F463302

General Info

Members Datasets Scaffolds Average Seq Length
557 228 1114 372

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100193511|Ga0075431_1001935112
Length 424
Sequence VQPLCSLCLCGEEIHGTTTTETQRTQRLYREELKLGHYTLEGSLNTTSFAVHESIGVKRIVLHRVRVPFLEPFRISNGVVAEKDAILIEITTDQGIVGWGEASPMSGSFYSADTPDSSWTVLKDEMVPALLSLRRVDGDEVHEFLRQQPGDAFSRAGIEGALWDAYANARGIALCELFGIEWRAVPSGVAIGIFETTDELIERVRRYVGEGYQRVKIKIQPGWDLEPVEFVRKQFPHLRLMVDANAAYTLRDLQVFRELDQFELMMIEQPLAASAIEEAGELQAQLKTPLCADESAESLASLEQIINNAAARIINIKVQRVGGLSAALVMLERTRSAGLQCWVGTMPELGIASAQGLHLAMHSGFSFPTDIEASSRWYVDDLVEPPLRIDEAGFIQVPRALGTGFKVVREKIDRYTTAVESFCL

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.9
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 10.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100193511 3300006847 Bacteria 2083
2 JGI25406J46586_10025006 3300003203 Bacteria 2327
3 Ga0065704_10168727 3300005289 Bacteria 1305
4 Ga0065704_10179851 3300005289 Bacteria 1243
5 Ga0065712_10000115 3300005290 Bacteria 144502
6 Ga0065712_10071107 3300005290 Bacteria 5480
7 Ga0065715_10003032 3300005293 Bacteria 5905
8 Ga0065715_10003978 3300005293 Unclassified 4025
9 Ga0065715_10090451 3300005293 Bacteria 6980
10 Ga0065715_10160211 3300005293 Bacteria 1637
11 Ga0065707_10009392 3300005295 Bacteria 2395
12 Ga0070658_10021836 3300005327 Bacteria 5131
13 Ga0070658_10041318 3300005327 Bacteria 3720
14 Ga0070658_10082218 3300005327 Bacteria 2646
15 Ga0070658_10328549 3300005327 Bacteria 1306
16 Ga0070683_100000021 3300005329 Bacteria 183486
17 Ga0070690_100004947 3300005330 Bacteria 7451
18 Ga0070690_100139041 3300005330 Bacteria 1647
19 Ga0070670_100011220 3300005331 Bacteria 7659
20 Ga0070670_100044693 3300005331 Bacteria 3808
21 Ga0068869_100012781 3300005334 Bacteria 5554
22 Ga0068869_100042160 3300005334 Unclassified 3271
23 Ga0068869_100059823 3300005334 Bacteria 2790
24 Ga0068869_100186165 3300005334 Unclassified 1630
25 Ga0070666_10015597 3300005335 Bacteria 4849
26 Ga0070680_100002897 3300005336 Bacteria 12745
27 Ga0070680_100117884 3300005336 Bacteria 2214
28 Ga0070682_100005421 3300005337 Bacteria 7105
29 Ga0070682_100021210 3300005337 Unclassified 3830
30 Ga0068868_100014431 3300005338 Bacteria 5822
31 Ga0068868_100015298 3300005338 Bacteria 5672
32 Ga0068868_100140825 3300005338 Bacteria 1980
33 Ga0070660_100050185 3300005339 Unclassified 3210
34 Ga0070689_100131574 3300005340 Bacteria 2006
35 Ga0070687_100009738 3300005343 Bacteria 4130
36 Ga0070687_100063379 3300005343 Unclassified 1960
37 Ga0070687_100088464 3300005343 Bacteria 1708
38 Ga0070669_100129740 3300005353 Bacteria 1932
39 Ga0070669_100170916 3300005353 Bacteria 1694
40 Ga0070675_100306827 3300005354 Bacteria 1399
41 Ga0070671_100043941 3300005355 Bacteria 3713
42 Ga0070673_100016117 3300005364 Bacteria 5274
43 Ga0070688_100016374 3300005365 Bacteria 4238
44 Ga0070659_100003961 3300005366 Bacteria 10538
45 Ga0070659_100077650 3300005366 Bacteria 2649
46 Ga0070659_100147990 3300005366 Unclassified 1914
47 Ga0070667_100027179 3300005367 Bacteria 4761
48 Ga0070711_100000931 3300005439 Bacteria 15461
49 Ga0070711_100077664 3300005439 Bacteria 2357
50 Ga0070705_100024816 3300005440 Bacteria 3241
51 Ga0070705_100033954 3300005440 Unclassified 2848
52 Ga0070705_100182722 3300005440 Unclassified 1422
53 Ga0070700_100039598 3300005441 Bacteria 2880
54 Ga0070700_100081886 3300005441 Bacteria 2086
55 Ga0070700_100086660 3300005441 Bacteria 2034
56 Ga0070694_100023010 3300005444 Bacteria 4001
57 Ga0070694_100036812 3300005444 Bacteria 3243
58 Ga0070694_100056906 3300005444 Unclassified 2657
59 Ga0070694_100170670 3300005444 Unclassified 1602
60 Ga0070708_100001518 3300005445 Bacteria 17724
61 Ga0070663_100175768 3300005455 Bacteria 1658
62 Ga0070681_10002826 3300005458 Bacteria 16033
63 Ga0070681_10011692 3300005458 Bacteria 8695
64 Ga0070681_10032432 3300005458 Bacteria 5242
65 Ga0070681_10035292 3300005458 Bacteria 5024
66 Ga0070681_10037049 3300005458 Bacteria 4895
67 Ga0068867_100039914 3300005459 Bacteria 3423
68 Ga0068867_100043863 3300005459 Bacteria 3275
69 Ga0070706_100000452 3300005467 Bacteria 49138
70 Ga0070706_100018984 3300005467 Bacteria 6342
71 Ga0070706_100020539 3300005467 Bacteria 6086
72 Ga0070706_100105202 3300005467 Bacteria 2626
73 Ga0070706_100193560 3300005467 Bacteria 1900
74 Ga0070706_100220497 3300005467 Bacteria 1770
75 Ga0070707_100001233 3300005468 Bacteria 25094
76 Ga0070707_100022551 3300005468 Bacteria 5953
77 Ga0070707_100038528 3300005468 Bacteria 4566
78 Ga0070707_100098794 3300005468 Bacteria 2827
79 Ga0070698_100005974 3300005471 Bacteria 13272
80 Ga0070698_100012714 3300005471 Bacteria 8913
81 Ga0070698_100023131 3300005471 Bacteria 6498
82 Ga0070698_100190033 3300005471 Unclassified 1991
83 Ga0070699_100016094 3300005518 Bacteria 6420
84 Ga0070699_100024926 3300005518 Bacteria 5157
85 Ga0070699_100030707 3300005518 Unclassified 4640
86 Ga0070699_100030796 3300005518 Bacteria 4632
87 Ga0070679_100000024 3300005530 Bacteria 121394
88 Ga0070679_100009548 3300005530 Bacteria 9177
89 Ga0070679_100022298 3300005530 Bacteria 6188
90 Ga0070679_100043317 3300005530 Bacteria 4483
91 Ga0070679_100126980 3300005530 Bacteria 2532
92 Ga0070679_100145094 3300005530 Bacteria 2351
93 Ga0070684_100000010 3300005535 Bacteria 183486
94 Ga0070684_100047549 3300005535 Bacteria 3718
95 Ga0070697_100000043 3300005536 Bacteria 93782
