F463330
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 557 | 309 | 547 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0008867|Ga0373934_0008867_2444_3094 |
| Length | 216 |
| Sequence | MCLLYACPDAAHEQQYCCDIHIGEPVLPRSEKPGKANARAGAPAAEREPEERGARDAGGLDRYDIALLSELQRDARQSNADLAGRIGLSPAPTWRRVRRLEELGIITGYRAEIDRRKIGLGVLAFVRVDTDRDNLAATKALEDAIRNLPEVISCHYISGAGTFELQVLVTDLDAYARWTMDTLFRLPNVKDLHTSFSLGEVKAGAALPLGHLGAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 9 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 10 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 11 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 12 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 77 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 105 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 167 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 180 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 185 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 186 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 205 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 210 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 211 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 212 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 213 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 214 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 215 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 216 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 217 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 218 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 219 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 220 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 221 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 222 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 229 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 272 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 273 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 274 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 289 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 290 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 291 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 292 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 293 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 294 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 295 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 296 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 297 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 298 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 299 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 303 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 304 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 305 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 307 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 308 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 309 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.2 |
| Metatranscriptomes | 0 |
| Isolates | 1.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.9 |
| Nodule | 0.54 |
| Rhizoplane | 2.33 |
| Rhizosphere | 66.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000063 | 3300002705 | Bacteria | 84312 |
| 2 | JGI25154J39366_1000533 | 3300002738 | Bacteria | 19083 |
| 3 | JGI25157J39369_1000082 | 3300002741 | Bacteria | 84303 |
| 4 | JGI25152J39213_1011981 | 3300002773 | Bacteria | 1886 |
| 5 | JGI25153J46596_10000416 | 3300003215 | Bacteria | 28007 |
| 6 | JGI25153J46596_10009702 | 3300003215 | Bacteria | 4433 |
| 7 | rootH2_10007281 | 3300003320 | Bacteria | 5399 |
| 8 | rootH2_10020702 | 3300003320 | Bacteria | 4207 |
| 9 | rootL2_10006362 | 3300003322 | Bacteria | 20083 |
| 10 | Ga0055539_1000303 | 3300003752 | Bacteria | 26405 |
| 11 | Ga0055533_1000043 | 3300003756 | Bacteria | 229262 |
| 12 | Ga0055525_1000056 | 3300003759 | Bacteria | 212321 |
| 13 | Ga0055525_1001652 | 3300003759 | Bacteria | 3443 |
| 14 | Ga0055535_1002530 | 3300003761 | Bacteria | 6213 |
| 15 | Ga0055529_1000464 | 3300003763 | Bacteria | 39223 |
| 16 | Ga0055529_1001234 | 3300003763 | Bacteria | 9615 |
| 17 | Ga0055524_1002162 | 3300003775 | Bacteria | 10345 |
| 18 | Ga0055524_1023386 | 3300003775 | Bacteria | 1991 |
| 19 | Ga0055531_10004238 | 3300003794 | Bacteria | 8822 |
| 20 | Ga0065165_1003834 | 3300005262 | Bacteria | 10014 |
| 21 | Ga0070658_10309099 | 3300005327 | Bacteria | 1349 |
| 22 | Ga0070676_10003518 | 3300005328 | Bacteria | 8184 |
| 23 | Ga0070676_10063737 | 3300005328 | Bacteria | 2196 |
| 24 | Ga0070676_10232881 | 3300005328 | Bacteria | 1221 |
| 25 | Ga0070676_10453022 | 3300005328 | Bacteria | 902 |
| 26 | Ga0070690_100001384 | 3300005330 | Bacteria | 12638 |
| 27 | Ga0070670_100245930 | 3300005331 | Bacteria | 1558 |
| 28 | Ga0070677_10005141 | 3300005333 | Bacteria | 4300 |
| 29 | Ga0070677_10216629 | 3300005333 | Bacteria | 933 |
| 30 | Ga0068869_100110461 | 3300005334 | Bacteria | 2091 |
| 31 | Ga0068868_100164969 | 3300005338 | Bacteria | 1832 |
| 32 | Ga0070669_100041589 | 3300005353 | Bacteria | 3343 |
| 33 | Ga0070669_100056439 | 3300005353 | Bacteria | 2879 |
| 34 | Ga0070675_100000811 | 3300005354 | Bacteria | 22016 |
| 35 | Ga0070675_100031487 | 3300005354 | Bacteria | 4288 |
| 36 | Ga0070671_100029927 | 3300005355 | Bacteria | 4492 |
| 37 | Ga0070671_100096575 | 3300005355 | Bacteria | 2478 |
| 38 | Ga0070671_100238993 | 3300005355 | Bacteria | 1542 |
| 39 | Ga0070671_100381437 | 3300005355 | Bacteria | 1205 |
| 40 | Ga0070674_100011059 | 3300005356 | Bacteria | 5476 |
| 41 | Ga0070674_100048225 | 3300005356 | Bacteria | 2922 |
| 42 | Ga0070673_100506425 | 3300005364 | Bacteria | 1093 |
| 43 | Ga0070673_100660681 | 3300005364 | Bacteria | 957 |
| 44 | Ga0070673_100867174 | 3300005364 | Bacteria | 836 |
| 45 | Ga0070659_100102567 | 3300005366 | Bacteria | 2303 |
| 46 | Ga0070667_100018817 | 3300005367 | Bacteria | 5729 |
| 47 | Ga0070667_100279892 | 3300005367 | Bacteria | 1498 |
| 48 | Ga0070708_100073412 | 3300005445 | Bacteria | 3084 |
| 49 | Ga0070663_100004945 | 3300005455 | Bacteria | 7870 |
| 50 | Ga0070678_100032954 | 3300005456 | Bacteria | 3591 |
| 51 | Ga0070678_100122683 | 3300005456 | Bacteria | 2051 |
| 52 | Ga0070662_100286379 | 3300005457 | Bacteria | 1335 |
| 53 | Ga0068867_100000439 | 3300005459 | Bacteria | 27677 |
| 54 | Ga0068867_100004831 | 3300005459 | Bacteria | 9487 |
| 55 | Ga0068867_100013526 | 3300005459 | Bacteria | 5779 |
| 56 | Ga0068867_100048805 | 3300005459 | Bacteria | 3115 |
| 57 | Ga0068867_100574282 | 3300005459 | Bacteria | 980 |
| 58 | Ga0070706_100040369 | 3300005467 | Bacteria | 4307 |
| 59 | Ga0070707_100019837 | 3300005468 | Bacteria | 6337 |
| 60 | Ga0070698_100137461 | 3300005471 | Bacteria | 2397 |
| 61 | Ga0068853_100033051 | 3300005539 | Bacteria | 4386 |
| 62 | Ga0068853_100582169 | 3300005539 | Bacteria | 1062 |
| 63 | Ga0070672_100003173 | 3300005543 | Bacteria | 10629 |
| 64 | Ga0070672_100136539 | 3300005543 | Bacteria | 2020 |
| 65 | Ga0070665_100608374 | 3300005548 | Bacteria | 1106 |
| 66 | Ga0068855_100002610 | 3300005563 | Bacteria | 22210 |
| 67 | Ga0068855_100594642 | 3300005563 | Bacteria | 1194 |
| 68 | Ga0068855_100628480 | 3300005563 | Bacteria | 1155 |
| 69 | Ga0070664_100216756 | 3300005564 | Bacteria | 1712 |
| 70 | Ga0070664_101182758 | 3300005564 | Bacteria | 721 |
| 71 | Ga0068857_100013771 | 3300005577 | Bacteria | 7047 |
| 72 | Ga0068857_100015412 | 3300005577 | Bacteria | 6675 |
| 73 | Ga0068854_100009344 | 3300005578 | Bacteria | 6329 |
| 74 | Ga0068854_100080311 | 3300005578 | Bacteria | 2407 |
| 75 | Ga0068856_100157132 | 3300005614 | Bacteria | 2284 |
| 76 | Ga0068852_100111343 | 3300005616 | Bacteria | 2489 |
| 77 | Ga0068852_100425956 | 3300005616 | Bacteria | 1310 |
| 78 | Ga0068852_100694675 | 3300005616 | Bacteria | 1027 |
| 79 | Ga0068859_100245015 | 3300005617 | Bacteria | 1882 |
| 80 | Ga0068864_100092822 | 3300005618 | Bacteria | 2665 |
| 81 | Ga0068861_101459382 | 3300005719 | Bacteria | 670 |
| 82 | Ga0068851_10388426 | 3300005834 | Bacteria | 819 |
| 83 | Ga0068870_10011020 | 3300005840 | Bacteria | 4176 |
| 84 | Ga0068870_10085964 | 3300005840 | Bacteria | 1749 |
| 85 | Ga0068863_100166600 | 3300005841 | Bacteria | 2113 |
| 86 | Ga0068860_100045649 | 3300005843 | Bacteria | 4178 |
| 87 | Ga0068860_100732141 | 3300005843 | Bacteria | 1000 |
| 88 | Ga0068862_100029865 | 3300005844 | Bacteria | 4593 |
| 89 | Ga0068862_100038190 | 3300005844 | Bacteria | 4071 |
| 90 | Ga0068862_101147603 | 3300005844 | Bacteria | 774 |
| 91 | Ga0081455_10192841 | 3300005937 | Bacteria | 1533 |
| 92 | Ga0075363_100021255 | 3300006048 | Bacteria | 3265 |
| 93 | Ga0075364_10035455 | 3300006051 | Bacteria | 3224 |
| 94 | Ga0075362_10025128 | 3300006177 | Bacteria | 2532 |
| 95 | Ga0075362_10026634 | 3300006177 | Bacteria | 2471 |
| 96 | Ga0075362_10055625 | 3300006177 | Bacteria | 1780 |
| 97 | Ga0075367_10056484 | 3300006178 | Bacteria | 2332 |
| 98 | Ga0075367_10105072 | 3300006178 | Bacteria | 1729 |
| 99 | Ga0075367_10117792 | 3300006178 | Bacteria | 1635 |
| 100 | Ga0075367_10138155 | 3300006178 | Bacteria | 1508 |
| 101 | Ga0075367_10349311 | 3300006178 | Bacteria | 933 |
| 102 | Ga0075366_10003496 | 3300006195 | Bacteria | 8299 |
| 103 | Ga0075366_10029464 | 3300006195 | Bacteria | 3224 |
| 104 | Ga0075366_10034758 | 3300006195 | Bacteria | 2970 |
| 105 | Ga0075366_10046639 | 3300006195 | Bacteria | 2568 |
