga0501031_0025733_1738_2748 322
541 3300049572 Ga0501036_0080828 Ga0501036_0080828_438_1448 322
542 3300049575 Ga0501039_0358116 Ga0501039_0358116_88_1098 322
543 3300049576 Ga0501040_0069225 Ga0501040_0069225_396_1406 322
544 3300049576 Ga0501040_0318510 Ga0501040_0318510_95_1063 322
545 3300049578 Ga0501042_0127219 Ga0501042_0127219_815_1825 322
546 3300049580 Ga0501046_0118060 Ga0501046_0118060_458_1468 322
547 3300049582 Ga0501048_0011793 Ga0501048_0011793_5079_6089 322
548 3300049587 Ga0501071_0017183 Ga0501071_0017183_3281_4291 322
549 3300049590 Ga0501074_0032521 Ga0501074_0032521_2458_3468 322
550 3300049592 Ga0501076_0084094 Ga0501076_0084094_199_1167 322
551 3300049741 Ga0501079_0031420 Ga0501079_0031420_11_1021 322
552 3300049743 Ga0501081_0097038 Ga0501081_0097038_132_1100 322
553 3300050496 nmdc:mga07m45_3628_c1 nmdc:mga07m45_3628_c1_2512_3483 322
554 3300053085 Ga0495619_0102243 Ga0495619_0102243_425_1393 322
555 3300053153 Ga0500616_0109872 Ga0500616_0109872_178_1149 322
556 3300054114 Ga0501084_0092141 Ga0501084_0092141_326_1336 322
557 3300061734 Ga0530510_0013175 Ga0530510_0013175_3197_4207 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

41

350

0.99

PF01039

Carboxyl_trans

Carboxyl transferase domain

66

338

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9656 4 316
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9625 4 316
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9417 5 318
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9387 5 318
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9345 6 318
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9426 5 318 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9397 5 318 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9374 54 315 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9303 54 315 3.90.226.10
af_A4I399_1_165_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8284 144 298 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A659QMM8-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9918 174 279 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A2N8GSY0-F1-model_v4 deleted 0.9906 99 194
AF-A0A3S4IKJ5-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9897 111 295 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A080K7Q6-F1-model_v4 deleted 0.9896 191 281
AF-Q0I3D3-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9883 1 316 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Feature Viewer

pLDDT pTM Quality
90.22 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map