96 Ga0070697_100000192 3300005536 Bacteria 49825
97 Ga0070697_100000695 3300005536 Bacteria 25189
98 Ga0070697_100127036 3300005536 Bacteria 2136
99 Ga0070697_100142231 3300005536 Unclassified 2018
100 Ga0068853_100006614 3300005539 Bacteria 9229
101 Ga0070686_100014687 3300005544 Unclassified 4519
102 Ga0070695_100033173 3300005545 Bacteria 3230
103 Ga0070695_100044926 3300005545 Bacteria 2814
104 Ga0070695_100188288 3300005545 Bacteria 1467
105 Ga0070696_100044752 3300005546 Bacteria 3065
106 Ga0070693_100121652 3300005547 Bacteria 1620
107 Ga0070665_100130282 3300005548 Bacteria 2517
108 Ga0070665_100211319 3300005548 Bacteria 1941
109 Ga0070704_100075893 3300005549 Bacteria 2457
110 Ga0070704_100090011 3300005549 Bacteria 2284
111 Ga0070704_100102047 3300005549 Bacteria 2164
112 Ga0070704_100145136 3300005549 Unclassified 1858
113 Ga0070704_100284630 3300005549 Bacteria 1371
114 Ga0068855_100006381 3300005563 Bacteria 14369
115 Ga0068855_100008615 3300005563 Bacteria 12324
116 Ga0068855_100052768 3300005563 Bacteria 4786
117 Ga0068855_100395738 3300005563 Bacteria 1515
118 Ga0070664_100231112 3300005564 Unclassified 1658
119 Ga0068857_100004403 3300005577 Bacteria 11905
120 Ga0068857_100009275 3300005577 Bacteria 8537
121 Ga0068857_100036084 3300005577 Bacteria 4380
122 Ga0068854_100049090 3300005578 Bacteria 3013
123 Ga0068856_100031235 3300005614 Bacteria 5211
124 Ga0068856_100036669 3300005614 Bacteria 4808
125 Ga0068856_100100190 3300005614 Bacteria 2889
126 Ga0068856_100100440 3300005614 Bacteria 2885
127 Ga0070702_100003620 3300005615 Bacteria 6948
128 Ga0070702_100117331 3300005615 Bacteria 1660
129 Ga0068852_100086989 3300005616 Bacteria 2787
130 Ga0068852_100117669 3300005616 Bacteria 2427
131 Ga0068852_100138198 3300005616 Bacteria 2252
132 Ga0068859_100005492 3300005617 Bacteria 12908
133 Ga0068859_100028044 3300005617 Bacteria 5647
134 Ga0068859_100035655 3300005617 Bacteria 4991
135 Ga0068859_100043442 3300005617 Bacteria 4516
136 Ga0068859_100094508 3300005617 Bacteria 3042
137 Ga0068859_100108160 3300005617 Unclassified 2842
138 Ga0068859_100191234 3300005617 Bacteria 2131
139 Ga0068859_100192611 3300005617 Bacteria 2123
140 Ga0068859_100200060 3300005617 Bacteria 2082
141 Ga0068864_100020345 3300005618 Bacteria 5552
142 Ga0068864_100132563 3300005618 Unclassified 2240
143 Ga0068864_100171461 3300005618 Bacteria 1978
144 Ga0068866_10010160 3300005718 Bacteria 4025
145 Ga0068861_100025052 3300005719 Bacteria 4321
146 Ga0068861_100061865 3300005719 Bacteria 2874
147 Ga0068851_10004072 3300005834 Bacteria 6564
148 Ga0068863_100018832 3300005841 Bacteria 6606
149 Ga0068863_100070073 3300005841 Bacteria 3316
150 Ga0068863_100124970 3300005841 Unclassified 2454
151 Ga0068863_100192914 3300005841 Bacteria 1958
152 Ga0068863_100342164 3300005841 Bacteria 1455
153 Ga0068858_100007926 3300005842 Bacteria 10236
154 Ga0068858_100036407 3300005842 Bacteria 4563
155 Ga0068858_100040084 3300005842 Unclassified 4343
156 Ga0068858_100059441 3300005842 Bacteria 3533
157 Ga0068858_100112772 3300005842 Bacteria 2539
158 Ga0068860_100007661 3300005843 Bacteria 10800
159 Ga0068860_100009604 3300005843 Bacteria 9613
160 Ga0068862_100075458 3300005844 Bacteria 2916
161 Ga0081539_10000043 3300005985 Bacteria 288108
162 Ga0081539_10007178 3300005985 Bacteria 10269
163 Ga0081539_10042197 3300005985 Unclassified 2659
164 Ga0070715_10021916 3300006163 Bacteria 2484
165 Ga0070716_100009299 3300006173 Bacteria 4898
166 Ga0070716_100129216 3300006173 Unclassified 1594
167 Ga0070712_100000445 3300006175 Bacteria 23661
168 Ga0097621_100003224 3300006237 Bacteria 11213
169 Ga0097621_100005607 3300006237 Bacteria 8852
170 Ga0097621_100010726 3300006237 Bacteria 6718
171 Ga0097621_100019452 3300006237 Bacteria 5211
172 Ga0097621_100227181 3300006237 Bacteria 1629
173 Ga0068871_100006192 3300006358 Bacteria 8436
174 Ga0068871_100007548 3300006358 Bacteria 7779
175 Ga0068871_100016723 3300006358 Bacteria 5534
176 Ga0068871_100193739 3300006358 Bacteria 1752
177 Ga0075428_100047888 3300006844 Unclassified 4694
178 Ga0075428_100311227 3300006844 Bacteria 1693
179 Ga0075431_100062459 3300006847 Bacteria 3844
180 Ga0075433_10003126 3300006852 Bacteria 12751
181 Ga0075433_10022329 3300006852 Bacteria 5311
182 Ga0075433_10027374 3300006852 Bacteria 4835
183 Ga0075433_10097983 3300006852 Bacteria 2595
184 Ga0075433_10174817 3300006852 Bacteria 1911
185 Ga0075434_100176517 3300006871 Bacteria 2156
186 Ga0075429_100147437 3300006880 Bacteria 2060
187 Ga0075436_100033523 3300006914 Bacteria 3540
188 Ga0075436_100049077 3300006914 Bacteria 2912
189 Ga0097620_100005491 3300006931 Bacteria 12908
190 Ga0097620_100028044 3300006931 Bacteria 5647
191 Ga0097620_100035656 3300006931 Bacteria 4991
192 Ga0097620_100043449 3300006931 Bacteria 4516
193 Ga0097620_100094506 3300006931 Bacteria 3042
194 Ga0097620_100108153 3300006931 Unclassified 2842
195 Ga0097620_100191248 3300006931 Bacteria 2131
196 Ga0097620_100192607 3300006931 Bacteria 2123
197 Ga0097620_100200057 3300006931 Bacteria 2082
198 Ga0075435_100130005 3300007076 Bacteria 2107
199 Ga0105240_10001081 3300009093 Bacteria 48105
200 Ga0105240_10001462 3300009093 Bacteria 40375
201 Ga0105240_10024119 3300009093 Bacteria 8029
202 Ga0105240_10190007 3300009093 Bacteria 2416
203 Ga0111539_10134232 3300009094 Bacteria 2898
204 Ga0111539_10199108 3300009094 Bacteria 2336