| 106 | Ga0075366_10049715 | 3300006195 | Bacteria | 2488 |
| 107 | Ga0075366_10083402 | 3300006195 | Bacteria | 1910 |
| 108 | Ga0075366_10092684 | 3300006195 | Bacteria | 1810 |
| 109 | Ga0075366_10525754 | 3300006195 | Bacteria | 732 |
| 110 | Ga0075370_10002677 | 3300006353 | Bacteria | 8330 |
| 111 | Ga0075370_10004667 | 3300006353 | Bacteria | 6682 |
| 112 | Ga0075370_10030758 | 3300006353 | Bacteria | 2997 |
| 113 | Ga0075370_10052585 | 3300006353 | Bacteria | 2311 |
| 114 | Ga0075370_10109744 | 3300006353 | Bacteria | 1601 |
| 115 | Ga0075370_10298737 | 3300006353 | Bacteria | 957 |
| 116 | Ga0075430_100114689 | 3300006846 | Bacteria | 2245 |
| 117 | Ga0075429_100129999 | 3300006880 | Bacteria | 2203 |
| 118 | Ga0068865_100006375 | 3300006881 | Bacteria | 7189 |
| 119 | Ga0068865_100218226 | 3300006881 | Bacteria | 1490 |
| 120 | Ga0068865_100224577 | 3300006881 | Bacteria | 1470 |
| 121 | Ga0068865_100309765 | 3300006881 | Bacteria | 1267 |
| 122 | Ga0068865_100672638 | 3300006881 | Bacteria | 882 |
| 123 | Ga0097620_100245005 | 3300006931 | Bacteria | 1882 |
| 124 | Ga0099824_1029266 | 3300006942 | Bacteria | 2374 |
| 125 | Ga0099823_1000025 | 3300006944 | Bacteria | 73278 |
| 126 | Ga0105240_10034252 | 3300009093 | Bacteria | 6552 |
| 127 | Ga0105240_10034475 | 3300009093 | Bacteria | 6528 |
| 128 | Ga0105240_10333179 | 3300009093 | Bacteria | 1726 |
| 129 | Ga0111539_12217070 | 3300009094 | Bacteria | 637 |
| 130 | Ga0105245_10230852 | 3300009098 | Bacteria | 1790 |
| 131 | Ga0105247_10427240 | 3300009101 | Bacteria | 950 |
| 132 | Ga0114129_10886992 | 3300009147 | Bacteria | 1131 |
| 133 | Ga0105243_10000562 | 3300009148 | Bacteria | 37568 |
| 134 | Ga0105243_10143730 | 3300009148 | Bacteria | 2039 |
| 135 | Ga0105243_10238029 | 3300009148 | Bacteria | 1619 |
| 136 | Ga0105243_10633497 | 3300009148 | Bacteria | 1034 |
| 137 | Ga0105241_10278483 | 3300009174 | Bacteria | 1428 |
| 138 | Ga0105248_10004608 | 3300009177 | Bacteria | 15258 |
| 139 | Ga0105237_10004426 | 3300009545 | Bacteria | 16286 |
| 140 | Ga0105237_10005880 | 3300009545 | Bacteria | 13755 |
| 141 | Ga0105237_10257989 | 3300009545 | Bacteria | 1746 |
| 142 | Ga0105237_11180532 | 3300009545 | Bacteria | 772 |
| 143 | Ga0105238_10010462 | 3300009551 | Bacteria | 9311 |
| 144 | Ga0105238_10014149 | 3300009551 | Bacteria | 8069 |
| 145 | Ga0105238_10488470 | 3300009551 | Bacteria | 1231 |
| 146 | Ga0105249_10547905 | 3300009553 | Bacteria | 1207 |
| 147 | Ga0105249_10574562 | 3300009553 | Bacteria | 1180 |
| 148 | Ga0105249_11198510 | 3300009553 | Bacteria | 830 |
| 149 | Ga0105249_11199012 | 3300009553 | Bacteria | 830 |
| 150 | Ga0105239_10029492 | 3300010375 | Bacteria | 6032 |
| 151 | Ga0105239_10063541 | 3300010375 | Bacteria | 4053 |
| 152 | Ga0105239_10067265 | 3300010375 | Bacteria | 3935 |
| 153 | Ga0105239_12086160 | 3300010375 | Bacteria | 659 |
| 154 | Ga0105246_10272765 | 3300011119 | Bacteria | 1353 |
| 155 | Ga0157319_1000014 | 3300012497 | Bacteria | 139356 |
| 156 | Ga0157373_10734771 | 3300013100 | Bacteria | 725 |
| 157 | Ga0157369_10103155 | 3300013105 | Bacteria | 3038 |
| 158 | Ga0157378_10048638 | 3300013297 | Bacteria | 3771 |
| 159 | Ga0163162_10004897 | 3300013306 | Bacteria | 12909 |
| 160 | Ga0163162_10058038 | 3300013306 | Bacteria | 3899 |
| 161 | Ga0163162_10731170 | 3300013306 | Bacteria | 1110 |
| 162 | Ga0157372_10512941 | 3300013307 | Bacteria | 1398 |
| 163 | Ga0157375_10152003 | 3300013308 | Bacteria | 2451 |
| 164 | Ga0157375_10290287 | 3300013308 | Bacteria | 1799 |
| 165 | Ga0163163_10311560 | 3300014325 | Bacteria | 1627 |
| 166 | Ga0157380_10117420 | 3300014326 | Bacteria | 2247 |
| 167 | Ga0157380_10698502 | 3300014326 | Bacteria | 1019 |
| 168 | Ga0157377_10000160 | 3300014745 | Bacteria | 41263 |
| 169 | Ga0157377_10603255 | 3300014745 | Bacteria | 783 |
| 170 | Ga0157379_10013046 | 3300014968 | Bacteria | 7276 |
| 171 | Ga0157379_10076813 | 3300014968 | Bacteria | 2991 |
| 172 | Ga0157379_10263498 | 3300014968 | Bacteria | 1566 |
| 173 | Ga0157379_10921037 | 3300014968 | Bacteria | 830 |
| 174 | Ga0157376_10818040 | 3300014969 | Bacteria | 945 |
| 175 | Ga0163161_10161461 | 3300017792 | Bacteria | 1709 |
| 176 | Ga0163161_10188798 | 3300017792 | Bacteria | 1583 |
| 177 | Ga0213872_10000219 | 3300021361 | Bacteria | 50549 |
| 178 | Ga0213872_10284374 | 3300021361 | Bacteria | 690 |
| 179 | Ga0209674_100067 | 3300025226 | Bacteria | 253824 |
| 180 | Ga0209672_103024 | 3300025228 | Bacteria | 3670 |
| 181 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 182 | Ga0209563_100068 | 3300025230 | Bacteria | 254802 |
| 183 | Ga0207427_100458 | 3300025231 | Bacteria | 22530 |
| 184 | Ga0209258_100129 | 3300025242 | Bacteria | 176515 |
| 185 | Ga0209258_100459 | 3300025242 | Bacteria | 44386 |
| 186 | Ga0207425_1004340 | 3300025245 | Bacteria | 4287 |
| 187 | Ga0209646_1000244 | 3300025246 | Bacteria | 55661 |
| 188 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 189 | Ga0209677_100049 | 3300025253 | Bacteria | 180721 |
| 190 | Ga0209677_100413 | 3300025253 | Bacteria | 25541 |
| 191 | Ga0209677_101817 | 3300025253 | Bacteria | 8730 |
| 192 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 193 | Ga0209759_1001180 | 3300025256 | Bacteria | 16394 |
| 194 | Ga0209129_1000113 | 3300025258 | Bacteria | 145178 |
| 195 | Ga0209455_1000083 | 3300025272 | Bacteria | 255660 |
| 196 | Ga0209673_1009751 | 3300025273 | Bacteria | 4122 |
| 197 | Ga0209673_1011242 | 3300025273 | Bacteria | 3704 |
| 198 | Ga0209564_1000186 | 3300025295 | Bacteria | 147120 |
| 199 | Ga0209758_1000172 | 3300025297 | Bacteria | 147763 |
| 200 | Ga0209758_1000304 | 3300025297 | Bacteria | 95770 |
| 201 | Ga0209050_1000489 | 3300025298 | Bacteria | 68506 |
| 202 | Ga0209050_1011160 | 3300025298 | Bacteria | 4303 |
| 203 | Ga0209256_1000391 | 3300025299 | Bacteria | 69634 |
| 204 | Ga0209256_1021065 | 3300025299 | Bacteria | 2015 |
| 205 | Ga0209256_1083914 | 3300025299 | Bacteria | 690 |
| 206 | Ga0209051_1000920 | 3300025303 | Bacteria | 29209 |
| 207 | Ga0209051_1002680 | 3300025303 | Bacteria | 12438 |
| 208 | Ga0209051_1012113 | 3300025303 | Bacteria | 4194 |
| 209 | Ga0209257_1004193 | 3300025304 | Bacteria | 11433 |
| 210 | Ga0207697_10076701 | 3300025315 | Bacteria | 1405 |
| 211 | Ga0207682_10000902 | 3300025893 | Bacteria | 13752 |
| 212 | Ga0207682_10076560 | 3300025893 | Bacteria | 1426 |
| 213 | Ga0207682_10208450 | 3300025893 | Bacteria | 901 |
| 214 | Ga0207688_10227998 | 3300025901 | Bacteria | 1124 |
| 215 | Ga0207680_10236408 | 3300025903 | Bacteria | 1257 |
| 216 | Ga0207645_10003682 | 3300025907 | Bacteria | 11561 |
| 217 | Ga0207645_10027108 | 3300025907 | Bacteria | 3702 |
| 218 | Ga0207645_10118511 | 3300025907 | Bacteria | 1717 |
| 219 | Ga0207645_10192359 | 3300025907 | Bacteria | 1341 |
| 220 | Ga0207645_10224234 | 3300025907 | Bacteria | 1239 |
| 221 | Ga0207645_10663452 | 3300025907 | Bacteria | 709 |
| 222 | Ga0207643_10089492 | 3300025908 | Bacteria | 1793 |
| 223 | Ga0207643_10186592 | 3300025908 | Bacteria | 1257 |
| 224 | Ga0207684_10017578 | 3300025910 | Bacteria | 6133 |
| 225 | Ga0207684_10169008 | 3300025910 | Bacteria | 1885 |
| 226 | Ga0207684_10976875 | 3300025910 | Bacteria | 709 |
| 227 | Ga0207695_10019455 | 3300025913 | Bacteria | 7821 |
| 228 | Ga0207695_10031958 | 3300025913 | Bacteria | 5765 |
| 229 | Ga0207695_10233155 | 3300025913 | Bacteria | 1744 |
| 230 | Ga0207671_10017873 | 3300025914 | Bacteria | 5455 |
| 231 | Ga0207671_10024660 | 3300025914 | Bacteria | 4518 |
| 232 | Ga0207662_10211102 | 3300025918 | Bacteria | 1260 |
| 233 | Ga0207649_11043061 | 3300025920 | Bacteria | 644 |
| 234 | Ga0207646_10624381 | 3300025922 | Bacteria | 966 |
| 235 | Ga0207681_10035054 | 3300025923 | Bacteria | 3305 |
| 236 | Ga0207681_10163776 | 3300025923 | Bacteria | 1679 |
| 237 | Ga0207681_10360200 | 3300025923 | Bacteria | 1166 |
| 238 | Ga0207694_10003197 | 3300025924 | Bacteria | 13068 |
| 239 | Ga0207650_10000580 | 3300025925 | Bacteria | 29427 |
| 240 | Ga0207650_10112642 | 3300025925 | Bacteria | 2108 |
| 241 | Ga0207659_10001304 | 3300025926 | Bacteria | 14888 |
| 242 | Ga0207659_10108646 | 3300025926 | Bacteria | 2104 |
| 243 | Ga0207644_10050850 | 3300025931 | Bacteria | 2972 |
| 244 | Ga0207644_10175200 | 3300025931 | Bacteria | 1677 |
| 245 | Ga0207644_10375023 | 3300025931 | Bacteria | 1159 |
| 246 | Ga0207644_10807861 | 3300025931 | Bacteria | 784 |
| 247 | Ga0207706_10135113 | 3300025933 | Bacteria | 2170 |
| 248 | Ga0207706_10146367 | 3300025933 | Bacteria | 2078 |
| 249 | Ga0207706_10509119 | 3300025933 | Bacteria | 1039 |
| 250 | Ga0207686_10369294 | 3300025934 | Bacteria | 1085 |
| 251 | Ga0207709_10002023 | 3300025935 | Bacteria | 13149 |
| 252 | Ga0207709_10046945 | 3300025935 | Bacteria | 2624 |
| 253 | Ga0207709_10351273 | 3300025935 | Bacteria | 1113 |
| 254 | Ga0207709_10509075 | 3300025935 | Bacteria | 941 |
| 255 | Ga0207669_10004641 | 3300025937 | Bacteria | 6068 |
| 256 | Ga0207669_10041839 | 3300025937 | Bacteria | 2670 |
| 257 | Ga0207669_10330611 | 3300025937 | Bacteria | 1170 |
| 258 | Ga0207704_10006505 | 3300025938 | Bacteria | 5454 |
| 259 | Ga0207704_10158481 | 3300025938 | Bacteria | 1607 |
| 260 | Ga0207704_10184182 | 3300025938 | Bacteria | 1512 |
| 261 | Ga0207704_10428517 | 3300025938 | Bacteria | 1050 |
| 262 | Ga0207691_10009625 | 3300025940 | Bacteria | 9272 |
| 263 | Ga0207691_10036588 | 3300025940 | Bacteria | 4549 |
| 264 | Ga0207711_10040465 | 3300025941 | Bacteria | 3966 |