205 Ga0105245_10002961 3300009098 Bacteria 15229
206 Ga0105245_10003583 3300009098 Bacteria 13862
207 Ga0105245_10013874 3300009098 Bacteria 7020
208 Ga0105245_10084873 3300009098 Bacteria 2902
209 Ga0105247_10030428 3300009101 Bacteria 3273
210 Ga0105247_10101265 3300009101 Bacteria 1842
211 Ga0114129_10036974 3300009147 Bacteria 6894
212 Ga0114129_10074352 3300009147 Unclassified 4733
213 Ga0114129_10094958 3300009147 Unclassified 4130
214 Ga0114129_10252698 3300009147 Bacteria 2366
215 Ga0114129_10523764 3300009147 Bacteria 1545
216 Ga0105243_10048803 3300009148 Bacteria 3338
217 Ga0105243_10090367 3300009148 Bacteria 2520
218 Ga0105243_10138871 3300009148 Unclassified 2071
219 Ga0105243_10206935 3300009148 Bacteria 1725
220 Ga0105241_10021842 3300009174 Bacteria 4737
221 Ga0105241_10023577 3300009174 Bacteria 4564
222 Ga0105241_10059875 3300009174 Bacteria 2929
223 Ga0105241_10157623 3300009174 Bacteria 1863
224 Ga0105241_10160393 3300009174 Bacteria 1848
225 Ga0105241_10265771 3300009174 Bacteria 1459
226 Ga0105242_10029701 3300009176 Bacteria 4360
227 Ga0105242_10110566 3300009176 Bacteria 2341
228 Ga0105242_10132819 3300009176 Bacteria 2151
229 Ga0105248_10007065 3300009177 Bacteria 12300
230 Ga0105248_10008484 3300009177 Bacteria 11279
231 Ga0105248_10021339 3300009177 Bacteria 7177
232 Ga0105248_10025877 3300009177 Bacteria 6527
233 Ga0105248_10041537 3300009177 Bacteria 5156
234 Ga0105248_10041604 3300009177 Bacteria 5152
235 Ga0105248_10224934 3300009177 Bacteria 2112
236 Ga0105237_10000506 3300009545 Bacteria 55083
237 Ga0105237_10027216 3300009545 Bacteria 5838
238 Ga0105237_10103450 3300009545 Unclassified 2840
239 Ga0105237_10162831 3300009545 Bacteria 2229
240 Ga0105238_10026874 3300009551 Bacteria 5866
241 Ga0105238_10068045 3300009551 Bacteria 3562
242 Ga0105238_10122670 3300009551 Bacteria 2578
243 Ga0105238_10226562 3300009551 Bacteria 1846
244 Ga0105238_10263773 3300009551 Bacteria 1702
245 Ga0105249_10054535 3300009553 Bacteria 3656
246 Ga0105249_10074532 3300009553 Bacteria 3141
247 Ga0105249_10242198 3300009553 Bacteria 1784
248 Ga0105249_10693125 3300009553 Unclassified 1078
249 Ga0105239_10026006 3300010375 Bacteria 6444
250 Ga0105239_10063569 3300010375 Bacteria 4053
251 Ga0105239_10146160 3300010375 Bacteria 2637
252 Ga0105239_10172080 3300010375 Bacteria 2422
253 Ga0105239_10225435 3300010375 Bacteria 2102
254 Ga0105239_10668913 3300010375 Bacteria 1186
255 Ga0105246_10226480 3300011119 Bacteria 1469
256 Ga0157373_10002359 3300013100 Bacteria 14329
257 Ga0157373_10009713 3300013100 Bacteria 7101
258 Ga0157373_10078890 3300013100 Bacteria 2322
259 Ga0157370_10002433 3300013104 Bacteria 22448
260 Ga0157370_10002565 3300013104 Bacteria 21805
261 Ga0157370_10014337 3300013104 Bacteria 8110
262 Ga0157370_10184820 3300013104 Bacteria 1936
263 Ga0157370_10242189 3300013104 Bacteria 1669
264 Ga0157370_10249625 3300013104 Bacteria 1641
265 Ga0157369_10163100 3300013105 Bacteria 2352
266 Ga0157369_10203438 3300013105 Bacteria 2078
267 Ga0157374_10004841 3300013296 Bacteria 11302
268 Ga0157374_10031059 3300013296 Bacteria 4851
269 Ga0157374_10331326 3300013296 Unclassified 1510
270 Ga0157378_10002212 3300013297 Bacteria 17253
271 Ga0157378_10005454 3300013297 Bacteria 11140
272 Ga0157378_10007890 3300013297 Bacteria 9292
273 Ga0157378_10115071 3300013297 Bacteria 2471
274 Ga0163162_10005567 3300013306 Bacteria 12188
275 Ga0163162_10009410 3300013306 Bacteria 9504
276 Ga0163162_10025973 3300013306 Bacteria 5788
277 Ga0163162_10033314 3300013306 Bacteria 5119
278 Ga0163162_10035653 3300013306 Bacteria 4956
279 Ga0163162_10061562 3300013306 Unclassified 3791
280 Ga0163162_10071436 3300013306 Unclassified 3524
281 Ga0163162_10144071 3300013306 Bacteria 2497
282 Ga0163162_10186559 3300013306 Bacteria 2201
283 Ga0157372_10122165 3300013307 Bacteria 2992
284 Ga0157372_10359528 3300013307 Bacteria 1696
285 Ga0157375_10056314 3300013308 Bacteria 3881
286 Ga0157375_10125508 3300013308 Bacteria 2681
287 Ga0157375_10145427 3300013308 Bacteria 2501
288 Ga0157375_10483758 3300013308 Bacteria 1403
289 Ga0163163_10001650 3300014325 Bacteria 18789
290 Ga0163163_10002569 3300014325 Bacteria 15365
291 Ga0163163_10005524 3300014325 Bacteria 10945
292 Ga0163163_10006693 3300014325 Bacteria 10098
293 Ga0163163_10011781 3300014325 Bacteria 7949
294 Ga0163163_10025404 3300014325 Bacteria 5647
295 Ga0163163_10073106 3300014325 Bacteria 3419
296 Ga0163163_10084927 3300014325 Bacteria 3173
297 Ga0163163_10120077 3300014325 Bacteria 2662
298 Ga0163163_10233577 3300014325 Bacteria 1888
299 Ga0163163_10272026 3300014325 Bacteria 1745
300 Ga0157380_10011778 3300014326 Bacteria 6324
301 Ga0157377_10155057 3300014745 Bacteria 1419
302 Ga0157376_10001577 3300014969 Bacteria 15067
303 Ga0157376_10067761 3300014969 Bacteria 3019
304 Ga0157376_10081340 3300014969 Bacteria 2781
305 Ga0213872_10000182 3300021361 Bacteria 56427
306 Ga0213876_10000190 3300021384 Bacteria 64067
307 Ga0213876_10116309 3300021384 Bacteria 1419
308 Ga0213875_10000002 3300021388 Bacteria 921066
309 Ga0213875_10002433 3300021388 Bacteria 11139
310 Ga0213875_10028154 3300021388 Bacteria 2671
311 Ga0207656_10002158 3300025321 Bacteria 6573
312 Ga0207653_10001251 3300025885 Bacteria 8300
313 Ga0207642_10020481 3300025899 Bacteria 2583
314 Ga0207680_10007757 3300025903 Bacteria 5244
315 Ga0207680_10041666 3300025903 Bacteria 2681
316 Ga0207680_10089308 3300025903 Bacteria 1956
317 Ga0207643_10001447 3300025908 Bacteria 13632
318 Ga0207643_10014797 3300025908 Bacteria 4243
319 Ga0207643_10061646 3300025908 Bacteria 2142
320 Ga0207705_10039367 3300025909 Bacteria 3388
321 Ga0207684_10000216 3300025910 Bacteria 89242
322 Ga0207684_10008212 3300025910 Bacteria 9296
323 Ga0207684_10022730 3300025910 Bacteria 5354
324 Ga0207684_10234475 3300025910 Unclassified 1583
325 Ga0207707_10000188 3300025912 Bacteria 65222
326 Ga0207707_10023499 3300025912 Bacteria 5392
327 Ga0207707_10077565 3300025912 Bacteria 2900
328 Ga0207707_10081820 3300025912 Bacteria 2819
329 Ga0207707_10154111 3300025912 Bacteria 2009
330 Ga0207695_10000956 3300025913 Bacteria 51440
331 Ga0207695_10004456 3300025913 Bacteria 19085
332 Ga0207695_10006735 3300025913 Bacteria 14829
333 Ga0207695_10006834 3300025913 Bacteria 14691
334 Ga0207695_10090951 3300025913 Bacteria 3066
335 Ga0207695_10102144 3300025913 Bacteria 2861
336 Ga0207695_10161432 3300025913 Bacteria 2172
337 Ga0207695_10175099 3300025913 Unclassified 2068
338 Ga0207695_10352483 3300025913 Bacteria 1359
339 Ga0207671_10005190 3300025914 Bacteria 12106
340 Ga0207671_10043411 3300025914 Bacteria 3325
341 Ga0207671_10121391 3300025914 Bacteria 1997
342 Ga0207693_10000120 3300025915 Bacteria 69565
343 Ga0207663_10003410 3300025916 Bacteria 7773
344 Ga0207660_10000403 3300025917 Bacteria 28503
345 Ga0207662_10002321 3300025918 Bacteria 9530
346 Ga0207662_10017817 3300025918 Bacteria 4021
347 Ga0207662_10020960 3300025918 Bacteria 3731
348 Ga0207662_10067195 3300025918 Unclassified 2162
349 Ga0207657_10188374 3300025919 Bacteria 1666
350 Ga0207652_10001088 3300025921 Bacteria 24610
351 Ga0207652_10045909 3300025921 Bacteria 3726
352 Ga0207652_10176495 3300025921 Bacteria 1919
353 Ga0207646_10016348 3300025922 Bacteria 6963
354 Ga0207646_10069727 3300025922 Bacteria 3140
355 Ga0207694_10090693 3300025924 Bacteria 2411
356 Ga0207650_10191154 3300025925 Bacteria 1635
357 Ga0207687_10013347 3300025927 Bacteria 5363
358 Ga0207687_10016925 3300025927 Bacteria 4792
359 Ga0207687_10059404 3300025927 Bacteria 2694
360 Ga0207644_10000697 3300025931 Bacteria 21261
361 Ga0207644_10141482 3300025931 Bacteria 1853
362 Ga0207690_10118328 3300025932 Unclassified 1920
363 Ga0207706_10020273 3300025933 Bacteria 5976
364 Ga0207686_10026264 3300025934 Bacteria 3396
365 Ga0207709_10068805 3300025935 Bacteria 2239
366 Ga0207709_10083229 3300025935 Unclassified 2068
367 Ga0207670_10005206 3300025936 Bacteria 7113
368 Ga0207670_10028244 3300025936 Bacteria 3559
369 Ga0207669_10147436 3300025937 Bacteria 1643
370 Ga0207665_10000030 3300025939 Bacteria 94900
371 Ga0207665_10155987 3300025939 Unclassified 1638
372 Ga0207691_10001277 3300025940 Bacteria 25156
373 Ga0207711_10024304 3300025941 Bacteria 5074
374 Ga0207711_10035254 3300025941 Bacteria 4240
375 Ga0207711_10037421 3300025941 Bacteria 4121
376 Ga0207711_10037483 3300025941 Bacteria 4119
377 Ga0207711_10122997 3300025941 Bacteria 2318
378 Ga0207711_10159506 3300025941 Bacteria 2040
379 Ga0207711_10211963 3300025941 Unclassified 1769
380 Ga0207711_10254852 3300025941 Unclassified 1612
381 Ga0207689_10003167 3300025942 Bacteria 15083
382 Ga0207689_10005239 3300025942 Bacteria 11629
383 Ga0207689_10006129 3300025942 Bacteria 10639
384 Ga0207689_10023365 3300025942 Bacteria 5190
385 Ga0207689_10135479 3300025942 Bacteria 2028
386 Ga0207689_10157109 3300025942 Unclassified 1874
387 Ga0207661_10000012 3300025944 Bacteria 354345
388 Ga0207679_10148668 3300025945 Bacteria 1903
389 Ga0207667_10012848 3300025949 Bacteria 9622
390 Ga0207667_10023104 3300025949 Bacteria 6850
391 Ga0207667_10039208 3300025949 Bacteria 5051
392 Ga0207667_10211305 3300025949 Bacteria 1989
393 Ga0207667_10311084 3300025949 Bacteria 1609
394 Ga0207651_10025235 3300025960 Bacteria 3693
395 Ga0207651_10036023 3300025960 Bacteria 3225
396 Ga0207651_10144317 3300025960 Bacteria 1843
397 Ga0207712_10326679 3300025961 Bacteria 1268
398 Ga0207658_10037802 3300025986 Bacteria 3472
399 Ga0207677_10017181 3300026023 Bacteria 4306
400 Ga0207677_10113601 3300026023 Bacteria 2022
401 Ga0207703_10022493 3300026035 Bacteria 4946
402 Ga0207703_10067362 3300026035 Unclassified 2946
403 Ga0207703_10118070 3300026035 Bacteria 2273
404 Ga0207703_10135098 3300026035 Bacteria 2134
405 Ga0207703_10143076 3300026035 Bacteria 2077
406 Ga0207703_10330799 3300026035 Unclassified 1397
407 Ga0207639_10030418 3300026041 Bacteria 3959
408 Ga0207639_10127024 3300026041 Bacteria 2105
409 Ga0207678_10057538 3300026067 Bacteria 3346
410 Ga0207678_10131094 3300026067 Bacteria 2138
411 Ga0207708_10018867 3300026075 Bacteria 5195
412 Ga0207708_10044077 3300026075 Unclassified 3399
413 Ga0207708_10044449 3300026075 Bacteria 3384
414 Ga0207708_10119787 3300026075 Bacteria 2050
415 Ga0207702_10136543 3300026078 Bacteria 2213
416 Ga0207641_10112100 3300026088 Bacteria 2420
417 Ga0207641_10117660 3300026088 Bacteria 2366
418 Ga0207641_10173256 3300026088 Unclassified 1971
419 Ga0207648_10010987 3300026089 Bacteria 8552
420 Ga0207648_10012665 3300026089 Bacteria 7885
421 Ga0207648_10014814 3300026089 Bacteria 7194
422 Ga0207648_10097066 3300026089 Bacteria 2579
423 Ga0207648_10115874 3300026089 Bacteria 2355
424 Ga0207676_10002012 3300026095 Bacteria 14807
425 Ga0207676_10077850 3300026095 Bacteria 2684