| 265 | Ga0207711_10809730 | 3300025941 | Bacteria | 872 |
| 266 | Ga0207711_10919367 | 3300025941 | Bacteria | 813 |
| 267 | Ga0207689_10020983 | 3300025942 | Bacteria | 5490 |
| 268 | Ga0207689_10033149 | 3300025942 | Bacteria | 4292 |
| 269 | Ga0207689_10078525 | 3300025942 | Bacteria | 2712 |
| 270 | Ga0207661_10191831 | 3300025944 | Bacteria | 1792 |
| 271 | Ga0207679_10338004 | 3300025945 | Bacteria | 1309 |
| 272 | Ga0207667_10011062 | 3300025949 | Bacteria | 10512 |
| 273 | Ga0207667_10358662 | 3300025949 | Bacteria | 1487 |
| 274 | Ga0207651_10000982 | 3300025960 | Bacteria | 12600 |
| 275 | Ga0207651_10353571 | 3300025960 | Bacteria | 1238 |
| 276 | Ga0207651_10697904 | 3300025960 | Bacteria | 894 |
| 277 | Ga0207651_10799199 | 3300025960 | Bacteria | 836 |
| 278 | Ga0207712_10101436 | 3300025961 | Bacteria | 2140 |
| 279 | Ga0207712_10603064 | 3300025961 | Bacteria | 950 |
| 280 | Ga0207712_11281557 | 3300025961 | Bacteria | 655 |
| 281 | Ga0207640_10051812 | 3300025981 | Bacteria | 2670 |
| 282 | Ga0207640_10091037 | 3300025981 | Bacteria | 2112 |
| 283 | Ga0207640_11034052 | 3300025981 | Bacteria | 724 |
| 284 | Ga0207658_10000533 | 3300025986 | Bacteria | 34674 |
| 285 | Ga0207658_10596696 | 3300025986 | Bacteria | 992 |
| 286 | Ga0207658_10687325 | 3300025986 | Bacteria | 924 |
| 287 | Ga0207703_10712501 | 3300026035 | Bacteria | 955 |
| 288 | Ga0207639_10027284 | 3300026041 | Bacteria | 4158 |
| 289 | Ga0207639_10650509 | 3300026041 | Bacteria | 975 |
| 290 | Ga0207678_10002475 | 3300026067 | Bacteria | 16780 |
| 291 | Ga0207678_10060519 | 3300026067 | Bacteria | 3257 |
| 292 | Ga0207678_10705588 | 3300026067 | Bacteria | 888 |
| 293 | Ga0207702_10000525 | 3300026078 | Bacteria | 42984 |
| 294 | Ga0207641_10149112 | 3300026088 | Bacteria | 2117 |
| 295 | Ga0207648_10000574 | 3300026089 | Bacteria | 41215 |
| 296 | Ga0207648_10003174 | 3300026089 | Bacteria | 17317 |
| 297 | Ga0207648_10003741 | 3300026089 | Bacteria | 15906 |
| 298 | Ga0207648_10004810 | 3300026089 | Bacteria | 13779 |
| 299 | Ga0207648_10276104 | 3300026089 | Bacteria | 1502 |
| 300 | Ga0207648_10467623 | 3300026089 | Bacteria | 1150 |
| 301 | Ga0207676_10041455 | 3300026095 | Bacteria | 3534 |
| 302 | Ga0207674_10018439 | 3300026116 | Bacteria | 7585 |
| 303 | Ga0207674_10068767 | 3300026116 | Bacteria | 3563 |
| 304 | Ga0207674_10145160 | 3300026116 | Bacteria | 2331 |
| 305 | Ga0207683_10051560 | 3300026121 | Bacteria | 3605 |
| 306 | Ga0207683_10110942 | 3300026121 | Bacteria | 2456 |
| 307 | Ga0207683_10383060 | 3300026121 | Bacteria | 1293 |
| 308 | Ga0207698_10200976 | 3300026142 | Bacteria | 1784 |
| 309 | Ga0207698_10284767 | 3300026142 | Bacteria | 1530 |
| 310 | Ga0207698_10610224 | 3300026142 | Bacteria | 1077 |
| 311 | Ga0207698_11576741 | 3300026142 | Bacteria | 672 |
| 312 | Ga0209389_1000215 | 3300027296 | Bacteria | 40569 |
| 313 | Ga0209371_1014733 | 3300027312 | Bacteria | 2130 |
| 314 | Ga0209996_1001297 | 3300027395 | Bacteria | 3002 |
| 315 | Ga0209995_1000208 | 3300027471 | Bacteria | 9439 |
| 316 | Ga0209966_1000046 | 3300027695 | Bacteria | 52323 |
| 317 | Ga0268266_10053942 | 3300028379 | Bacteria | 3455 |
| 318 | Ga0268266_10076779 | 3300028379 | Bacteria | 2904 |
| 319 | Ga0268265_10030975 | 3300028380 | Bacteria | 3859 |
| 320 | Ga0268265_10166411 | 3300028380 | Bacteria | 1879 |
| 321 | Ga0268264_10002041 | 3300028381 | Bacteria | 18038 |
| 322 | Ga0268264_10260372 | 3300028381 | Bacteria | 1615 |
| 323 | Ga0268264_10932075 | 3300028381 | Bacteria | 873 |
| 324 | Ga0265336_10000087 | 3300028666 | Bacteria | 72636 |
| 325 | Ga0307517_10000394 | 3300028786 | Bacteria | 74695 |
| 326 | Ga0307517_10113786 | 3300028786 | Bacteria | 2040 |
| 327 | Ga0307517_10140602 | 3300028786 | Bacteria | 1696 |
| 328 | Ga0307515_10000013 | 3300028794 | Bacteria | 568456 |
| 329 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 330 | Ga0307515_10000123 | 3300028794 | Bacteria | 186601 |
| 331 | Ga0307515_10037587 | 3300028794 | Bacteria | 7780 |
| 332 | Ga0307515_10121955 | 3300028794 | Bacteria | 2944 |
| 333 | Ga0307515_10274273 | 3300028794 | Bacteria | 1402 |
| 334 | Ga0265324_10000334 | 3300029957 | Bacteria | 34717 |
| 335 | Ga0268256_1024471 | 3300030500 | Bacteria | 1549 |
| 336 | Ga0307511_10074169 | 3300030521 | Bacteria | 2455 |
| 337 | Ga0307512_10094851 | 3300030522 | Bacteria | 2056 |
| 338 | Ga0307513_10106404 | 3300031456 | Bacteria | 2811 |
| 339 | Ga0307513_10263653 | 3300031456 | Bacteria | 1511 |
| 340 | Ga0307509_10000950 | 3300031507 | Bacteria | 49553 |
| 341 | Ga0307509_10023601 | 3300031507 | Bacteria | 6901 |
| 342 | Ga0307408_100716071 | 3300031548 | Bacteria | 901 |
| 343 | Ga0307508_10000150 | 3300031616 | Bacteria | 83110 |
| 344 | Ga0307508_10000912 | 3300031616 | Bacteria | 34407 |
| 345 | Ga0307508_10175321 | 3300031616 | Bacteria | 1747 |
| 346 | Ga0307514_10067190 | 3300031649 | Bacteria | 2707 |
| 347 | Ga0307516_10000164 | 3300031730 | Bacteria | 83388 |
| 348 | Ga0307516_10004805 | 3300031730 | Bacteria | 16463 |
| 349 | Ga0307516_10084315 | 3300031730 | Bacteria | 3017 |
| 350 | Ga0307516_10091116 | 3300031730 | Bacteria | 2877 |
| 351 | Ga0307516_10137194 | 3300031730 | Bacteria | 2219 |
| 352 | Ga0307516_10229868 | 3300031730 | Bacteria | 1559 |
| 353 | Ga0307516_10768091 | 3300031730 | Bacteria | 624 |
| 354 | Ga0307405_10201829 | 3300031731 | Bacteria | 1445 |
| 355 | Ga0307413_10039868 | 3300031824 | Bacteria | 2735 |
| 356 | Ga0307406_10067917 | 3300031901 | Bacteria | 2326 |
| 357 | Ga0307407_10248570 | 3300031903 | Bacteria | 1217 |
| 358 | Ga0307412_10004357 | 3300031911 | Bacteria | 7893 |
| 359 | Ga0307412_10077563 | 3300031911 | Bacteria | 2286 |
| 360 | Ga0307412_10336348 | 3300031911 | Bacteria | 1207 |
| 361 | Ga0307412_11062602 | 3300031911 | Bacteria | 718 |
| 362 | Ga0307416_100022472 | 3300032002 | Bacteria | 4554 |
| 363 | Ga0307416_100612526 | 3300032002 | Bacteria | 1170 |
| 364 | Ga0307411_11145617 | 3300032005 | Bacteria | 703 |
| 365 | Ga0307507_10044515 | 3300033179 | Bacteria | 4385 |
| 366 | Ga0307507_10276280 | 3300033179 | Bacteria | 1055 |
| 367 | Ga0307510_10018224 | 3300033180 | Bacteria | 8266 |
| 368 | Ga0307510_10024351 | 3300033180 | Bacteria | 6995 |
| 369 | Ga0307510_10208656 | 3300033180 | Bacteria | 1478 |
| 370 | Ga0307510_10244882 | 3300033180 | Bacteria | 1284 |
| 371 | Ga0373934_0008867 | 3300035086 | Bacteria | 3758 |
| 372 | Ga0373931_0107423 | 3300035691 | Bacteria | 1578 |
| 373 | Ga0373935_0581205 | 3300035692 | Bacteria | 818 |
| 374 | Ga0373927_0007707 | 3300035695 | Bacteria | 7286 |
| 375 | Ga0373925_0175771 | 3300037068 | Bacteria | 1692 |
| 376 | Ga0395900_0000904 | 3300037418 | Bacteria | 39054 |
| 377 | Ga0395898_0001196 | 3300037466 | Bacteria | 39243 |
| 378 | Ga0395905_0004485 | 3300037471 | Bacteria | 14482 |
| 379 | Ga0395905_0036167 | 3300037471 | Bacteria | 4637 |
| 380 | Ga0395905_0059846 | 3300037471 | Bacteria | 3561 |
| 381 | Ga0395905_0162470 | 3300037471 | Bacteria | 2099 |
| 382 | Ga0436361_0231366 | 3300039447 | Bacteria | 3282 |
| 383 | Ga0436361_0264437 | 3300039447 | Bacteria | 60444 |
| 384 | Ga0436361_0813098 | 3300039447 | Bacteria | 136133 |
| 385 | Ga0436361_1029632 | 3300039447 | Bacteria | 7528 |
| 386 | Ga0451789_0291111 | 3300041443 | Bacteria | 2276 |
| 387 | Ga0451795_1056889 | 3300041456 | Bacteria | 1110 |
| 388 | Ga0451798_0274987 | 3300041458 | Bacteria | 851 |
| 389 | Ga0451804_0431348 | 3300041463 | Bacteria | 2788 |
| 390 | Ga0451853_2456265 | 3300041512 | Bacteria | 743 |
| 391 | Ga0451853_3681233 | 3300041512 | Bacteria | 1553 |
| 392 | Ga0439449_0010624 | 3300042007 | Bacteria | 3478 |
| 393 | Ga0439454_016864 | 3300042011 | Bacteria | 1037 |
| 394 | Ga0439455_0042469 | 3300042012 | Bacteria | 1168 |
| 395 | Ga0450895_020713 | 3300042132 | Bacteria | 609 |
| 396 | Ga0450898_032783 | 3300042134 | Bacteria | 959 |
| 397 | Ga0450898_072705 | 3300042134 | Bacteria | 691 |
| 398 | Ga0450909_032635 | 3300042185 | Bacteria | 792 |
| 399 | Ga0439434_0168139 | 3300042435 | Bacteria | 731 |
| 400 | Ga0439464_0071330 | 3300042439 | Bacteria | 1028 |
| 401 | Ga0450893_0023100 | 3300042532 | Bacteria | 1080 |
| 402 | Ga0451577_0089335 | 3300042876 | Bacteria | 2749 |
| 403 | Ga0451577_0919678 | 3300042876 | Bacteria | 787 |
| 404 | Ga0466969_0033076 | 3300044656 | Bacteria | 2627 |
| 405 | Ga0466972_0006140 | 3300044658 | Bacteria | 6037 |
| 406 | Ga0466965_0015474 | 3300044683 | Bacteria | 3624 |
| 407 | Ga0466965_0172534 | 3300044683 | Bacteria | 1138 |
| 408 | Ga0466966_0027536 | 3300044684 | Bacteria | 3705 |
| 409 | Ga0466961_0028716 | 3300044693 | Bacteria | 3577 |
| 410 | Ga0466961_0253405 | 3300044693 | Bacteria | 1080 |
| 411 | Ga0466963_0029617 | 3300044694 | Bacteria | 3525 |
| 412 | Ga0466963_0073044 | 3300044694 | Bacteria | 2312 |
| 413 | Ga0466964_0022033 | 3300044706 | Bacteria | 2468 |
| 414 | Ga0466964_0163256 | 3300044706 | Bacteria | 1043 |
| 415 | Ga0453684_0000365 | 3300044712 | Bacteria | 186233 |
| 416 | Ga0453684_0064742 | 3300044712 | Bacteria | 4668 |
| 417 | Ga0453684_0081723 | 3300044712 | Bacteria | 4029 |
| 418 | Ga0453684_0269217 | 3300044712 | Bacteria | 1948 |
| 419 | Ga0453684_0801738 | 3300044712 | Bacteria | 1015 |
| 420 | Ga0466970_0020049 | 3300044765 | Bacteria | 3470 |
| 421 | Ga0466957_0164007 | 3300044842 | Bacteria | 1444 |
| 422 | Ga0466957_0307821 | 3300044842 | Bacteria | 1066 |
| 423 | Ga0466959_0000916 | 3300045049 | Bacteria | 17453 |
| 424 | Ga0451576_0020395 | 3300045051 | Bacteria | 7220 |