426 Ga0207676_10108948 3300026095 Bacteria 2313
427 Ga0207674_10000258 3300026116 Bacteria 66186
428 Ga0207674_10013162 3300026116 Bacteria 9207
429 Ga0207674_10357554 3300026116 Unclassified 1412
430 Ga0207675_100004638 3300026118 Bacteria 13243
431 Ga0207675_100068758 3300026118 Unclassified 3310
432 Ga0207675_100088894 3300026118 Bacteria 2902
433 Ga0207698_10119294 3300026142 Bacteria 2229
434 Ga0209588_1000854 3300027671 Bacteria 7775
435 Ga0207428_10143737 3300027907 Bacteria 1819
436 Ga0207428_10186881 3300027907 Unclassified 1563
437 Ga0268266_10001048 3300028379 Bacteria 34678
438 Ga0268266_10049494 3300028379 Bacteria 3604
439 Ga0268265_10080851 3300028380 Bacteria 2564
440 Ga0268264_10011513 3300028381 Bacteria 7307
441 Ga0268264_10064123 3300028381 Bacteria 3091
442 Ga0268264_10115156 3300028381 Bacteria 2361
443 Ga0265323_10002725 3300028653 Bacteria 7964
444 Ga0265329_10023513 3300031242 Bacteria 2052
445 Ga0265316_10010253 3300031344 Bacteria 8551
446 Ga0265316_10012442 3300031344 Bacteria 7630
447 Ga0265316_10102988 3300031344 Bacteria 2168
448 Ga0265316_10107657 3300031344 Bacteria 2113
449 Ga0265316_10115600 3300031344 Bacteria 2028
450 Ga0307415_100112508 3300032126 Bacteria 2023
451 Ga0373954_0076447 3300035118 Bacteria 1596
452 Ga0373943_0019944 3300035170 Bacteria 3088
453 Ga0373935_0036866 3300035692 Bacteria 3059
454 Ga0373935_0056366 3300035692 Bacteria 2505
455 Ga0373927_0003141 3300035695 Bacteria 11935
456 Ga0373927_0044038 3300035695 Bacteria 2888
457 Ga0373947_0089555 3300035725 Bacteria 1917
458 Ga0373947_0134284 3300035725 Bacteria 1582
459 Ga0373937_0026652 3300036401 Bacteria 5222
460 Ga0373937_0140306 3300036401 Bacteria 2261
461 Ga0373937_0144233 3300036401 Bacteria 2228
462 Ga0373925_0015405 3300037068 Bacteria 5528
463 Ga0373925_0107697 3300037068 Bacteria 2150
464 Ga0373925_0324829 3300037068 Bacteria 1246
465 Ga0395900_0147356 3300037418 Bacteria 2407
466 Ga0395900_0240000 3300037418 Bacteria 1819
467 Ga0395898_0272982 3300037466 Bacteria 1613
468 Ga0436364_0478638 3300037853 Unclassified 3096
469 Ga0436364_0517360 3300037853 Bacteria 13526
470 Ga0436364_0919396 3300037853 Bacteria 13386
471 Ga0395901_0133428 3300038443 Bacteria 2610
472 Ga0242420_014565 3300038996 Bacteria 1351
473 Ga0436365_0001504 3300039437 Bacteria 2646
474 Ga0436365_0576586 3300039437 Bacteria 106320
475 Ga0436365_1492531 3300039437 Bacteria 5639
476 Ga0436365_1793553 3300039437 Bacteria 7084
477 Ga0436360_1323621 3300039438 Bacteria 1903
478 Ga0436361_0126076 3300039447 Bacteria 97470
479 Ga0436363_0737069 3300039450 Bacteria 2125
480 Ga0439448_0029165 3300042005 Bacteria 1746
481 Ga0439455_0043303 3300042012 Bacteria 1158
482 Ga0451577_0161665 3300042876 Bacteria 2017
483 Ga0466957_0263213 3300044842 Bacteria 1150
484 Ga0451576_0525896 3300045051 Unclassified 1243
485 Ga0466967_0112795 3300045976 Bacteria 2500
486 Ga0495592_0008047 3300046454 Bacteria 7918
487 Ga0495651_0019957 3300046462 Bacteria 5199
488 Ga0495651_0272397 3300046462 Bacteria 1147
489 Ga0495653_0046441 3300046463 Bacteria 3363
490 Ga0495639_0028109 3300046475 Bacteria 2492
491 Ga0495662_0058736 3300046476 Bacteria 1858
492 Ga0495664_0010701 3300046477 Bacteria 5153
493 Ga0495664_0113408 3300046477 Bacteria 1637
494 Ga0495594_0112244 3300046499 Bacteria 1537
495 Ga0495628_0033135 3300046516 Bacteria 4165
496 Ga0495652_0118298 3300046529 Bacteria 2118
497 Ga0495621_0023003 3300046539 Bacteria 2071
498 Ga0495634_0129413 3300046642 Bacteria 1610
499 Ga0495599_0146449 3300046678 Bacteria 1464
500 Ga0495623_0198969 3300046679 Bacteria 1153
501 Ga0495658_0166147 3300046683 Bacteria 1363
502 Ga0495613_0060230 3300046689 Bacteria 2781
503 Ga0495674_0013188 3300047319 Bacteria 7769
504 Ga0495674_0083076 3300047319 Bacteria 2746
505 Ga0495674_0114505 3300047319 Bacteria 2283
506 Ga0495674_0123573 3300047319 Bacteria 2185
507 Ga0495674_0153187 3300047319 Bacteria 1932
508 Ga0495680_0009823 3300047322 Bacteria 8580
509 Ga0495675_0036147 3300047444 Bacteria 3152
510 Ga0495675_0117237 3300047444 Bacteria 1660
511 Ga0495684_0025144 3300047471 Bacteria 4579
512 Ga0495602_0051524 3300048088 Bacteria 3665
513 Ga0495614_0010864 3300048089 Bacteria 4010
514 Ga0496108_0048914 3300048911 Bacteria 3536
515 Ga0496112_0128781 3300048915 Unclassified 2502
516 Ga0496112_0270713 3300048915 Bacteria 1647
517 Ga0496112_0381590 3300048915 Bacteria 1350
518 Ga0496115_0015570 3300048918 Bacteria 5772
519 Ga0501034_0009063 3300049571 Bacteria 10451
520 Ga0501037_0022707 3300049573 Bacteria 4639
521 Ga0501038_0179013 3300049574 Unclassified 1712
522 Ga0501043_0035939 3300049579 Bacteria 3897
523 Ga0501047_0004792 3300049581 Bacteria 12731
524 Ga0501070_0030266 3300049586 Bacteria 4536
525 Ga0501070_0035687 3300049586 Bacteria 4153
526 Ga0501073_0010061 3300049589 Bacteria 6955
527 Ga0501073_0094455 3300049589 Unclassified 2077
528 Ga0501249_002297 3300049679 Bacteria 3870
529 Ga0501268_009875 3300049765 Unclassified 1475
530 Ga0501035_0004621 3300049822 Bacteria 13052
531 Ga0501044_0001767 3300049823 Bacteria 25271
532 Ga0501044_0002962 3300049823 Bacteria 19309
533 nmdc:mga05p37_151371_c1 3300050507 Unclassified 2837
534 nmdc:mga05p37_17568_c1 3300050507 Bacteria 8636
535 nmdc:mga05p37_27645_c1 3300050507 Bacteria 6909
536 nmdc:mga05p37_370186_c1 3300050507 Bacteria 1682
537 nmdc:mga05p37_387094_c1 3300050507 Bacteria 1636