| 425 | Ga0451576_0050879 | 3300045051 | Bacteria | 4344 |
| 426 | Ga0466958_0055320 | 3300045836 | Bacteria | 2408 |
| 427 | Ga0466958_0144732 | 3300045836 | Bacteria | 1497 |
| 428 | Ga0466967_0080814 | 3300045976 | Bacteria | 2934 |
| 429 | Ga0495592_0007407 | 3300046454 | Bacteria | 8216 |
| 430 | Ga0495638_0028172 | 3300046460 | Bacteria | 3630 |
| 431 | Ga0495639_0140918 | 3300046475 | Bacteria | 1159 |
| 432 | Ga0495639_0381097 | 3300046475 | Bacteria | 711 |
| 433 | Ga0495585_0268530 | 3300046492 | Bacteria | 846 |
| 434 | Ga0495606_0000600 | 3300046507 | Bacteria | 57013 |
| 435 | Ga0495606_0084253 | 3300046507 | Bacteria | 1969 |
| 436 | Ga0495620_0052156 | 3300046515 | Bacteria | 1738 |
| 437 | Ga0495630_0171136 | 3300046517 | Bacteria | 1655 |
| 438 | Ga0495632_0037421 | 3300046519 | Bacteria | 2462 |
| 439 | Ga0495643_0103084 | 3300046522 | Bacteria | 1460 |
| 440 | Ga0495648_0080880 | 3300046524 | Bacteria | 1850 |
| 441 | Ga0495666_0078310 | 3300046526 | Bacteria | 1566 |
| 442 | Ga0495609_0117909 | 3300046538 | Bacteria | 1143 |
| 443 | Ga0495621_0077078 | 3300046539 | Bacteria | 1237 |
| 444 | Ga0495668_0490787 | 3300046616 | Bacteria | 677 |
| 445 | Ga0495625_0029142 | 3300046660 | Bacteria | 4132 |
| 446 | Ga0495624_0044128 | 3300046690 | Bacteria | 2843 |
| 447 | Ga0495624_0621157 | 3300046690 | Bacteria | 643 |
| 448 | Ga0495671_0180060 | 3300046692 | Bacteria | 1027 |
| 449 | Ga0495649_0000655 | 3300046694 | Bacteria | 28205 |
| 450 | Ga0495649_0012421 | 3300046694 | Bacteria | 4951 |
| 451 | Ga0495589_0012863 | 3300046794 | Bacteria | 4325 |
| 452 | Ga0495660_0037246 | 3300046810 | Bacteria | 2710 |
| 453 | Ga0495660_0155214 | 3300046810 | Bacteria | 1127 |
| 454 | Ga0495676_0055352 | 3300047321 | Bacteria | 3146 |
| 455 | Ga0495687_000414 | 3300047443 | Bacteria | 52840 |
| 456 | Ga0495687_019317 | 3300047443 | Bacteria | 3348 |
| 457 | Ga0495687_035617 | 3300047443 | Bacteria | 2235 |
| 458 | Ga0495679_124727 | 3300047446 | Bacteria | 702 |
| 459 | Ga0495593_0133286 | 3300047673 | Bacteria | 1260 |
| 460 | Ga0495626_0005858 | 3300048091 | Bacteria | 7086 |
| 461 | Ga0496102_0003913 | 3300048905 | Bacteria | 12613 |
| 462 | Ga0496106_0163454 | 3300048909 | Bacteria | 1761 |
| 463 | Ga0496108_0108525 | 3300048911 | Bacteria | 2371 |
| 464 | Ga0496108_0113414 | 3300048911 | Bacteria | 2320 |
| 465 | Ga0496109_0233412 | 3300048912 | Bacteria | 1731 |
| 466 | Ga0496109_0341453 | 3300048912 | Bacteria | 1414 |
| 467 | Ga0496112_0074530 | 3300048915 | Bacteria | 3355 |
| 468 | Ga0496113_0190853 | 3300048916 | Bacteria | 1626 |
| 469 | Ga0496113_0448783 | 3300048916 | Bacteria | 1036 |
| 470 | Ga0501303_001646 | 3300049526 | Bacteria | 1681 |
| 471 | Ga0501042_0126781 | 3300049578 | Bacteria | 1838 |
| 472 | Ga0501043_0000012 | 3300049579 | Bacteria | 188907 |
| 473 | Ga0501046_0000030 | 3300049580 | Bacteria | 187803 |
| 474 | Ga0501047_0000049 | 3300049581 | Bacteria | 162513 |
| 475 | Ga0501048_0001813 | 3300049582 | Bacteria | 16227 |
| 476 | Ga0501206_024451 | 3300049653 | Bacteria | 875 |
| 477 | Ga0501206_027179 | 3300049653 | Bacteria | 838 |
| 478 | Ga0501245_031209 | 3300049708 | Bacteria | 882 |
| 479 | Ga0501265_002387 | 3300049762 | Bacteria | 2132 |
| 480 | Ga0501266_014677 | 3300049763 | Bacteria | 1029 |
| 481 | Ga0501035_0093746 | 3300049822 | Bacteria | 2642 |
| 482 | Ga0501044_0211044 | 3300049823 | Bacteria | 1896 |
| 483 | Ga0501045_0002489 | 3300049824 | Bacteria | 12533 |
| 484 | nmdc:mga03683_128419_c1 | 3300050489 | Bacteria | 1132 |
| 485 | nmdc:mga03683_41714_c1 | 3300050489 | Bacteria | 1886 |
| 486 | nmdc:mga00v17_148194_c1 | 3300050491 | Bacteria | 1507 |
| 487 | nmdc:mga0yw44_253628_c1 | 3300050492 | Bacteria | 1171 |
| 488 | nmdc:mga0k408_119275_c1 | 3300050493 | Bacteria | 1562 |
| 489 | nmdc:mga0k408_12249_c1 | 3300050493 | Bacteria | 4686 |
| 490 | nmdc:mga0k408_125778_c1 | 3300050493 | Bacteria | 1520 |
| 491 | nmdc:mga0k408_16837_c1 | 3300050493 | Bacteria | 4064 |
| 492 | nmdc:mga0k408_29814_c1 | 3300050493 | Bacteria | 3108 |
| 493 | nmdc:mga0k408_3343_c1 | 3300050493 | Bacteria | 8489 |
| 494 | nmdc:mga0k408_340706_c1 | 3300050493 | Bacteria | 894 |
| 495 | nmdc:mga0k408_36271_c1 | 3300050493 | Bacteria | 2830 |
| 496 | nmdc:mga0k408_37149_c1 | 3300050493 | Bacteria | 2796 |
| 497 | nmdc:mga0k408_37611_c1 | 3300050493 | Bacteria | 2779 |
| 498 | nmdc:mga0k408_608919_c1 | 3300050493 | Bacteria | 644 |
| 499 | nmdc:mga0k408_77192_c1 | 3300050493 | Bacteria | 1948 |
| 500 | nmdc:mga0k408_908_c1 | 3300050493 | Bacteria | 16172 |
| 501 | nmdc:mga06z11_43224_c1 | 3300050494 | Bacteria | 2265 |
| 502 | nmdc:mga06z11_67809_c1 | 3300050494 | Bacteria | 1879 |
| 503 | nmdc:mga06z11_91460_c1 | 3300050494 | Bacteria | 1652 |
| 504 | nmdc:mga07m45_284_c1 | 3300050496 | Bacteria | 16296 |
| 505 | nmdc:mga07m45_3787_c1 | 3300050496 | Bacteria | 7320 |
| 506 | nmdc:mga07m45_4440_c1 | 3300050496 | Bacteria | 6866 |
| 507 | nmdc:mga07m45_5674_c1 | 3300050496 | Bacteria | 6238 |
| 508 | nmdc:mga05p37_278107_c1 | 3300050507 | Bacteria | 1997 |
| 509 | nmdc:mga05p37_456627_c1 | 3300050507 | Bacteria | 1477 |
| 510 | nmdc:mga09592_220626_c1 | 3300050508 | Bacteria | 1643 |
| 511 | nmdc:mga0qj67_281725_c1 | 3300050509 | Bacteria | 1347 |
| 512 | nmdc:mga0qj67_282262_c1 | 3300050509 | Bacteria | 1346 |
| 513 | nmdc:mga0sz30_31376_c1 | 3300050516 | Bacteria | 2199 |
| 514 | Ga0500635_0000322 | 3300053080 | Bacteria | 16527 |
| 515 | Ga0500635_0087184 | 3300053080 | Bacteria | 1130 |
| 516 | Ga0500578_0139065 | 3300053086 | Bacteria | 1519 |
| 517 | Ga0500644_0020880 | 3300053088 | Bacteria | 1954 |
| 518 | Ga0500646_0018715 | 3300053090 | Bacteria | 1826 |
| 519 | Ga0500650_0019913 | 3300053098 | Bacteria | 2937 |
| 520 | Ga0500650_0048253 | 3300053098 | Bacteria | 1975 |
| 521 | Ga0500562_022756 | 3300053108 | Bacteria | 1634 |
| 522 | Ga0500594_0002149 | 3300053118 | Bacteria | 4266 |
| 523 | Ga0500628_010170 | 3300053129 | Bacteria | 1677 |
| 524 | Ga0500642_0001693 | 3300053130 | Bacteria | 6357 |
| 525 | Ga0500652_002916 | 3300053131 | Bacteria | 5158 |
| 526 | Ga0500655_006702 | 3300053133 | Bacteria | 2072 |
| 527 | Ga0500658_0056748 | 3300053134 | Bacteria | 1616 |
| 528 | Ga0500559_0004161 | 3300053136 | Bacteria | 6942 |
| 529 | Ga0500559_0019920 | 3300053136 | Bacteria | 2835 |
| 530 | Ga0500568_0027685 | 3300053139 | Bacteria | 2368 |
| 531 | Ga0500568_0059275 | 3300053139 | Bacteria | 1486 |
| 532 | Ga0500568_0100326 | 3300053139 | Bacteria | 1086 |
| 533 | Ga0500604_0001619 | 3300053151 | Bacteria | 6319 |
| 534 | Ga0500604_0010207 | 3300053151 | Bacteria | 2509 |
| 535 | Ga0500604_0044930 | 3300053151 | Bacteria | 1346 |
| 536 | Ga0500619_011735 | 3300053154 | Bacteria | 2265 |
| 537 | Ga0500622_0000146 | 3300053156 | Bacteria | 74615 |
| 538 | Ga0500622_0010151 | 3300053156 | Bacteria | 5180 |
| 539 | Ga0500622_0154083 | 3300053156 | Bacteria | 1083 |
| 540 | Ga0500636_0074806 | 3300053177 | Bacteria | 1960 |
| 541 | Ga0500636_0132185 | 3300053177 | Bacteria | 1389 |
| 542 | Ga0500645_024283 | 3300053730 | Bacteria | 1853 |
| 543 | Ga0500587_001169 | 3300053739 | Bacteria | 3624 |
| 544 | Ga0500661_037886 | 3300055283 | Bacteria | 853 |
| 545 | Ga0500661_046177 | 3300055283 | Bacteria | 774 |
| 546 | Ga0466962_0158800 | 3300061719 | Bacteria | 1098 |
| 547 | Ga0466962_0344010 | 3300061719 | Bacteria | 742 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300030521 | Ga0307511_10074169 | Ga0307511_100741692 | 145 |
| 2 | 3300046507 | Ga0495606_0000600 | Ga0495606_0000600_38792_39376 | 145 |
| 3 | 3300046694 | Ga0495649_0000655 | Ga0495649_0000655_3066_3650 | 145 |
| 4 | 3300026067 | Ga0207678_10705588 | Ga0207678_107055881 | 146 |
| 5 | 3300028666 | Ga0265336_10000087 | Ga0265336_1000008736 | 148 |
| 6 | 3300029957 | Ga0265324_10000334 | Ga0265324_100003343 | 148 |
| 7 | 3300053177 | Ga0500636_0074806 | Ga0500636_0074806_1289_1852 | 148 |
| 8 | 3300005328 | Ga0070676_10063737 | Ga0070676_100637372 | 155 |
| 9 | 3300025907 | Ga0207645_10027108 | Ga0207645_100271082 | 155 |
| 10 | 3300025945 | Ga0207679_10338004 | Ga0207679_103380042 | 155 |
| 11 | 3300003775 | Ga0055524_1023386 | Ga0055524_10233863 | 156 |
| 12 | 3300003794 | Ga0055531_10004238 | Ga0055531_100042382 | 156 |
| 13 | 3300006942 | Ga0099824_1029266 | Ga0099824_10292662 | 156 |
| 14 | 3300006944 | Ga0099823_1000025 | Ga0099823_100002537 | 156 |
| 15 | 3300025273 | Ga0209673_1009751 | Ga0209673_10097512 | 156 |
| 16 | 3300025298 | Ga0209050_1011160 | Ga0209050_10111605 | 156 |
| 17 | 3300025299 | Ga0209256_1021065 | Ga0209256_10210652 | 156 |
| 18 | 3300025303 | Ga0209051_1000920 | Ga0209051_10009206 | 156 |
| 19 | 3300025304 | Ga0209257_1004193 | Ga0209257_10041935 | 156 |
| 20 | 3300027296 | Ga0209389_1000215 | Ga0209389_10002159 | 156 |
| 21 | 3300027312 | Ga0209371_1014733 | Ga0209371_10147333 | 156 |
| 22 | 3300030500 | Ga0268256_1024471 | Ga0268256_10244712 | 156 |
| 23 | 3300031730 | Ga0307516_10768091 | Ga0307516_107680911 | 156 |
| 24 | 3300042011 | Ga0439454_016864 | Ga0439454_016864_132_740 | 156 |
| 25 | 3300044712 | Ga0453684_0000365 | Ga0453684_0000365_62304_62831 | 156 |
| 26 | 3300044694 | Ga0466963_0073044 | Ga0466963_0073044_1658_2245 | 157 |
| 27 | 3300046616 | Ga0495668_0490787 | Ga0495668_0490787_100_639 | 158 |
| 28 | 3300047446 | Ga0495679_124727 | Ga0495679_124727_162_692 | 158 |
| 29 | 3300053108 | Ga0500562_022756 | Ga0500562_022756_440_970 | 158 |
| 30 | 3300053118 | Ga0500594_0002149 | Ga0500594_0002149_2634_3164 | 158 |
| 31 | 3300053139 | Ga0500568_0100326 | Ga0500568_0100326_536_1066 | 158 |
| 32 | 3300053177 | Ga0500636_0132185 | Ga0500636_0132185_511_1041 | 158 |
| 33 | 3300053739 | Ga0500587_001169 | Ga0500587_001169_445_975 | 158 |
| 34 | 3300005355 | Ga0070671_100238993 | Ga0070671_1002389932 | 159 |
| 35 | 3300048911 | Ga0496108_0113414 | Ga0496108_0113414_1508_2125 | 159 |
| 36 | 3300048912 | Ga0496109_0341453 | Ga0496109_0341453_255_872 | 159 |
| 37 | 3300003761 | Ga0055535_1002530 | Ga0055535_10025302 | 160 |
| 38 | 3300003763 | Ga0055529_1000464 | Ga0055529_10004644 | 160 |
| 39 | 3300003763 | Ga0055529_1001234 | Ga0055529_10012344 | 160 |
| 40 | 3300025228 | Ga0209672_103024 | Ga0209672_1030243 | 160 |
| 41 | 3300025242 | Ga0209258_100129 | Ga0209258_10012926 | 160 |
| 42 | 3300025256 | Ga0209759_1001180 | Ga0209759_10011802 | 160 |
| 43 | 3300025272 | Ga0209455_1000083 | Ga0209455_1000083129 | 160 |
| 44 | 3300003775 | Ga0055524_1002162 | Ga0055524_100216210 | 161 |
| 45 | 3300005844 | Ga0068862_101147603 | Ga0068862_1011476031 | 161 |
| 46 | 3300006177 | Ga0075362_10055625 | Ga0075362_100556252 | 161 |
| 47 | 3300006195 | Ga0075366_10003496 | Ga0075366_100034969 | 161 |
| 48 | 3300012497 | Ga0157319_1000014 | Ga0157319_100001468 | 161 |
| 49 | 3300025299 | Ga0209256_1000391 | Ga0209256_100039124 | 161 |
| 50 | 3300050489 | nmdc:mga03683_128419_c1 | nmdc:mga03683_128419_c1_258_788 | 161 |
| 51 | 3300050493 | nmdc:mga0k408_12249_c1 | nmdc:mga0k408_12249_c1_3328_3855 | 161 |
| 52 | 3300050493 | nmdc:mga0k408_908_c1 | nmdc:mga0k408_908_c1_15459_15989 | 161 |
| 53 | 3300050507 | nmdc:mga05p37_456627_c1 | nmdc:mga05p37_456627_c1_289_810 | 161 |
| 54 | 3300053080 | Ga0500635_0087184 | Ga0500635_0087184_342_899 | 161 |
| 55 | 3300053151 | Ga0500604_0010207 | Ga0500604_0010207_1343_1900 | 161 |
| 56 | 3300003759 | Ga0055525_1000056 | Ga0055525_100005634 | 162 |
| 57 | 3300025230 | Ga0209563_100014 | Ga0209563_100014160 | 162 |
| 58 | 3300025303 | Ga0209051_1002680 | Ga0209051_10026808 | 162 |
| 59 | 3300025907 | Ga0207645_10118511 | Ga0207645_101185112 | 162 |
| 60 | 3300025960 | Ga0207651_10697904 | Ga0207651_106979041 | 162 |
| 61 | 3300028794 | Ga0307515_10000123 | Ga0307515_10000123142 | 162 |
| 62 | 3300031456 | Ga0307513_10263653 | Ga0307513_102636532 | 162 |
| 63 | 3300031731 | Ga0307405_10201829 | Ga0307405_102018292 | 162 |
| 64 | 3300031911 | Ga0307412_10077563 | Ga0307412_100775632 | 162 |
| 65 | 3300032002 | Ga0307416_100612526 | Ga0307416_1006125262 | 162 |
| 66 | 3300033179 | Ga0307507_10044515 | Ga0307507_100445154 | 162 |
| 67 | 3300046507 | Ga0495606_0084253 | Ga0495606_0084253_823_1380 | 162 |
| 68 | 3300053129 | Ga0500628_010170 | Ga0500628_010170_771_1337 | 162 |
| 69 | 3300053156 | Ga0500622_0154083 | Ga0500622_0154083_213_776 | 162 |
| 70 | 3300003320 | rootH2_10020702 | rootH2_100207022 | 163 |
| 71 | 3300005366 | Ga0070659_100102567 | Ga0070659_1001025672 | 163 |
| 72 | 3300006846 | Ga0075430_100114689 | Ga0075430_1001146892 | 163 |
| 73 | 3300006880 | Ga0075429_100129999 | Ga0075429_1001299992 | 163 |
| 74 | 3300021361 | Ga0213872_10000219 | Ga0213872_1000021933 | 163 |
| 75 | 3300021361 | Ga0213872_10284374 | Ga0213872_102843741 | 163 |
| 76 | 3300025960 | Ga0207651_10000982 | Ga0207651_100009824 | 163 |
| 77 | 3300026142 | Ga0207698_11576741 | Ga0207698_115767411 | 163 |
| 78 | 3300031911 | Ga0307412_10336348 | Ga0307412_103363482 | 163 |
| 79 | 3300032002 | Ga0307416_100022472 | Ga0307416_1000224724 | 163 |
| 80 | 3300035692 | Ga0373935_0581205 | Ga0373935_0581205_112_711 | 163 |
| 81 | 3300035695 | Ga0373927_0007707 | Ga0373927_0007707_5136_5735 | 163 |
| 82 | 3300039447 | Ga0436361_0264437 | Ga0436361_0264437_43494_44036 | 163 |
| 83 | 3300039447 | Ga0436361_1029632 | Ga0436361_1029632_6604_7152 | 163 |
| 84 | 3300049526 | Ga0501303_001646 | Ga0501303_001646_814_1341 | 163 |
| 85 | 3300049653 | Ga0501206_024451 | Ga0501206_024451_316_843 | 163 |
| 86 | 3300049708 | Ga0501245_031209 | Ga0501245_031209_248_775 | 163 |
| 87 | 3300049762 | Ga0501265_002387 | Ga0501265_002387_1419_1946 | 163 |
| 88 | 3300050508 | nmdc:mga09592_220626_c1 | nmdc:mga09592_220626_c1_303_863 | 163 |
| 89 | 3300050509 | nmdc:mga0qj67_282262_c1 | nmdc:mga0qj67_282262_c1_274_834 | 163 |
| 90 | 3300005334 | Ga0068869_100110461 | Ga0068869_1001104612 | 164 |
| 91 | 3300005356 | Ga0070674_100048225 | Ga0070674_1000482251 | 164 |
| 92 | 3300005459 | Ga0068867_100004831 | Ga0068867_10000483111 | 164 |
| 93 | 3300005539 | Ga0068853_100582169 | Ga0068853_1005821692 | 164 |
| 94 | 3300005617 | Ga0068859_100245015 | Ga0068859_1002450152 | 164 |
| 95 | 3300005844 | Ga0068862_100038190 | Ga0068862_1000381903 | 164 |
| 96 | 3300006195 | Ga0075366_10034758 | Ga0075366_100347582 | 164 |
| 97 | 3300006195 | Ga0075366_10525754 | Ga0075366_105257541 | 164 |
| 98 | 3300006353 | Ga0075370_10052585 | Ga0075370_100525852 | 164 |
| 99 | 3300006881 | Ga0068865_100006375 | Ga0068865_1000063758 | 164 |
| 100 | 3300006931 | Ga0097620_100245005 | Ga0097620_1002450052 | 164 |
| 101 | 3300013306 | Ga0163162_10004897 | Ga0163162_100048972 | 164 |
| 102 | 3300014326 | Ga0157380_10117420 | Ga0157380_101174202 | 164 |
| 103 | 3300014968 | Ga0157379_10013046 | Ga0157379_100130462 | 164 |
| 104 | 3300014968 | Ga0157379_10263498 | Ga0157379_102634982 | 164 |
| 105 | 3300014969 | Ga0157376_10818040 | Ga0157376_108180402 | 164 |
| 106 | 3300017792 | Ga0163161_10188798 | Ga0163161_101887982 | 164 |
| 107 | 3300025910 | Ga0207684_10976875 | Ga0207684_109768751 | 164 |
| 108 | 3300025938 | Ga0207704_10006505 | Ga0207704_100065055 | 164 |
| 109 | 3300025940 | Ga0207691_10036588 | Ga0207691_100365882 | 164 |
| 110 | 3300025961 | Ga0207712_10101436 | Ga0207712_101014362 | 164 |
| 111 | 3300026035 | Ga0207703_10712501 | Ga0207703_107125012 | 164 |
| 112 | 3300026089 | Ga0207648_10004810 | Ga0207648_1000481017 | 164 |
| 113 | 3300028380 | Ga0268265_10030975 | Ga0268265_100309754 | 164 |
| 114 | 3300028381 | Ga0268264_10002041 | Ga0268264_1000204118 | 164 |
| 115 | 3300031548 | Ga0307408_100716071 | Ga0307408_1007160712 | 164 |
| 116 | 3300044712 | Ga0453684_0064742 | Ga0453684_0064742_3600_4160 | 164 |
| 117 | 3300050493 | nmdc:mga0k408_608919_c1 | nmdc:mga0k408_608919_c1_80_616 | 164 |
| 118 | iso_pu_bacteria | 2585428057 | 2587730714 | 164 |
| 119 | iso_pu_bacteria | 2643221654 | 2644305597 | 164 |
| 120 | 3300005456 | Ga0070678_100122683 | Ga0070678_1001226832 | 165 |
| 121 | 3300005548 | Ga0070665_100608374 | Ga0070665_1006083742 | 165 |
| 122 | 3300005616 | Ga0068852_100694675 | Ga0068852_1006946751 | 165 |
| 123 | 3300009093 | Ga0105240_10034475 | Ga0105240_100344754 | 165 |
| 124 | 3300009545 | Ga0105237_10005880 | Ga0105237_100058803 | 165 |
| 125 | 3300009551 | Ga0105238_10010462 | Ga0105238_100104622 | 165 |
| 126 | 3300010375 | Ga0105239_10067265 | Ga0105239_100672652 | 165 |
| 127 | 3300025913 | Ga0207695_10019455 | Ga0207695_100194554 | 165 |
| 128 | 3300025914 | Ga0207671_10017873 | Ga0207671_100178732 | 165 |
| 129 | 3300025924 | Ga0207694_10003197 | Ga0207694_100031973 | 165 |
| 130 | 3300026041 | Ga0207639_10650509 | Ga0207639_106505091 | 165 |
| 131 | 3300026142 | Ga0207698_10610224 | Ga0207698_106102241 | 165 |
| 132 | 3300031616 | Ga0307508_10000150 | Ga0307508_1000015076 | 165 |
| 133 | 3300033179 | Ga0307507_10276280 | Ga0307507_102762802 | 165 |
| 134 | 3300033180 | Ga0307510_10244882 | Ga0307510_102448822 | 165 |
| 135 | 3300037471 | Ga0395905_0004485 | Ga0395905_0004485_897_1499 | 165 |
| 136 | 3300039447 | Ga0436361_0813098 | Ga0436361_0813098_81163_81723 | 165 |
| 137 | 3300044712 | Ga0453684_0269217 | Ga0453684_0269217_791_1330 | 165 |
| 138 | 3300050493 | nmdc:mga0k408_37611_c1 | nmdc:mga0k408_37611_c1_17_571 | 165 |
| 139 | iso_pu_bacteria | 2588253510 | 2588294897 | 165 |
| 140 | 3300005719 | Ga0068861_101459382 | Ga0068861_1014593821 | 166 |
| 141 | 3300005843 | Ga0068860_100045649 | Ga0068860_1000456494 | 166 |
| 142 | 3300028381 | Ga0268264_10260372 | Ga0268264_102603722 | 166 |
| 143 | 3300041458 | Ga0451798_0274987 | Ga0451798_0274987_135_725 | 166 |
| 144 | 3300042876 | Ga0451577_0089335 | Ga0451577_0089335_1498_2076 | 166 |
| 145 | 3300044712 | Ga0453684_0801738 | Ga0453684_0801738_305_883 | 166 |
| 146 | 3300045051 | Ga0451576_0050879 | Ga0451576_0050879_2386_2964 | 166 |
| 147 | 3300049822 | Ga0501035_0093746 | Ga0501035_0093746_1737_2279 | 166 |
| 148 | 3300005367 | Ga0070667_100018817 | Ga0070667_1000188172 | 167 |
| 149 | 3300005455 | Ga0070663_100004945 | Ga0070663_1000049455 | 167 |
| 150 | 3300005459 | Ga0068867_100000439 | Ga0068867_1000004396 | 167 |
| 151 | 3300005563 | Ga0068855_100594642 | Ga0068855_1005946422 | 167 |
| 152 | 3300005937 | Ga0081455_10192841 | Ga0081455_101928412 | 167 |
| 153 | 3300006881 | Ga0068865_100224577 | Ga0068865_1002245771 | 167 |
| 154 | 3300009148 | Ga0105243_10000562 | Ga0105243_1000056218 | 167 |
| 155 | 3300013100 | Ga0157373_10734771 | Ga0157373_107347711 | 167 |
| 156 | 3300013308 | Ga0157375_10152003 | Ga0157375_101520032 | 167 |
| 157 | 3300014745 | Ga0157377_10000160 | Ga0157377_1000016023 | 167 |
| 158 | 3300014968 | Ga0157379_10076813 | Ga0157379_100768132 | 167 |
| 159 | 3300025935 | Ga0207709_10002023 | Ga0207709_100020234 | 167 |
| 160 | 3300025949 | Ga0207667_10358662 | Ga0207667_103586622 | 167 |
| 161 | 3300025986 | Ga0207658_10000533 | Ga0207658_100005335 | 167 |
| 162 | 3300025986 | Ga0207658_10596696 | Ga0207658_105966962 | 167 |
| 163 | 3300026067 | Ga0207678_10002475 | Ga0207678_100024752 | 167 |
| 164 | 3300026089 | Ga0207648_10000574 | Ga0207648_1000057420 | 167 |