538 nmdc:mga05p37_524231_c1 3300050507 Bacteria 1354
539 nmdc:mga0qj67_21139_c1 3300050509 Bacteria 4990
540 nmdc:mga0qj67_84472_c1 3300050509 Bacteria 2546
541 nmdc:mga06r32_103117_c1 3300050510 Bacteria 2801
542 nmdc:mga06r32_142184_c1 3300050510 Bacteria 2376
543 nmdc:mga06r32_28441_c1 3300050510 Bacteria 5230
544 nmdc:mga08y16_1416_c1 3300050511 Bacteria 24064
545 nmdc:mga08y16_375066_c1 3300050511 Bacteria 1459
546 nmdc:mga08y16_94382_c1 3300050511 Unclassified 3116
547 nmdc:mga0n895_329363_c1 3300050512 Unclassified 1547
548 nmdc:mga0n895_456462_c1 3300050512 Bacteria 1290
549 nmdc:mga08x19_27360_c1 3300050514 Bacteria 3566
550 nmdc:mga0a205_10688_c1 3300050515 Bacteria 8438
551 nmdc:mga0a205_15001_c1 3300050515 Bacteria 7232
552 nmdc:mga0a205_286565_c1 3300050515 Bacteria 1522
553 nmdc:mga0a205_30300_c1 3300050515 Bacteria 5179
554 nmdc:mga0a205_38625_c1 3300050515 Unclassified 4593
555 nmdc:mga0a205_68959_c1 3300050515 Unclassified 3415
556 Ga0501082_0000143 3300060353 Bacteria 59481
557 Ga0501082_0164847 3300060353 Bacteria 1926
558 Ga0075431_100193511
559 JGI25406J46586_10025006
560 Ga0065704_10168727
561 Ga0065704_10179851
562 Ga0065712_10000115
563 Ga0065712_10071107
564 Ga0065715_10003032
565 Ga0065715_10003978
566 Ga0065715_10090451
567 Ga0065715_10160211
568 Ga0065707_10009392
569 Ga0070658_10021836
570 Ga0070658_10041318
571 Ga0070658_10082218
572 Ga0070658_10328549
573 Ga0070683_100000021
574 Ga0070690_100004947
575 Ga0070690_100139041
576 Ga0070670_100011220
577 Ga0070670_100044693
578 Ga0068869_100012781
579 Ga0068869_100042160
580 Ga0068869_100059823
581 Ga0068869_100186165
582 Ga0070666_10015597
583 Ga0070680_100002897
584 Ga0070680_100117884
585 Ga0070682_100005421
586 Ga0070682_100021210
587 Ga0068868_100014431
588 Ga0068868_100015298
589 Ga0068868_100140825
590 Ga0070660_100050185
591 Ga0070689_100131574
592 Ga0070687_100009738
593 Ga0070687_100063379
594 Ga0070687_100088464
595 Ga0070669_100129740
596 Ga0070669_100170916
597 Ga0070675_100306827
598 Ga0070671_100043941
599 Ga0070673_100016117
600 Ga0070688_100016374
601 Ga0070659_100003961
602 Ga0070659_100077650
603 Ga0070659_100147990
604 Ga0070667_100027179
605 Ga0070711_100000931
606 Ga0070711_100077664
607 Ga0070705_100024816
608 Ga0070705_100033954
609 Ga0070705_100182722
610 Ga0070700_100039598
611 Ga0070700_100081886
612 Ga0070700_100086660
613 Ga0070694_100023010
614 Ga0070694_100036812
615 Ga0070694_100056906
616 Ga0070694_100170670
617 Ga0070708_100001518
618 Ga0070663_100175768
619 Ga0070681_10002826
620 Ga0070681_10011692
621 Ga0070681_10032432
622 Ga0070681_10035292
623 Ga0070681_10037049
624 Ga0068867_100039914
625 Ga0068867_100043863
626 Ga0070706_100000452
627 Ga0070706_100018984
628 Ga0070706_100020539
629 Ga0070706_100105202
630 Ga0070706_100193560
631 Ga0070706_100220497
632 Ga0070707_100001233
633 Ga0070707_100022551
634 Ga0070707_100038528
635 Ga0070707_100098794
636 Ga0070698_100005974
637 Ga0070698_100012714
638 Ga0070698_100023131
639 Ga0070698_100190033
640 Ga0070699_100016094
641 Ga0070699_100024926
642 Ga0070699_100030707
643 Ga0070699_100030796
644 Ga0070679_100000024
645 Ga0070679_100009548
646 Ga0070679_100022298
647 Ga0070679_100043317
648 Ga0070679_100126980
649 Ga0070679_100145094
650 Ga0070684_100000010
651 Ga0070684_100047549
652 Ga0070697_100000043
653 Ga0070697_100000192
654 Ga0070697_100000695
655 Ga0070697_100127036
656 Ga0070697_100142231
657 Ga0068853_100006614
658 Ga0070686_100014687
659 Ga0070695_100033173
660 Ga0070695_100044926
661 Ga0070695_100188288
662 Ga0070696_100044752
663 Ga0070693_100121652
664 Ga0070665_100130282
665 Ga0070665_100211319
666 Ga0070704_100075893
667 Ga0070704_100090011
668 Ga0070704_100102047
669 Ga0070704_100145136
670 Ga0070704_100284630
671 Ga0068855_100006381
672 Ga0068855_100008615
673 Ga0068855_100052768
674 Ga0068855_100395738
675 Ga0070664_100231112
676 Ga0068857_100004403
677 Ga0068857_100009275
678 Ga0068857_100036084
679 Ga0068854_100049090
680 Ga0068856_100031235
681 Ga0068856_100036669
682 Ga0068856_100100190
683 Ga0068856_100100440
684 Ga0070702_100003620
685 Ga0070702_100117331
686 Ga0068852_100086989
687 Ga0068852_100117669
688 Ga0068852_100138198
689 Ga0068859_100005492
690 Ga0068859_100028044
691 Ga0068859_100035655
692 Ga0068859_100043442
693 Ga0068859_100094508
694 Ga0068859_100108160
695 Ga0068859_100191234
696 Ga0068859_100192611
697 Ga0068859_100200060
698 Ga0068864_100020345
699 Ga0068864_100132563
700 Ga0068864_100171461
701 Ga0068866_10010160
702 Ga0068861_100025052
703 Ga0068861_100061865
704 Ga0068851_10004072
705 Ga0068863_100018832
706 Ga0068863_100070073
707 Ga0068863_100124970
708 Ga0068863_100192914
709 Ga0068863_100342164
710 Ga0068858_100007926
711 Ga0068858_100036407
712 Ga0068858_100040084
713 Ga0068858_100059441
714 Ga0068858_100112772
715 Ga0068860_100007661
716 Ga0068860_100009604
717 Ga0068862_100075458
718 Ga0081539_10000043
719 Ga0081539_10007178
720 Ga0081539_10042197
721 Ga0070715_10021916
722 Ga0070716_100009299
723 Ga0070716_100129216
724 Ga0070712_100000445
725 Ga0097621_100003224
726 Ga0097621_100005607
727 Ga0097621_100010726
728 Ga0097621_100019452
729 Ga0097621_100227181
730 Ga0068871_100006192
731 Ga0068871_100007548
732 Ga0068871_100016723
733 Ga0068871_100193739
734 Ga0075428_100047888
735 Ga0075428_100311227
736 Ga0075431_100062459
737 Ga0075433_10003126
738 Ga0075433_10022329