| 165 | 3300027395 | Ga0209996_1001297 | Ga0209996_10012972 | 167 |
| 166 | 3300027471 | Ga0209995_1000208 | Ga0209995_10002084 | 167 |
| 167 | 3300027695 | Ga0209966_1000046 | Ga0209966_100004633 | 167 |
| 168 | 3300028379 | Ga0268266_10053942 | Ga0268266_100539422 | 167 |
| 169 | 3300037068 | Ga0373925_0175771 | Ga0373925_0175771_713_1273 | 167 |
| 170 | 3300037471 | Ga0395905_0036167 | Ga0395905_0036167_3980_4519 | 167 |
| 171 | 3300037471 | Ga0395905_0059846 | Ga0395905_0059846_957_1499 | 167 |
| 172 | 3300042132 | Ga0450895_020713 | Ga0450895_020713_34_588 | 167 |
| 173 | 3300042185 | Ga0450909_032635 | Ga0450909_032635_199_759 | 167 |
| 174 | 3300046475 | Ga0495639_0381097 | Ga0495639_0381097_38_622 | 167 |
| 175 | 3300046517 | Ga0495630_0171136 | Ga0495630_0171136_221_805 | 167 |
| 176 | 3300046526 | Ga0495666_0078310 | Ga0495666_0078310_658_1242 | 167 |
| 177 | 3300046690 | Ga0495624_0044128 | Ga0495624_0044128_1060_1644 | 167 |
| 178 | 3300047321 | Ga0495676_0055352 | Ga0495676_0055352_1691_2275 | 167 |
| 179 | 3300047673 | Ga0495593_0133286 | Ga0495593_0133286_55_639 | 167 |
| 180 | 3300048909 | Ga0496106_0163454 | Ga0496106_0163454_882_1442 | 167 |
| 181 | 3300048916 | Ga0496113_0448783 | Ga0496113_0448783_49_609 | 167 |
| 182 | 3300049653 | Ga0501206_027179 | Ga0501206_027179_248_787 | 167 |
| 183 | 3300049763 | Ga0501266_014677 | Ga0501266_014677_216_755 | 167 |
| 184 | 3300053086 | Ga0500578_0139065 | Ga0500578_0139065_239_799 | 167 |
| 185 | 3300053730 | Ga0500645_024283 | Ga0500645_024283_568_1128 | 167 |
| 186 | 3300005467 | Ga0070706_100040369 | Ga0070706_1000403692 | 168 |
| 187 | 3300005564 | Ga0070664_101182758 | Ga0070664_1011827581 | 168 |
| 188 | 3300009101 | Ga0105247_10427240 | Ga0105247_104272401 | 168 |
| 189 | 3300009553 | Ga0105249_11199012 | Ga0105249_111990121 | 168 |
| 190 | 3300013306 | Ga0163162_10731170 | Ga0163162_107311702 | 168 |
| 191 | 3300014326 | Ga0157380_10698502 | Ga0157380_106985022 | 168 |
| 192 | 3300025907 | Ga0207645_10663452 | Ga0207645_106634521 | 168 |
| 193 | 3300025910 | Ga0207684_10169008 | Ga0207684_101690082 | 168 |
| 194 | 3300028794 | Ga0307515_10000013 | Ga0307515_100000132 | 168 |
| 195 | 3300028794 | Ga0307515_10000037 | Ga0307515_10000037280 | 168 |
| 196 | 3300028794 | Ga0307515_10037587 | Ga0307515_100375879 | 168 |
| 197 | 3300031730 | Ga0307516_10000164 | Ga0307516_1000016433 | 168 |
| 198 | 3300031730 | Ga0307516_10091116 | Ga0307516_100911165 | 168 |
| 199 | 3300031911 | Ga0307412_10004357 | Ga0307412_100043573 | 168 |
| 200 | 3300031911 | Ga0307412_11062602 | Ga0307412_110626021 | 168 |
| 201 | 3300037471 | Ga0395905_0162470 | Ga0395905_0162470_989_1531 | 168 |
| 202 | 3300042007 | Ga0439449_0010624 | Ga0439449_0010624_2161_2703 | 168 |
| 203 | 3300042012 | Ga0439455_0042469 | Ga0439455_0042469_265_807 | 168 |
| 204 | 3300042134 | Ga0450898_032783 | Ga0450898_032783_39_581 | 168 |
| 205 | 3300042435 | Ga0439434_0168139 | Ga0439434_0168139_138_680 | 168 |
| 206 | 3300042439 | Ga0439464_0071330 | Ga0439464_0071330_263_820 | 168 |
| 207 | 3300042876 | Ga0451577_0919678 | Ga0451577_0919678_60_608 | 168 |
| 208 | 3300044683 | Ga0466965_0172534 | Ga0466965_0172534_384_926 | 168 |
| 209 | 3300044693 | Ga0466961_0028716 | Ga0466961_0028716_2281_2823 | 168 |
| 210 | 3300044706 | Ga0466964_0163256 | Ga0466964_0163256_308_850 | 168 |
| 211 | 3300044712 | Ga0453684_0081723 | Ga0453684_0081723_2350_2940 | 168 |
| 212 | 3300045051 | Ga0451576_0020395 | Ga0451576_0020395_3704_4294 | 168 |
| 213 | 3300045836 | Ga0466958_0055320 | Ga0466958_0055320_334_876 | 168 |
| 214 | 3300046475 | Ga0495639_0140918 | Ga0495639_0140918_350_916 | 168 |
| 215 | 3300048905 | Ga0496102_0003913 | Ga0496102_0003913_8183_8749 | 168 |
| 216 | 3300050509 | nmdc:mga0qj67_281725_c1 | nmdc:mga0qj67_281725_c1_48_605 | 168 |
| 217 | iso_pu_bacteria | 2585428058 | 2587736987 | 168 |
| 218 | iso_pu_bacteria | 2585428062 | 2587758086 | 168 |
| 219 | iso_pu_bacteria | 2643221592 | 2643967747 | 168 |
| 220 | iso_pu_bacteria | 2643221625 | 2644140569 | 168 |
| 221 | iso_pu_bacteria | 2643221648 | 2644273536 | 168 |
| 222 | 3300005330 | Ga0070690_100001384 | Ga0070690_10000138411 | 169 |
| 223 | 3300005353 | Ga0070669_100056439 | Ga0070669_1000564392 | 169 |
| 224 | 3300005364 | Ga0070673_100660681 | Ga0070673_1006606811 | 169 |
| 225 | 3300005367 | Ga0070667_100279892 | Ga0070667_1002798921 | 169 |
| 226 | 3300005445 | Ga0070708_100073412 | Ga0070708_1000734122 | 169 |
| 227 | 3300005459 | Ga0068867_100574282 | Ga0068867_1005742821 | 169 |
| 228 | 3300005543 | Ga0070672_100136539 | Ga0070672_1001365393 | 169 |
| 229 | 3300006178 | Ga0075367_10117792 | Ga0075367_101177922 | 169 |
| 230 | 3300006195 | Ga0075366_10029464 | Ga0075366_100294642 | 169 |
| 231 | 3300009094 | Ga0111539_12217070 | Ga0111539_122170701 | 169 |
| 232 | 3300009147 | Ga0114129_10886992 | Ga0114129_108869922 | 169 |
| 233 | 3300009148 | Ga0105243_10238029 | Ga0105243_102380292 | 169 |
| 234 | 3300009545 | Ga0105237_11180532 | Ga0105237_111805321 | 169 |
| 235 | 3300009553 | Ga0105249_10574562 | Ga0105249_105745622 | 169 |
| 236 | 3300013297 | Ga0157378_10048638 | Ga0157378_100486382 | 169 |
| 237 | 3300014325 | Ga0163163_10311560 | Ga0163163_103115602 | 169 |
| 238 | 3300014968 | Ga0157379_10921037 | Ga0157379_109210371 | 169 |
| 239 | 3300025253 | Ga0209677_101817 | Ga0209677_10181710 | 169 |
| 240 | 3300025893 | Ga0207682_10076560 | Ga0207682_100765602 | 169 |
| 241 | 3300025923 | Ga0207681_10163776 | Ga0207681_101637762 | 169 |
| 242 | 3300025935 | Ga0207709_10509075 | Ga0207709_105090751 | 169 |
| 243 | 3300025937 | Ga0207669_10330611 | Ga0207669_103306111 | 169 |
| 244 | 3300025941 | Ga0207711_10919367 | Ga0207711_109193671 | 169 |
| 245 | 3300025942 | Ga0207689_10020983 | Ga0207689_100209834 | 169 |
| 246 | 3300025960 | Ga0207651_10353571 | Ga0207651_103535712 | 169 |
| 247 | 3300026089 | Ga0207648_10276104 | Ga0207648_102761042 | 169 |
| 248 | 3300026121 | Ga0207683_10110942 | Ga0207683_101109423 | 169 |
| 249 | 3300028786 | Ga0307517_10000394 | Ga0307517_1000039432 | 169 |
| 250 | 3300028786 | Ga0307517_10113786 | Ga0307517_101137862 | 169 |
| 251 | 3300028786 | Ga0307517_10140602 | Ga0307517_101406022 | 169 |
| 252 | 3300028794 | Ga0307515_10121955 | Ga0307515_101219553 | 169 |
| 253 | 3300028794 | Ga0307515_10274273 | Ga0307515_102742732 | 169 |
| 254 | 3300031507 | Ga0307509_10023601 | Ga0307509_100236013 | 169 |
| 255 | 3300031616 | Ga0307508_10000912 | Ga0307508_1000091229 | 169 |
| 256 | 3300031730 | Ga0307516_10137194 | Ga0307516_101371941 | 169 |
| 257 | 3300031824 | Ga0307413_10039868 | Ga0307413_100398683 | 169 |
| 258 | 3300031903 | Ga0307407_10248570 | Ga0307407_102485702 | 169 |
| 259 | 3300033180 | Ga0307510_10208656 | Ga0307510_102086562 | 169 |
| 260 | 3300039447 | Ga0436361_0231366 | Ga0436361_0231366_2178_2720 | 169 |
| 261 | 3300044658 | Ga0466972_0006140 | Ga0466972_0006140_432_1007 | 169 |
| 262 | 3300044842 | Ga0466957_0307821 | Ga0466957_0307821_300_875 | 169 |
| 263 | 3300046492 | Ga0495585_0268530 | Ga0495585_0268530_277_834 | 169 |
| 264 | 3300046539 | Ga0495621_0077078 | Ga0495621_0077078_313_885 | 169 |
| 265 | 3300046660 | Ga0495625_0029142 | Ga0495625_0029142_1439_2029 | 169 |
| 266 | 3300046794 | Ga0495589_0012863 | Ga0495589_0012863_2511_3086 | 169 |
| 267 | 3300049578 | Ga0501042_0126781 | Ga0501042_0126781_1233_1787 | 169 |
| 268 | 3300049579 | Ga0501043_0000012 | Ga0501043_0000012_172368_172922 | 169 |
| 269 | 3300049580 | Ga0501046_0000030 | Ga0501046_0000030_172340_172894 | 169 |
| 270 | 3300049581 | Ga0501047_0000049 | Ga0501047_0000049_147037_147591 | 169 |
| 271 | 3300049582 | Ga0501048_0001813 | Ga0501048_0001813_14562_15116 | 169 |
| 272 | 3300049823 | Ga0501044_0211044 | Ga0501044_0211044_656_1210 | 169 |
| 273 | 3300049824 | Ga0501045_0002489 | Ga0501045_0002489_132_686 | 169 |
| 274 | 3300050493 | nmdc:mga0k408_77192_c1 | nmdc:mga0k408_77192_c1_233_793 | 169 |
| 275 | 3300050494 | nmdc:mga06z11_91460_c1 | nmdc:mga06z11_91460_c1_564_1124 | 169 |
| 276 | 3300050507 | nmdc:mga05p37_278107_c1 | nmdc:mga05p37_278107_c1_632_1192 | 169 |
| 277 | 3300053098 | Ga0500650_0019913 | Ga0500650_0019913_517_1107 | 169 |
| 278 | 3300053139 | Ga0500568_0059275 | Ga0500568_0059275_264_836 | 169 |
| 279 | 3300002773 | JGI25152J39213_1011981 | JGI25152J39213_10119812 | 170 |
| 280 | 3300003215 | JGI25153J46596_10000416 | JGI25153J46596_1000041620 | 170 |
| 281 | 3300003215 | JGI25153J46596_10009702 | JGI25153J46596_100097022 | 170 |
| 282 | 3300003322 | rootL2_10006362 | rootL2_100063622 | 170 |
| 283 | 3300005364 | Ga0070673_100867174 | Ga0070673_1008671741 | 170 |
| 284 | 3300005468 | Ga0070707_100019837 | Ga0070707_1000198372 | 170 |
| 285 | 3300005471 | Ga0070698_100137461 | Ga0070698_1001374612 | 170 |
| 286 | 3300005843 | Ga0068860_100732141 | Ga0068860_1007321412 | 170 |
| 287 | 3300005844 | Ga0068862_100029865 | Ga0068862_1000298656 | 170 |
| 288 | 3300006178 | Ga0075367_10138155 | Ga0075367_101381552 | 170 |
| 289 | 3300006195 | Ga0075366_10049715 | Ga0075366_100497154 | 170 |
| 290 | 3300009553 | Ga0105249_11198510 | Ga0105249_111985101 | 170 |
| 291 | 3300010375 | Ga0105239_12086160 | Ga0105239_120861601 | 170 |
| 292 | 3300025245 | Ga0207425_1004340 | Ga0207425_10043402 | 170 |
| 293 | 3300025258 | Ga0209129_1000113 | Ga0209129_1000113103 | 170 |
| 294 | 3300025273 | Ga0209673_1011242 | Ga0209673_10112422 | 170 |
| 295 | 3300025295 | Ga0209564_1000186 | Ga0209564_1000186103 | 170 |