739 Ga0075433_10027374
740 Ga0075433_10097983
741 Ga0075433_10174817
742 Ga0075434_100176517
743 Ga0075429_100147437
744 Ga0075436_100033523
745 Ga0075436_100049077
746 Ga0097620_100005491
747 Ga0097620_100028044
748 Ga0097620_100035656
749 Ga0097620_100043449
750 Ga0097620_100094506
751 Ga0097620_100108153
752 Ga0097620_100191248
753 Ga0097620_100192607
754 Ga0097620_100200057
755 Ga0075435_100130005
756 Ga0105240_10001081
757 Ga0105240_10001462
758 Ga0105240_10024119
759 Ga0105240_10190007
760 Ga0111539_10134232
761 Ga0111539_10199108
762 Ga0105245_10002961
763 Ga0105245_10003583
764 Ga0105245_10013874
765 Ga0105245_10084873
766 Ga0105247_10030428
767 Ga0105247_10101265
768 Ga0114129_10036974
769 Ga0114129_10074352
770 Ga0114129_10094958
771 Ga0114129_10252698
772 Ga0114129_10523764
773 Ga0105243_10048803
774 Ga0105243_10090367
775 Ga0105243_10138871
776 Ga0105243_10206935
777 Ga0105241_10021842
778 Ga0105241_10023577
779 Ga0105241_10059875
780 Ga0105241_10157623
781 Ga0105241_10160393
782 Ga0105241_10265771
783 Ga0105242_10029701
784 Ga0105242_10110566
785 Ga0105242_10132819
786 Ga0105248_10007065
787 Ga0105248_10008484
788 Ga0105248_10021339
789 Ga0105248_10025877
790 Ga0105248_10041537
791 Ga0105248_10041604
792 Ga0105248_10224934
793 Ga0105237_10000506
794 Ga0105237_10027216
795 Ga0105237_10103450
796 Ga0105237_10162831
797 Ga0105238_10026874
798 Ga0105238_10068045
799 Ga0105238_10122670
800 Ga0105238_10226562
801 Ga0105238_10263773
802 Ga0105249_10054535
803 Ga0105249_10074532
804 Ga0105249_10242198
805 Ga0105249_10693125
806 Ga0105239_10026006
807 Ga0105239_10063569
808 Ga0105239_10146160
809 Ga0105239_10172080
810 Ga0105239_10225435
811 Ga0105239_10668913
812 Ga0105246_10226480
813 Ga0157373_10002359
814 Ga0157373_10009713
815 Ga0157373_10078890
816 Ga0157370_10002433
817 Ga0157370_10002565
818 Ga0157370_10014337
819 Ga0157370_10184820
820 Ga0157370_10242189
821 Ga0157370_10249625
822 Ga0157369_10163100
823 Ga0157369_10203438
824 Ga0157374_10004841
825 Ga0157374_10031059
826 Ga0157374_10331326
827 Ga0157378_10002212
828 Ga0157378_10005454
829 Ga0157378_10007890
830 Ga0157378_10115071
831 Ga0163162_10005567
832 Ga0163162_10009410
833 Ga0163162_10025973
834 Ga0163162_10033314
835 Ga0163162_10035653
836 Ga0163162_10061562
837 Ga0163162_10071436
838 Ga0163162_10144071
839 Ga0163162_10186559
840 Ga0157372_10122165
841 Ga0157372_10359528
842 Ga0157375_10056314
843 Ga0157375_10125508
844 Ga0157375_10145427
845 Ga0157375_10483758
846 Ga0163163_10001650
847 Ga0163163_10002569
848 Ga0163163_10005524
849 Ga0163163_10006693
850 Ga0163163_10011781
851 Ga0163163_10025404
852 Ga0163163_10073106
853 Ga0163163_10084927
854 Ga0163163_10120077
855 Ga0163163_10233577
856 Ga0163163_10272026
857 Ga0157380_10011778
858 Ga0157377_10155057
859 Ga0157376_10001577
860 Ga0157376_10067761
861 Ga0157376_10081340
862 Ga0213872_10000182
863 Ga0213876_10000190
864 Ga0213876_10116309
865 Ga0213875_10000002
866 Ga0213875_10002433
867 Ga0213875_10028154
868 Ga0207656_10002158
869 Ga0207653_10001251
870 Ga0207642_10020481
871 Ga0207680_10007757
872 Ga0207680_10041666
873 Ga0207680_10089308
874 Ga0207643_10001447
875 Ga0207643_10014797
876 Ga0207643_10061646
877 Ga0207705_10039367
878 Ga0207684_10000216
879 Ga0207684_10008212
880 Ga0207684_10022730
881 Ga0207684_10234475
882 Ga0207707_10000188
883 Ga0207707_10023499
884 Ga0207707_10077565
885 Ga0207707_10081820
886 Ga0207707_10154111
887 Ga0207695_10000956
888 Ga0207695_10004456
889 Ga0207695_10006735
890 Ga0207695_10006834
891 Ga0207695_10090951
892 Ga0207695_10102144
893 Ga0207695_10161432
894 Ga0207695_10175099
895 Ga0207695_10352483
896 Ga0207671_10005190
897 Ga0207671_10043411
898 Ga0207671_10121391
899 Ga0207693_10000120
900 Ga0207663_10003410
901 Ga0207660_10000403
902 Ga0207662_10002321
903 Ga0207662_10017817
904 Ga0207662_10020960
905 Ga0207662_10067195
906 Ga0207657_10188374
907 Ga0207652_10001088
908 Ga0207652_10045909
909 Ga0207652_10176495
910 Ga0207646_10016348
911 Ga0207646_10069727
912 Ga0207694_10090693
913 Ga0207650_10191154
914 Ga0207687_10013347
915 Ga0207687_10016925
916 Ga0207687_10059404
917 Ga0207644_10000697
918 Ga0207644_10141482
919 Ga0207690_10118328
920 Ga0207706_10020273
921 Ga0207686_10026264
922 Ga0207709_10068805
923 Ga0207709_10083229
924 Ga0207670_10005206
925 Ga0207670_10028244
926 Ga0207669_10147436
927 Ga0207665_10000030
928 Ga0207665_10155987
929 Ga0207691_10001277
930 Ga0207711_10024304
931 Ga0207711_10035254
932 Ga0207711_10037421
933 Ga0207711_10037483
934 Ga0207711_10122997
935 Ga0207711_10159506
936 Ga0207711_10211963
937 Ga0207711_10254852
938 Ga0207689_10003167
939 Ga0207689_10005239
940 Ga0207689_10006129
941 Ga0207689_10023365
942 Ga0207689_10135479
943 Ga0207689_10157109
944 Ga0207661_10000012
945 Ga0207679_10148668
946 Ga0207667_10012848
947 Ga0207667_10023104
948 Ga0207667_10039208
949 Ga0207667_10211305
950 Ga0207667_10311084
951 Ga0207651_10025235
952 Ga0207651_10036023
953 Ga0207651_10144317
954 Ga0207712_10326679
955 Ga0207658_10037802
956 Ga0207677_10017181
957 Ga0207677_10113601
958 Ga0207703_10022493
959 Ga0207703_10067362
960 Ga0207703_10118070
961 Ga0207703_10135098
962 Ga0207703_10143076
963 Ga0207703_10330799
964 Ga0207639_10030418
965 Ga0207639_10127024
966 Ga0207678_10057538
967 Ga0207678_10131094
968 Ga0207708_10018867
969 Ga0207708_10044077
970 Ga0207708_10044449
971 Ga0207708_10119787