| 296 | 3300025297 | Ga0209758_1000172 | Ga0209758_1000172103 | 170 |
| 297 | 3300025297 | Ga0209758_1000304 | Ga0209758_100030441 | 170 |
| 298 | 3300025299 | Ga0209256_1083914 | Ga0209256_10839141 | 170 |
| 299 | 3300025910 | Ga0207684_10017578 | Ga0207684_100175782 | 170 |
| 300 | 3300025922 | Ga0207646_10624381 | Ga0207646_106243811 | 170 |
| 301 | 3300025923 | Ga0207681_10360200 | Ga0207681_103602001 | 170 |
| 302 | 3300025961 | Ga0207712_10603064 | Ga0207712_106030641 | 170 |
| 303 | 3300028380 | Ga0268265_10166411 | Ga0268265_101664112 | 170 |
| 304 | 3300028381 | Ga0268264_10932075 | Ga0268264_109320752 | 170 |
| 305 | 3300031730 | Ga0307516_10084315 | Ga0307516_100843152 | 170 |
| 306 | 3300037418 | Ga0395900_0000904 | Ga0395900_0000904_3993_4550 | 170 |
| 307 | 3300037466 | Ga0395898_0001196 | Ga0395898_0001196_34666_35223 | 170 |
| 308 | 3300044656 | Ga0466969_0033076 | Ga0466969_0033076_2026_2583 | 170 |
| 309 | 3300044683 | Ga0466965_0015474 | Ga0466965_0015474_2633_3190 | 170 |
| 310 | 3300044684 | Ga0466966_0027536 | Ga0466966_0027536_2170_2727 | 170 |
| 311 | 3300044693 | Ga0466961_0253405 | Ga0466961_0253405_177_734 | 170 |
| 312 | 3300044694 | Ga0466963_0029617 | Ga0466963_0029617_485_1042 | 170 |
| 313 | 3300044706 | Ga0466964_0022033 | Ga0466964_0022033_1360_1917 | 170 |
| 314 | 3300044765 | Ga0466970_0020049 | Ga0466970_0020049_2369_2926 | 170 |
| 315 | 3300044842 | Ga0466957_0164007 | Ga0466957_0164007_835_1392 | 170 |
| 316 | 3300045049 | Ga0466959_0000916 | Ga0466959_0000916_12528_13085 | 170 |
| 317 | 3300045836 | Ga0466958_0144732 | Ga0466958_0144732_436_993 | 170 |
| 318 | 3300045976 | Ga0466967_0080814 | Ga0466967_0080814_38_595 | 170 |
| 319 | 3300050493 | nmdc:mga0k408_119275_c1 | nmdc:mga0k408_119275_c1_97_666 | 170 |
| 320 | 3300050493 | nmdc:mga0k408_125778_c1 | nmdc:mga0k408_125778_c1_800_1369 | 170 |
| 321 | 3300050494 | nmdc:mga06z11_67809_c1 | nmdc:mga06z11_67809_c1_415_984 | 170 |
| 322 | 3300061719 | Ga0466962_0158800 | Ga0466962_0158800_406_963 | 170 |
| 323 | iso_pu_bacteria | 2643221660 | 2644339185 | 170 |
| 324 | 3300005262 | Ga0065165_1003834 | Ga0065165_10038342 | 171 |
| 325 | 3300005328 | Ga0070676_10232881 | Ga0070676_102328812 | 171 |
| 326 | 3300005328 | Ga0070676_10453022 | Ga0070676_104530221 | 171 |
| 327 | 3300005355 | Ga0070671_100381437 | Ga0070671_1003814372 | 171 |
| 328 | 3300005364 | Ga0070673_100506425 | Ga0070673_1005064251 | 171 |
| 329 | 3300005457 | Ga0070662_100286379 | Ga0070662_1002863792 | 171 |
| 330 | 3300005539 | Ga0068853_100033051 | Ga0068853_1000330514 | 171 |
| 331 | 3300005577 | Ga0068857_100015412 | Ga0068857_1000154125 | 171 |
| 332 | 3300005578 | Ga0068854_100080311 | Ga0068854_1000803112 | 171 |
| 333 | 3300005616 | Ga0068852_100111343 | Ga0068852_1001113431 | 171 |
| 334 | 3300006048 | Ga0075363_100021255 | Ga0075363_1000212554 | 171 |
| 335 | 3300006051 | Ga0075364_10035455 | Ga0075364_100354553 | 171 |
| 336 | 3300006177 | Ga0075362_10025128 | Ga0075362_100251282 | 171 |
| 337 | 3300006177 | Ga0075362_10026634 | Ga0075362_100266342 | 171 |
| 338 | 3300006178 | Ga0075367_10056484 | Ga0075367_100564842 | 171 |
| 339 | 3300006178 | Ga0075367_10105072 | Ga0075367_101050722 | 171 |
| 340 | 3300006178 | Ga0075367_10349311 | Ga0075367_103493111 | 171 |
| 341 | 3300006195 | Ga0075366_10046639 | Ga0075366_100466393 | 171 |
| 342 | 3300006195 | Ga0075366_10083402 | Ga0075366_100834022 | 171 |
| 343 | 3300006195 | Ga0075366_10092684 | Ga0075366_100926842 | 171 |
| 344 | 3300006353 | Ga0075370_10002677 | Ga0075370_100026772 | 171 |
| 345 | 3300006353 | Ga0075370_10004667 | Ga0075370_100046672 | 171 |
| 346 | 3300006353 | Ga0075370_10109744 | Ga0075370_101097442 | 171 |
| 347 | 3300006353 | Ga0075370_10298737 | Ga0075370_102987371 | 171 |
| 348 | 3300006881 | Ga0068865_100672638 | Ga0068865_1006726382 | 171 |
| 349 | 3300009093 | Ga0105240_10034252 | Ga0105240_100342522 | 171 |
| 350 | 3300009098 | Ga0105245_10230852 | Ga0105245_102308522 | 171 |
| 351 | 3300009148 | Ga0105243_10143730 | Ga0105243_101437302 | 171 |
| 352 | 3300009148 | Ga0105243_10633497 | Ga0105243_106334972 | 171 |
| 353 | 3300009174 | Ga0105241_10278483 | Ga0105241_102784832 | 171 |
| 354 | 3300009545 | Ga0105237_10004426 | Ga0105237_100044265 | 171 |
| 355 | 3300009551 | Ga0105238_10488470 | Ga0105238_104884702 | 171 |
| 356 | 3300009553 | Ga0105249_10547905 | Ga0105249_105479052 | 171 |
| 357 | 3300010375 | Ga0105239_10063541 | Ga0105239_100635412 | 171 |
| 358 | 3300013308 | Ga0157375_10290287 | Ga0157375_102902873 | 171 |
| 359 | 3300025298 | Ga0209050_1000489 | Ga0209050_100048942 | 171 |
| 360 | 3300025303 | Ga0209051_1012113 | Ga0209051_10121133 | 171 |
| 361 | 3300025903 | Ga0207680_10236408 | Ga0207680_102364081 | 171 |
| 362 | 3300025907 | Ga0207645_10192359 | Ga0207645_101923592 | 171 |
| 363 | 3300025913 | Ga0207695_10031958 | Ga0207695_100319582 | 171 |
| 364 | 3300025914 | Ga0207671_10024660 | Ga0207671_100246602 | 171 |
| 365 | 3300025931 | Ga0207644_10807861 | Ga0207644_108078611 | 171 |
| 366 | 3300025933 | Ga0207706_10146367 | Ga0207706_101463672 | 171 |
| 367 | 3300025933 | Ga0207706_10509119 | Ga0207706_105091192 | 171 |
| 368 | 3300025934 | Ga0207686_10369294 | Ga0207686_103692942 | 171 |
| 369 | 3300025935 | Ga0207709_10046945 | Ga0207709_100469452 | 171 |
| 370 | 3300025935 | Ga0207709_10351273 | Ga0207709_103512731 | 171 |
| 371 | 3300025938 | Ga0207704_10428517 | Ga0207704_104285171 | 171 |
| 372 | 3300025942 | Ga0207689_10033149 | Ga0207689_100331492 | 171 |
| 373 | 3300025960 | Ga0207651_10799199 | Ga0207651_107991991 | 171 |
| 374 | 3300025961 | Ga0207712_11281557 | Ga0207712_112815571 | 171 |
| 375 | 3300025981 | Ga0207640_10051812 | Ga0207640_100518124 | 171 |
| 376 | 3300026041 | Ga0207639_10027284 | Ga0207639_100272842 | 171 |
| 377 | 3300026067 | Ga0207678_10060519 | Ga0207678_100605194 | 171 |
| 378 | 3300026116 | Ga0207674_10018439 | Ga0207674_100184392 | 171 |
| 379 | 3300026142 | Ga0207698_10200976 | Ga0207698_102009761 | 171 |
| 380 | 3300031456 | Ga0307513_10106404 | Ga0307513_101064043 | 171 |
| 381 | 3300031616 | Ga0307508_10175321 | Ga0307508_101753212 | 171 |
| 382 | 3300031649 | Ga0307514_10067190 | Ga0307514_100671902 | 171 |
| 383 | 3300031730 | Ga0307516_10004805 | Ga0307516_100048054 | 171 |
| 384 | 3300031730 | Ga0307516_10229868 | Ga0307516_102298682 | 171 |
| 385 | 3300041443 | Ga0451789_0291111 | Ga0451789_0291111_1501_2067 | 171 |
| 386 | 3300041456 | Ga0451795_1056889 | Ga0451795_1056889_490_1053 | 171 |
| 387 | 3300041463 | Ga0451804_0431348 | Ga0451804_0431348_1602_2168 | 171 |
| 388 | 3300041512 | Ga0451853_2456265 | Ga0451853_2456265_105_659 | 171 |
| 389 | 3300041512 | Ga0451853_3681233 | Ga0451853_3681233_186_752 | 171 |
| 390 | 3300042134 | Ga0450898_072705 | Ga0450898_072705_41_613 | 171 |
| 391 | 3300042532 | Ga0450893_0023100 | Ga0450893_0023100_446_1018 | 171 |
| 392 | 3300046460 | Ga0495638_0028172 | Ga0495638_0028172_2761_3327 | 171 |
| 393 | 3300046515 | Ga0495620_0052156 | Ga0495620_0052156_278_844 | 171 |
| 394 | 3300046519 | Ga0495632_0037421 | Ga0495632_0037421_1148_1708 | 171 |
| 395 | 3300046522 | Ga0495643_0103084 | Ga0495643_0103084_385_942 | 171 |
| 396 | 3300046538 | Ga0495609_0117909 | Ga0495609_0117909_547_1107 | 171 |
| 397 | 3300046692 | Ga0495671_0180060 | Ga0495671_0180060_428_988 | 171 |
| 398 | 3300046694 | Ga0495649_0012421 | Ga0495649_0012421_2705_3265 | 171 |
| 399 | 3300046810 | Ga0495660_0037246 | Ga0495660_0037246_1088_1648 | 171 |
| 400 | 3300047443 | Ga0495687_000414 | Ga0495687_000414_22510_23067 | 171 |
| 401 | 3300047443 | Ga0495687_019317 | Ga0495687_019317_1343_1903 | 171 |
| 402 | 3300047443 | Ga0495687_035617 | Ga0495687_035617_230_790 | 171 |
| 403 | 3300048091 | Ga0495626_0005858 | Ga0495626_0005858_309_869 | 171 |
| 404 | 3300050489 | nmdc:mga03683_41714_c1 | nmdc:mga03683_41714_c1_1283_1843 | 171 |
| 405 | 3300050491 | nmdc:mga00v17_148194_c1 | nmdc:mga00v17_148194_c1_396_953 | 171 |
| 406 | 3300050492 | nmdc:mga0yw44_253628_c1 | nmdc:mga0yw44_253628_c1_529_1086 | 171 |
| 407 | 3300050493 | nmdc:mga0k408_16837_c1 | nmdc:mga0k408_16837_c1_2375_2932 | 171 |
| 408 | 3300050493 | nmdc:mga0k408_29814_c1 | nmdc:mga0k408_29814_c1_1415_1972 | 171 |
| 409 | 3300050493 | nmdc:mga0k408_3343_c1 | nmdc:mga0k408_3343_c1_6212_6772 | 171 |
| 410 | 3300050493 | nmdc:mga0k408_340706_c1 | nmdc:mga0k408_340706_c1_297_857 | 171 |
| 411 | 3300050493 | nmdc:mga0k408_36271_c1 | nmdc:mga0k408_36271_c1_172_729 | 171 |
| 412 | 3300050493 | nmdc:mga0k408_37149_c1 | nmdc:mga0k408_37149_c1_1292_1852 | 171 |
| 413 | 3300050494 | nmdc:mga06z11_43224_c1 | nmdc:mga06z11_43224_c1_589_1146 | 171 |
| 414 | 3300050496 | nmdc:mga07m45_3787_c1 | nmdc:mga07m45_3787_c1_6539_7099 | 171 |
| 415 | 3300050496 | nmdc:mga07m45_4440_c1 | nmdc:mga07m45_4440_c1_3385_3945 | 171 |
| 416 | 3300050496 | nmdc:mga07m45_5674_c1 | nmdc:mga07m45_5674_c1_5424_5981 | 171 |
| 417 | 3300050516 | nmdc:mga0sz30_31376_c1 | nmdc:mga0sz30_31376_c1_1604_2164 | 171 |
| 418 | 3300053088 | Ga0500644_0020880 | Ga0500644_0020880_350_916 | 171 |
| 419 | 3300053090 | Ga0500646_0018715 | Ga0500646_0018715_479_1045 | 171 |
| 420 | 3300053098 | Ga0500650_0048253 | Ga0500650_0048253_1077_1643 | 171 |
| 421 | 3300053130 | Ga0500642_0001693 | Ga0500642_0001693_3056_3622 | 171 |
| 422 | 3300053131 | Ga0500652_002916 | Ga0500652_002916_2009_2575 | 171 |
| 423 | 3300053133 | Ga0500655_006702 | Ga0500655_006702_590_1156 | 171 |
| 424 | 3300053134 | Ga0500658_0056748 | Ga0500658_0056748_445_1005 | 171 |