972 Ga0207702_10136543
973 Ga0207641_10112100
974 Ga0207641_10117660
975 Ga0207641_10173256
976 Ga0207648_10010987
977 Ga0207648_10012665
978 Ga0207648_10014814
979 Ga0207648_10097066
980 Ga0207648_10115874
981 Ga0207676_10002012
982 Ga0207676_10077850
983 Ga0207676_10108948
984 Ga0207674_10000258
985 Ga0207674_10013162
986 Ga0207674_10357554
987 Ga0207675_100004638
988 Ga0207675_100068758
989 Ga0207675_100088894
990 Ga0207698_10119294
991 Ga0209588_1000854
992 Ga0207428_10143737
993 Ga0207428_10186881
994 Ga0268266_10001048
995 Ga0268266_10049494
996 Ga0268265_10080851
997 Ga0268264_10011513
998 Ga0268264_10064123
999 Ga0268264_10115156
1000 Ga0265323_10002725
1001 Ga0265329_10023513
1002 Ga0265316_10010253
1003 Ga0265316_10012442
1004 Ga0265316_10102988
1005 Ga0265316_10107657
1006 Ga0265316_10115600
1007 Ga0307415_100112508
1008 Ga0373954_0076447
1009 Ga0373943_0019944
1010 Ga0373935_0036866
1011 Ga0373935_0056366
1012 Ga0373927_0003141
1013 Ga0373927_0044038
1014 Ga0373947_0089555
1015 Ga0373947_0134284
1016 Ga0373937_0026652
1017 Ga0373937_0140306
1018 Ga0373937_0144233
1019 Ga0373925_0015405
1020 Ga0373925_0107697
1021 Ga0373925_0324829
1022 Ga0395900_0147356
1023 Ga0395900_0240000
1024 Ga0395898_0272982
1025 Ga0436364_0478638
1026 Ga0436364_0517360
1027 Ga0436364_0919396
1028 Ga0395901_0133428
1029 Ga0242420_014565
1030 Ga0436365_0001504
1031 Ga0436365_0576586
1032 Ga0436365_1492531
1033 Ga0436365_1793553
1034 Ga0436360_1323621
1035 Ga0436361_0126076
1036 Ga0436363_0737069
1037 Ga0439448_0029165
1038 Ga0439455_0043303
1039 Ga0451577_0161665
1040 Ga0466957_0263213
1041 Ga0451576_0525896
1042 Ga0466967_0112795
1043 Ga0495592_0008047
1044 Ga0495651_0019957
1045 Ga0495651_0272397
1046 Ga0495653_0046441
1047 Ga0495639_0028109
1048 Ga0495662_0058736
1049 Ga0495664_0010701
1050 Ga0495664_0113408
1051 Ga0495594_0112244
1052 Ga0495628_0033135
1053 Ga0495652_0118298
1054 Ga0495621_0023003
1055 Ga0495634_0129413
1056 Ga0495599_0146449
1057 Ga0495623_0198969
1058 Ga0495658_0166147
1059 Ga0495613_0060230
1060 Ga0495674_0013188
1061 Ga0495674_0083076
1062 Ga0495674_0114505
1063 Ga0495674_0123573
1064 Ga0495674_0153187
1065 Ga0495680_0009823
1066 Ga0495675_0036147
1067 Ga0495675_0117237
1068 Ga0495684_0025144
1069 Ga0495602_0051524
1070 Ga0495614_0010864
1071 Ga0496108_0048914
1072 Ga0496112_0128781
1073 Ga0496112_0270713
1074 Ga0496112_0381590
1075 Ga0496115_0015570
1076 Ga0501034_0009063
1077 Ga0501037_0022707
1078 Ga0501038_0179013
1079 Ga0501043_0035939
1080 Ga0501047_0004792
1081 Ga0501070_0030266
1082 Ga0501070_0035687
1083 Ga0501073_0010061
1084 Ga0501073_0094455
1085 Ga0501249_002297
1086 Ga0501268_009875
1087 Ga0501035_0004621
1088 Ga0501044_0001767
1089 Ga0501044_0002962
1090 nmdc:mga05p37_151371_c1
1091 nmdc:mga05p37_17568_c1
1092 nmdc:mga05p37_27645_c1
1093 nmdc:mga05p37_370186_c1
1094 nmdc:mga05p37_387094_c1
1095 nmdc:mga05p37_524231_c1
1096 nmdc:mga0qj67_21139_c1
1097 nmdc:mga0qj67_84472_c1
1098 nmdc:mga06r32_103117_c1
1099 nmdc:mga06r32_142184_c1
1100 nmdc:mga06r32_28441_c1
1101 nmdc:mga08y16_1416_c1
1102 nmdc:mga08y16_375066_c1
1103 nmdc:mga08y16_94382_c1
1104 nmdc:mga0n895_329363_c1
1105 nmdc:mga0n895_456462_c1
1106 nmdc:mga08x19_27360_c1
1107 nmdc:mga0a205_10688_c1
1108 nmdc:mga0a205_15001_c1
1109 nmdc:mga0a205_286565_c1
1110 nmdc:mga0a205_30300_c1
1111 nmdc:mga0a205_38625_c1
1112 nmdc:mga0a205_68959_c1
1113 Ga0501082_0000143
1114 Ga0501082_0164847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

199

411

0.92

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

58

179

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s8w-assembly1.cif.gz_A amycolatopsis sp. t-1-60 n-succinylamino acid racemase/o-succinylbenzoate synthase r266q mutant in complex with n-succinylphenylglycine 0.9619 10 375
4a6g-assembly1.cif.gz_A n-acyl amino acid racemase from amycalotopsis sp. ts-1-60: g291d- f323y mutant in complex with n-acetyl methionine 0.9609 10 374
1sja-assembly1.cif.gz_A x-ray structure of o-succinylbenzoate synthase complexed with n-acetylmethionine 0.9603 10 373
5fjp-assembly2.cif.gz_A n-acyl amino acid racemase from amycolatopsis sp ts-1-60: g291d f323y i293g mutant in complex with n-acetyl naphthylalanine 0.9601 10 374
2ggg-assembly1.cif.gz_C the mutant a68c-d72c of deinococcus radiodurans n-acylamino acid racemase 0.96 9 373
ID Description Score Start End Superfamily
1wufA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9533 128 368 3.20.20.120
1r0mA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9514 127 356 3.20.20.120
1r0mA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9435 127 356 3.20.20.120
1wufA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9382 128 368 3.20.20.120
1sjaA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9331 10 125 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A353CEB5-F1-model_v4 o-succinylbenzoate synthase (EC 4.2.1.113) 0.9786 127 375 GO:0009234
GO:0016836
AF-A0A1B6BFA4-F1-model_v4 O-succinylbenzoate synthase (EC 4.2.1.113) 0.9785 187 301 GO:0043748
GO:0046872
AF-A0A7C4KWW6-F1-model_v4 o-succinylbenzoate synthase (EC 4.2.1.113) 0.9784 10 374 GO:0009063
GO:0009234
GO:0043748
AF-A0A4R6JAA8-F1-model_v4 o-succinylbenzoate synthase (EC 4.2.1.113) 0.9759 10 374 GO:0009234
GO:0043748
AF-A0A523CYA9-F1-model_v4 o-succinylbenzoate synthase (EC 4.2.1.113) 0.9757 10 313 GO:0009063
GO:0009234
GO:0043748

Map