| 425 | 3300053139 | Ga0500568_0027685 | Ga0500568_0027685_1333_1893 | 171 |
| 426 | 3300053151 | Ga0500604_0001619 | Ga0500604_0001619_233_805 | 171 |
| 427 | 3300053151 | Ga0500604_0044930 | Ga0500604_0044930_258_824 | 171 |
| 428 | 3300053156 | Ga0500622_0000146 | Ga0500622_0000146_43740_44306 | 171 |
| 429 | 3300055283 | Ga0500661_046177 | Ga0500661_046177_94_675 | 171 |
| 430 | 3300061719 | Ga0466962_0344010 | Ga0466962_0344010_19_639 | 171 |
| 431 | iso_pu_bacteria | 2886848708 | 2886853429 | 171 |
| 432 | 3300025918 | Ga0207662_10211102 | Ga0207662_102111021 | 172 |
| 433 | 3300030522 | Ga0307512_10094851 | Ga0307512_100948512 | 172 |
| 434 | 3300031507 | Ga0307509_10000950 | Ga0307509_1000095018 | 172 |
| 435 | 3300031901 | Ga0307406_10067917 | Ga0307406_100679172 | 172 |
| 436 | 3300032005 | Ga0307411_11145617 | Ga0307411_111456171 | 172 |
| 437 | 3300033180 | Ga0307510_10018224 | Ga0307510_100182246 | 172 |
| 438 | 3300033180 | Ga0307510_10024351 | Ga0307510_100243512 | 172 |
| 439 | 3300035691 | Ga0373931_0107423 | Ga0373931_0107423_567_1157 | 172 |
| 440 | 3300046454 | Ga0495592_0007407 | Ga0495592_0007407_6334_6912 | 172 |
| 441 | 3300046524 | Ga0495648_0080880 | Ga0495648_0080880_396_974 | 172 |
| 442 | 3300046690 | Ga0495624_0621157 | Ga0495624_0621157_24_617 | 172 |
| 443 | 3300053136 | Ga0500559_0004161 | Ga0500559_0004161_1162_1740 | 172 |
| 444 | 3300053154 | Ga0500619_011735 | Ga0500619_011735_761_1339 | 172 |
| 445 | 3300053156 | Ga0500622_0010151 | Ga0500622_0010151_1817_2395 | 172 |
| 446 | 3300055283 | Ga0500661_037886 | Ga0500661_037886_182_760 | 172 |
| 447 | 3300003752 | Ga0055539_1000303 | Ga0055539_10003032 | 173 |
| 448 | 3300003756 | Ga0055533_1000043 | Ga0055533_1000043134 | 173 |
| 449 | 3300003759 | Ga0055525_1001652 | Ga0055525_10016523 | 173 |
| 450 | 3300005328 | Ga0070676_10003518 | Ga0070676_100035182 | 173 |
| 451 | 3300005331 | Ga0070670_100245930 | Ga0070670_1002459302 | 173 |
| 452 | 3300005338 | Ga0068868_100164969 | Ga0068868_1001649692 | 173 |
| 453 | 3300005354 | Ga0070675_100031487 | Ga0070675_1000314877 | 173 |
| 454 | 3300005355 | Ga0070671_100096575 | Ga0070671_1000965752 | 173 |
| 455 | 3300005459 | Ga0068867_100013526 | Ga0068867_1000135262 | 173 |
| 456 | 3300005564 | Ga0070664_100216756 | Ga0070664_1002167562 | 173 |
| 457 | 3300005840 | Ga0068870_10011020 | Ga0068870_100110203 | 173 |
| 458 | 3300005841 | Ga0068863_100166600 | Ga0068863_1001666003 | 173 |
| 459 | 3300006353 | Ga0075370_10030758 | Ga0075370_100307582 | 173 |
| 460 | 3300006881 | Ga0068865_100218226 | Ga0068865_1002182262 | 173 |
| 461 | 3300009177 | Ga0105248_10004608 | Ga0105248_100046082 | 173 |
| 462 | 3300014745 | Ga0157377_10603255 | Ga0157377_106032551 | 173 |
| 463 | 3300025226 | Ga0209674_100067 | Ga0209674_100067135 | 173 |
| 464 | 3300025230 | Ga0209563_100068 | Ga0209563_100068135 | 173 |
| 465 | 3300025231 | Ga0207427_100458 | Ga0207427_10045815 | 173 |
| 466 | 3300025253 | Ga0209677_100049 | Ga0209677_10004926 | 173 |
| 467 | 3300025907 | Ga0207645_10003682 | Ga0207645_1000368214 | 173 |
| 468 | 3300025908 | Ga0207643_10186592 | Ga0207643_101865922 | 173 |
| 469 | 3300025925 | Ga0207650_10112642 | Ga0207650_101126422 | 173 |
| 470 | 3300025926 | Ga0207659_10108646 | Ga0207659_101086462 | 173 |
| 471 | 3300025931 | Ga0207644_10050850 | Ga0207644_100508502 | 173 |
| 472 | 3300025931 | Ga0207644_10375023 | Ga0207644_103750232 | 173 |
| 473 | 3300025933 | Ga0207706_10135113 | Ga0207706_101351132 | 173 |
| 474 | 3300025938 | Ga0207704_10158481 | Ga0207704_101584812 | 173 |
| 475 | 3300025941 | Ga0207711_10040465 | Ga0207711_100404652 | 173 |
| 476 | 3300025942 | Ga0207689_10078525 | Ga0207689_100785252 | 173 |
| 477 | 3300025981 | Ga0207640_11034052 | Ga0207640_110340521 | 173 |
| 478 | 3300026088 | Ga0207641_10149112 | Ga0207641_101491121 | 173 |
| 479 | 3300026089 | Ga0207648_10003174 | Ga0207648_1000317412 | 173 |
| 480 | 3300026116 | Ga0207674_10068767 | Ga0207674_100687672 | 173 |
| 481 | 3300046810 | Ga0495660_0155214 | Ga0495660_0155214_201_803 | 173 |
| 482 | 3300048911 | Ga0496108_0108525 | Ga0496108_0108525_1408_2013 | 173 |
| 483 | 3300048912 | Ga0496109_0233412 | Ga0496109_0233412_657_1262 | 173 |
| 484 | 3300048915 | Ga0496112_0074530 | Ga0496112_0074530_454_1059 | 173 |
| 485 | 3300048916 | Ga0496113_0190853 | Ga0496113_0190853_393_998 | 173 |
| 486 | 3300050496 | nmdc:mga07m45_284_c1 | nmdc:mga07m45_284_c1_2889_3452 | 173 |
| 487 | 3300005333 | Ga0070677_10005141 | Ga0070677_100051414 | 174 |
| 488 | 3300005333 | Ga0070677_10216629 | Ga0070677_102166291 | 174 |
| 489 | 3300005353 | Ga0070669_100041589 | Ga0070669_1000415892 | 174 |
| 490 | 3300005354 | Ga0070675_100000811 | Ga0070675_10000081121 | 174 |
| 491 | 3300005355 | Ga0070671_100029927 | Ga0070671_1000299271 | 174 |
| 492 | 3300005356 | Ga0070674_100011059 | Ga0070674_1000110592 | 174 |
| 493 | 3300005456 | Ga0070678_100032954 | Ga0070678_1000329541 | 174 |
| 494 | 3300005459 | Ga0068867_100048805 | Ga0068867_1000488053 | 174 |
| 495 | 3300005543 | Ga0070672_100003173 | Ga0070672_10000317311 | 174 |
| 496 | 3300005618 | Ga0068864_100092822 | Ga0068864_1000928222 | 174 |
| 497 | 3300005834 | Ga0068851_10388426 | Ga0068851_103884262 | 174 |
| 498 | 3300005840 | Ga0068870_10085964 | Ga0068870_100859642 | 174 |
| 499 | 3300006881 | Ga0068865_100309765 | Ga0068865_1003097652 | 174 |
| 500 | 3300017792 | Ga0163161_10161461 | Ga0163161_101614612 | 174 |
| 501 | 3300025315 | Ga0207697_10076701 | Ga0207697_100767012 | 174 |
| 502 | 3300025893 | Ga0207682_10000902 | Ga0207682_100009022 | 174 |
| 503 | 3300025893 | Ga0207682_10208450 | Ga0207682_102084501 | 174 |
| 504 | 3300025901 | Ga0207688_10227998 | Ga0207688_102279982 | 174 |
| 505 | 3300025907 | Ga0207645_10224234 | Ga0207645_102242342 | 174 |
| 506 | 3300025908 | Ga0207643_10089492 | Ga0207643_100894922 | 174 |
| 507 | 3300025923 | Ga0207681_10035054 | Ga0207681_100350542 | 174 |
| 508 | 3300025925 | Ga0207650_10000580 | Ga0207650_100005806 | 174 |
| 509 | 3300025926 | Ga0207659_10001304 | Ga0207659_100013045 | 174 |
| 510 | 3300025931 | Ga0207644_10175200 | Ga0207644_101752002 | 174 |
| 511 | 3300025937 | Ga0207669_10004641 | Ga0207669_100046418 | 174 |
| 512 | 3300025937 | Ga0207669_10041839 | Ga0207669_100418393 | 174 |
| 513 | 3300025938 | Ga0207704_10184182 | Ga0207704_101841822 | 174 |
| 514 | 3300025940 | Ga0207691_10009625 | Ga0207691_1000962511 | 174 |
| 515 | 3300025941 | Ga0207711_10809730 | Ga0207711_108097301 | 174 |
| 516 | 3300025986 | Ga0207658_10687325 | Ga0207658_106873251 | 174 |
| 517 | 3300026089 | Ga0207648_10003741 | Ga0207648_100037412 | 174 |
| 518 | 3300026095 | Ga0207676_10041455 | Ga0207676_100414552 | 174 |
| 519 | 3300026121 | Ga0207683_10051560 | Ga0207683_100515601 | 174 |
| 520 | 3300028379 | Ga0268266_10076779 | Ga0268266_100767792 | 174 |
| 521 | 3300025920 | Ga0207649_11043061 | Ga0207649_110430611 | 176 |
| 522 | 3300011119 | Ga0105246_10272765 | Ga0105246_102727652 | 177 |
| 523 | 3300003320 | rootH2_10007281 | rootH2_100072812 | 178 |
| 524 | 3300002705 | JGI25156J39149_1000063 | JGI25156J39149_100006325 | 179 |
| 525 | 3300002738 | JGI25154J39366_1000533 | JGI25154J39366_100053313 | 179 |
| 526 | 3300002741 | JGI25157J39369_1000082 | JGI25157J39369_100008248 | 179 |
| 527 | 3300005327 | Ga0070658_10309099 | Ga0070658_103090991 | 179 |
| 528 | 3300005563 | Ga0068855_100002610 | Ga0068855_1000026102 | 179 |
| 529 | 3300005563 | Ga0068855_100628480 | Ga0068855_1006284802 | 179 |
| 530 | 3300005577 | Ga0068857_100013771 | Ga0068857_1000137712 | 179 |
| 531 | 3300005578 | Ga0068854_100009344 | Ga0068854_1000093442 | 179 |
| 532 | 3300005614 | Ga0068856_100157132 | Ga0068856_1001571322 | 179 |
| 533 | 3300005616 | Ga0068852_100425956 | Ga0068852_1004259561 | 179 |
| 534 | 3300009093 | Ga0105240_10333179 | Ga0105240_103331792 | 179 |
| 535 | 3300009545 | Ga0105237_10257989 | Ga0105237_102579892 | 179 |
| 536 | 3300009551 | Ga0105238_10014149 | Ga0105238_100141496 | 179 |
| 537 | 3300010375 | Ga0105239_10029492 | Ga0105239_100294924 | 179 |
| 538 | 3300013105 | Ga0157369_10103155 | Ga0157369_101031552 | 179 |
| 539 | 3300013306 | Ga0163162_10058038 | Ga0163162_100580384 | 179 |
| 540 | 3300013307 | Ga0157372_10512941 | Ga0157372_105129412 | 179 |
| 541 | 3300025242 | Ga0209258_100459 | Ga0209258_10045935 | 179 |
| 542 | 3300025246 | Ga0209646_1000244 | Ga0209646_100024425 | 179 |
| 543 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004700 | 179 |
| 544 | 3300025253 | Ga0209677_100413 | Ga0209677_10041322 | 179 |
| 545 | 3300025256 | Ga0209759_1000003 | Ga0209759_100000325 | 179 |
| 546 | 3300025913 | Ga0207695_10233155 | Ga0207695_102331552 | 179 |
| 547 | 3300025944 | Ga0207661_10191831 | Ga0207661_101918312 | 179 |
| 548 | 3300025949 | Ga0207667_10011062 | Ga0207667_100110621 | 179 |
| 549 | 3300025981 | Ga0207640_10091037 | Ga0207640_100910371 | 179 |
| 550 | 3300026078 | Ga0207702_10000525 | Ga0207702_100005254 | 179 |
| 551 | 3300026089 | Ga0207648_10467623 | Ga0207648_104676231 | 179 |
| 552 | 3300026116 | Ga0207674_10145160 | Ga0207674_101451602 | 179 |
| 553 | 3300026121 | Ga0207683_10383060 | Ga0207683_103830602 | 179 |
| 554 | 3300026142 | Ga0207698_10284767 | Ga0207698_102847672 | 179 |
| 555 | 3300035086 | Ga0373934_0008867 | Ga0373934_0008867_2444_3094 | 179 |
| 556 | 3300053080 | Ga0500635_0000322 | Ga0500635_0000322_14246_14821 | 179 |
| 557 | 3300053136 | Ga0500559_0019920 | Ga0500559_0019920_1652_2227 | 179 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar