F463330

General Info

Members Datasets Scaffolds Average Seq Length
557 309 547 187

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0008867|Ga0373934_0008867_2444_3094
Length 216
Sequence MCLLYACPDAAHEQQYCCDIHIGEPVLPRSEKPGKANARAGAPAAEREPEERGARDAGGLDRYDIALLSELQRDARQSNADLAGRIGLSPAPTWRRVRRLEELGIITGYRAEIDRRKIGLGVLAFVRVDTDRDNLAATKALEDAIRNLPEVISCHYISGAGTFELQVLVTDLDAYARWTMDTLFRLPNVKDLHTSFSLGEVKAGAALPLGHLGAAR

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
77 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
167 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
179 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
180 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
206 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
207 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
208 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
214 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
215 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
221 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
256 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
272 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
273 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
274 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
289 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
290 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
291 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
292 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
293 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
294 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
295 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
296 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
297 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
298 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
303 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
307 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
308 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
309 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.9
Nodule 0.54
Rhizoplane 2.33
Rhizosphere 66.43
Stem 0
Stem Tuber 0
Unclassified 8.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000063 3300002705 Bacteria 84312
2 JGI25154J39366_1000533 3300002738 Bacteria 19083
3 JGI25157J39369_1000082 3300002741 Bacteria 84303
4 JGI25152J39213_1011981 3300002773 Bacteria 1886
5 JGI25153J46596_10000416 3300003215 Bacteria 28007
6 JGI25153J46596_10009702 3300003215 Bacteria 4433
7 rootH2_10007281 3300003320 Bacteria 5399
8 rootH2_10020702 3300003320 Bacteria 4207
9 rootL2_10006362 3300003322 Bacteria 20083
10 Ga0055539_1000303 3300003752 Bacteria 26405
11 Ga0055533_1000043 3300003756 Bacteria 229262
12 Ga0055525_1000056 3300003759 Bacteria 212321
13 Ga0055525_1001652 3300003759 Bacteria 3443
14 Ga0055535_1002530 3300003761 Bacteria 6213
15 Ga0055529_1000464 3300003763 Bacteria 39223
16 Ga0055529_1001234 3300003763 Bacteria 9615
17 Ga0055524_1002162 3300003775 Bacteria 10345
18 Ga0055524_1023386 3300003775 Bacteria 1991
19 Ga0055531_10004238 3300003794 Bacteria 8822
20 Ga0065165_1003834 3300005262 Bacteria 10014
21 Ga0070658_10309099 3300005327 Bacteria 1349
22 Ga0070676_10003518 3300005328 Bacteria 8184
23 Ga0070676_10063737 3300005328 Bacteria 2196
24 Ga0070676_10232881 3300005328 Bacteria 1221
25 Ga0070676_10453022 3300005328 Bacteria 902
26 Ga0070690_100001384 3300005330 Bacteria 12638
27 Ga0070670_100245930 3300005331 Bacteria 1558
28 Ga0070677_10005141 3300005333 Bacteria 4300
29 Ga0070677_10216629 3300005333 Bacteria 933
30 Ga0068869_100110461 3300005334 Bacteria 2091
31 Ga0068868_100164969 3300005338 Bacteria 1832
32 Ga0070669_100041589 3300005353 Bacteria 3343
33 Ga0070669_100056439 3300005353 Bacteria 2879
34 Ga0070675_100000811 3300005354 Bacteria 22016
35 Ga0070675_100031487 3300005354 Bacteria 4288
36 Ga0070671_100029927 3300005355 Bacteria 4492
37 Ga0070671_100096575 3300005355 Bacteria 2478
38 Ga0070671_100238993 3300005355 Bacteria 1542
39 Ga0070671_100381437 3300005355 Bacteria 1205
40 Ga0070674_100011059 3300005356 Bacteria 5476
41 Ga0070674_100048225 3300005356 Bacteria 2922
42 Ga0070673_100506425 3300005364 Bacteria 1093
43 Ga0070673_100660681 3300005364 Bacteria 957
44 Ga0070673_100867174 3300005364 Bacteria 836
45 Ga0070659_100102567 3300005366 Bacteria 2303
46 Ga0070667_100018817 3300005367 Bacteria 5729
47 Ga0070667_100279892 3300005367 Bacteria 1498
48 Ga0070708_100073412 3300005445 Bacteria 3084
49 Ga0070663_100004945 3300005455 Bacteria 7870
50 Ga0070678_100032954 3300005456 Bacteria 3591
51 Ga0070678_100122683 3300005456 Bacteria 2051
52 Ga0070662_100286379 3300005457 Bacteria 1335
53 Ga0068867_100000439 3300005459 Bacteria 27677
54 Ga0068867_100004831 3300005459 Bacteria 9487
55 Ga0068867_100013526 3300005459 Bacteria 5779
56 Ga0068867_100048805 3300005459 Bacteria 3115
57 Ga0068867_100574282 3300005459 Bacteria 980
58 Ga0070706_100040369 3300005467 Bacteria 4307
59 Ga0070707_100019837 3300005468 Bacteria 6337
60 Ga0070698_100137461 3300005471 Bacteria 2397
61 Ga0068853_100033051 3300005539 Bacteria 4386
62 Ga0068853_100582169 3300005539 Bacteria 1062
63 Ga0070672_100003173 3300005543 Bacteria 10629
64 Ga0070672_100136539 3300005543 Bacteria 2020
65 Ga0070665_100608374 3300005548 Bacteria 1106
66 Ga0068855_100002610 3300005563 Bacteria 22210
67 Ga0068855_100594642 3300005563 Bacteria 1194
68 Ga0068855_100628480 3300005563 Bacteria 1155
69 Ga0070664_100216756 3300005564 Bacteria 1712
70 Ga0070664_101182758 3300005564 Bacteria 721
71 Ga0068857_100013771 3300005577 Bacteria 7047
72 Ga0068857_100015412 3300005577 Bacteria 6675
73 Ga0068854_100009344 3300005578 Bacteria 6329
74 Ga0068854_100080311 3300005578 Bacteria 2407
75 Ga0068856_100157132 3300005614 Bacteria 2284
76 Ga0068852_100111343 3300005616 Bacteria 2489
77 Ga0068852_100425956 3300005616 Bacteria 1310
78 Ga0068852_100694675 3300005616 Bacteria 1027
79 Ga0068859_100245015 3300005617 Bacteria 1882
80 Ga0068864_100092822 3300005618 Bacteria 2665
81 Ga0068861_101459382 3300005719 Bacteria 670
82 Ga0068851_10388426 3300005834 Bacteria 819
83 Ga0068870_10011020 3300005840 Bacteria 4176
84 Ga0068870_10085964 3300005840 Bacteria 1749
85 Ga0068863_100166600 3300005841 Bacteria 2113
86 Ga0068860_100045649 3300005843 Bacteria 4178
87 Ga0068860_100732141 3300005843 Bacteria 1000
88 Ga0068862_100029865 3300005844 Bacteria 4593
89 Ga0068862_100038190 3300005844 Bacteria 4071
90 Ga0068862_101147603 3300005844 Bacteria 774
91 Ga0081455_10192841 3300005937 Bacteria 1533
92 Ga0075363_100021255 3300006048 Bacteria 3265
93 Ga0075364_10035455 3300006051 Bacteria 3224
94 Ga0075362_10025128 3300006177 Bacteria 2532
95 Ga0075362_10026634 3300006177 Bacteria 2471
96 Ga0075362_10055625 3300006177 Bacteria 1780
97 Ga0075367_10056484 3300006178 Bacteria 2332
98 Ga0075367_10105072 3300006178 Bacteria 1729
99 Ga0075367_10117792 3300006178 Bacteria 1635
100 Ga0075367_10138155 3300006178 Bacteria 1508
101 Ga0075367_10349311 3300006178 Bacteria 933
102 Ga0075366_10003496 3300006195 Bacteria 8299
103 Ga0075366_10029464 3300006195 Bacteria 3224
104 Ga0075366_10034758 3300006195 Bacteria 2970
105 Ga0075366_10046639 3300006195 Bacteria 2568
106 Ga0075366_10049715 3300006195 Bacteria 2488
107 Ga0075366_10083402 3300006195 Bacteria 1910
108 Ga0075366_10092684 3300006195 Bacteria 1810
109 Ga0075366_10525754 3300006195 Bacteria 732
110 Ga0075370_10002677 3300006353 Bacteria 8330
111 Ga0075370_10004667 3300006353 Bacteria 6682
112 Ga0075370_10030758 3300006353 Bacteria 2997
113 Ga0075370_10052585 3300006353 Bacteria 2311
114 Ga0075370_10109744 3300006353 Bacteria 1601
115 Ga0075370_10298737 3300006353 Bacteria 957
116 Ga0075430_100114689 3300006846 Bacteria 2245
117 Ga0075429_100129999 3300006880 Bacteria 2203
118 Ga0068865_100006375 3300006881 Bacteria 7189
119 Ga0068865_100218226 3300006881 Bacteria 1490
120 Ga0068865_100224577 3300006881 Bacteria 1470
121 Ga0068865_100309765 3300006881 Bacteria 1267
122 Ga0068865_100672638 3300006881 Bacteria 882
123 Ga0097620_100245005 3300006931 Bacteria 1882
124 Ga0099824_1029266 3300006942 Bacteria 2374
125 Ga0099823_1000025 3300006944 Bacteria 73278
126 Ga0105240_10034252 3300009093 Bacteria 6552
127 Ga0105240_10034475 3300009093 Bacteria 6528
128 Ga0105240_10333179 3300009093 Bacteria 1726
129 Ga0111539_12217070 3300009094 Bacteria 637
130 Ga0105245_10230852 3300009098 Bacteria 1790
131 Ga0105247_10427240 3300009101 Bacteria 950
132 Ga0114129_10886992 3300009147 Bacteria 1131
133 Ga0105243_10000562 3300009148 Bacteria 37568
134 Ga0105243_10143730 3300009148 Bacteria 2039
135 Ga0105243_10238029 3300009148 Bacteria 1619
136 Ga0105243_10633497 3300009148 Bacteria 1034
137 Ga0105241_10278483 3300009174 Bacteria 1428
138 Ga0105248_10004608 3300009177 Bacteria 15258
139 Ga0105237_10004426 3300009545 Bacteria 16286
140 Ga0105237_10005880 3300009545 Bacteria 13755
141 Ga0105237_10257989 3300009545 Bacteria 1746
142 Ga0105237_11180532 3300009545 Bacteria 772
143 Ga0105238_10010462 3300009551 Bacteria 9311
144 Ga0105238_10014149 3300009551 Bacteria 8069
145 Ga0105238_10488470 3300009551 Bacteria 1231
146 Ga0105249_10547905 3300009553 Bacteria 1207
147 Ga0105249_10574562 3300009553 Bacteria 1180
148 Ga0105249_11198510 3300009553 Bacteria 830
149 Ga0105249_11199012 3300009553 Bacteria 830
150 Ga0105239_10029492 3300010375 Bacteria 6032
151 Ga0105239_10063541 3300010375 Bacteria 4053
152 Ga0105239_10067265 3300010375 Bacteria 3935
153 Ga0105239_12086160 3300010375 Bacteria 659
154 Ga0105246_10272765 3300011119 Bacteria 1353
155 Ga0157319_1000014 3300012497 Bacteria 139356
156 Ga0157373_10734771 3300013100 Bacteria 725
157 Ga0157369_10103155 3300013105 Bacteria 3038
158 Ga0157378_10048638 3300013297 Bacteria 3771
159 Ga0163162_10004897 3300013306 Bacteria 12909
160 Ga0163162_10058038 3300013306 Bacteria 3899
161 Ga0163162_10731170 3300013306 Bacteria 1110
162 Ga0157372_10512941 3300013307 Bacteria 1398
163 Ga0157375_10152003 3300013308 Bacteria 2451
164 Ga0157375_10290287 3300013308 Bacteria 1799
165 Ga0163163_10311560 3300014325 Bacteria 1627
166 Ga0157380_10117420 3300014326 Bacteria 2247
167 Ga0157380_10698502 3300014326 Bacteria 1019
168 Ga0157377_10000160 3300014745 Bacteria 41263
169 Ga0157377_10603255 3300014745 Bacteria 783
170 Ga0157379_10013046 3300014968 Bacteria 7276
171 Ga0157379_10076813 3300014968 Bacteria 2991
172 Ga0157379_10263498 3300014968 Bacteria 1566
173 Ga0157379_10921037 3300014968 Bacteria 830
174 Ga0157376_10818040 3300014969 Bacteria 945
175 Ga0163161_10161461 3300017792 Bacteria 1709
176 Ga0163161_10188798 3300017792 Bacteria 1583
177 Ga0213872_10000219 3300021361 Bacteria 50549
178 Ga0213872_10284374 3300021361 Bacteria 690
179 Ga0209674_100067 3300025226 Bacteria 253824
180 Ga0209672_103024 3300025228 Bacteria 3670
181 Ga0209563_100014 3300025230 Bacteria 940582
182 Ga0209563_100068 3300025230 Bacteria 254802
183 Ga0207427_100458 3300025231 Bacteria 22530
184 Ga0209258_100129 3300025242 Bacteria 176515
185 Ga0209258_100459 3300025242 Bacteria 44386
186 Ga0207425_1004340 3300025245 Bacteria 4287
187 Ga0209646_1000244 3300025246 Bacteria 55661
188 Ga0209026_1000004 3300025250 Bacteria 949012
189 Ga0209677_100049 3300025253 Bacteria 180721
190 Ga0209677_100413 3300025253 Bacteria 25541
191 Ga0209677_101817 3300025253 Bacteria 8730
192 Ga0209759_1000003 3300025256 Bacteria 792130
193 Ga0209759_1001180 3300025256 Bacteria 16394
194 Ga0209129_1000113 3300025258 Bacteria 145178
195 Ga0209455_1000083 3300025272 Bacteria 255660
196 Ga0209673_1009751 3300025273 Bacteria 4122
197 Ga0209673_1011242 3300025273 Bacteria 3704
198 Ga0209564_1000186 3300025295 Bacteria 147120
199 Ga0209758_1000172 3300025297 Bacteria 147763
200 Ga0209758_1000304 3300025297 Bacteria 95770
201 Ga0209050_1000489 3300025298 Bacteria 68506
202 Ga0209050_1011160 3300025298 Bacteria 4303
203 Ga0209256_1000391 3300025299 Bacteria 69634
204 Ga0209256_1021065 3300025299 Bacteria 2015
205 Ga0209256_1083914 3300025299 Bacteria 690
206 Ga0209051_1000920 3300025303 Bacteria 29209
207 Ga0209051_1002680 3300025303 Bacteria 12438
208 Ga0209051_1012113 3300025303 Bacteria 4194
209 Ga0209257_1004193 3300025304 Bacteria 11433
210 Ga0207697_10076701 3300025315 Bacteria 1405
211 Ga0207682_10000902 3300025893 Bacteria 13752
212 Ga0207682_10076560 3300025893 Bacteria 1426
213 Ga0207682_10208450 3300025893 Bacteria 901
214 Ga0207688_10227998 3300025901 Bacteria 1124
215 Ga0207680_10236408 3300025903 Bacteria 1257
216 Ga0207645_10003682 3300025907 Bacteria 11561
217 Ga0207645_10027108 3300025907 Bacteria 3702
218 Ga0207645_10118511 3300025907 Bacteria 1717
219 Ga0207645_10192359 3300025907 Bacteria 1341
220 Ga0207645_10224234 3300025907 Bacteria 1239
221 Ga0207645_10663452 3300025907 Bacteria 709
222 Ga0207643_10089492 3300025908 Bacteria 1793
223 Ga0207643_10186592 3300025908 Bacteria 1257
224 Ga0207684_10017578 3300025910 Bacteria 6133
225 Ga0207684_10169008 3300025910 Bacteria 1885
226 Ga0207684_10976875 3300025910 Bacteria 709
227 Ga0207695_10019455 3300025913 Bacteria 7821
228 Ga0207695_10031958 3300025913 Bacteria 5765
229 Ga0207695_10233155 3300025913 Bacteria 1744
230 Ga0207671_10017873 3300025914 Bacteria 5455
231 Ga0207671_10024660 3300025914 Bacteria 4518
232 Ga0207662_10211102 3300025918 Bacteria 1260
233 Ga0207649_11043061 3300025920 Bacteria 644
234 Ga0207646_10624381 3300025922 Bacteria 966
235 Ga0207681_10035054 3300025923 Bacteria 3305
236 Ga0207681_10163776 3300025923 Bacteria 1679
237 Ga0207681_10360200 3300025923 Bacteria 1166
238 Ga0207694_10003197 3300025924 Bacteria 13068
239 Ga0207650_10000580 3300025925 Bacteria 29427
240 Ga0207650_10112642 3300025925 Bacteria 2108
241 Ga0207659_10001304 3300025926 Bacteria 14888
242 Ga0207659_10108646 3300025926 Bacteria 2104
243 Ga0207644_10050850 3300025931 Bacteria 2972
244 Ga0207644_10175200 3300025931 Bacteria 1677
245 Ga0207644_10375023 3300025931 Bacteria 1159
246 Ga0207644_10807861 3300025931 Bacteria 784
247 Ga0207706_10135113 3300025933 Bacteria 2170
248 Ga0207706_10146367 3300025933 Bacteria 2078
249 Ga0207706_10509119 3300025933 Bacteria 1039
250 Ga0207686_10369294 3300025934 Bacteria 1085
251 Ga0207709_10002023 3300025935 Bacteria 13149
252 Ga0207709_10046945 3300025935 Bacteria 2624
253 Ga0207709_10351273 3300025935 Bacteria 1113
254 Ga0207709_10509075 3300025935 Bacteria 941
255 Ga0207669_10004641 3300025937 Bacteria 6068
256 Ga0207669_10041839 3300025937 Bacteria 2670
257 Ga0207669_10330611 3300025937 Bacteria 1170
258 Ga0207704_10006505 3300025938 Bacteria 5454
259 Ga0207704_10158481 3300025938 Bacteria 1607
260 Ga0207704_10184182 3300025938 Bacteria 1512
261 Ga0207704_10428517 3300025938 Bacteria 1050
262 Ga0207691_10009625 3300025940 Bacteria 9272
263 Ga0207691_10036588 3300025940 Bacteria 4549
264 Ga0207711_10040465 3300025941 Bacteria 3966
265 Ga0207711_10809730 3300025941 Bacteria 872
266 Ga0207711_10919367 3300025941 Bacteria 813
267 Ga0207689_10020983 3300025942 Bacteria 5490
268 Ga0207689_10033149 3300025942 Bacteria 4292
269 Ga0207689_10078525 3300025942 Bacteria 2712
270 Ga0207661_10191831 3300025944 Bacteria 1792
271 Ga0207679_10338004 3300025945 Bacteria 1309
272 Ga0207667_10011062 3300025949 Bacteria 10512
273 Ga0207667_10358662 3300025949 Bacteria 1487
274 Ga0207651_10000982 3300025960 Bacteria 12600
275 Ga0207651_10353571 3300025960 Bacteria 1238
276 Ga0207651_10697904 3300025960 Bacteria 894
277 Ga0207651_10799199 3300025960 Bacteria 836
278 Ga0207712_10101436 3300025961 Bacteria 2140
279 Ga0207712_10603064 3300025961 Bacteria 950
280 Ga0207712_11281557 3300025961 Bacteria 655
281 Ga0207640_10051812 3300025981 Bacteria 2670
282 Ga0207640_10091037 3300025981 Bacteria 2112
283 Ga0207640_11034052 3300025981 Bacteria 724
284 Ga0207658_10000533 3300025986 Bacteria 34674
285 Ga0207658_10596696 3300025986 Bacteria 992
286 Ga0207658_10687325 3300025986 Bacteria 924
287 Ga0207703_10712501 3300026035 Bacteria 955
288 Ga0207639_10027284 3300026041 Bacteria 4158
289 Ga0207639_10650509 3300026041 Bacteria 975
290 Ga0207678_10002475 3300026067 Bacteria 16780
291 Ga0207678_10060519 3300026067 Bacteria 3257
292 Ga0207678_10705588 3300026067 Bacteria 888
293 Ga0207702_10000525 3300026078 Bacteria 42984
294 Ga0207641_10149112 3300026088 Bacteria 2117
295 Ga0207648_10000574 3300026089 Bacteria 41215
296 Ga0207648_10003174 3300026089 Bacteria 17317
297 Ga0207648_10003741 3300026089 Bacteria 15906
298 Ga0207648_10004810 3300026089 Bacteria 13779
299 Ga0207648_10276104 3300026089 Bacteria 1502
300 Ga0207648_10467623 3300026089 Bacteria 1150
301 Ga0207676_10041455 3300026095 Bacteria 3534
302 Ga0207674_10018439 3300026116 Bacteria 7585
303 Ga0207674_10068767 3300026116 Bacteria 3563
304 Ga0207674_10145160 3300026116 Bacteria 2331
305 Ga0207683_10051560 3300026121 Bacteria 3605
306 Ga0207683_10110942 3300026121 Bacteria 2456
307 Ga0207683_10383060 3300026121 Bacteria 1293
308 Ga0207698_10200976 3300026142 Bacteria 1784
309 Ga0207698_10284767 3300026142 Bacteria 1530
310 Ga0207698_10610224 3300026142 Bacteria 1077
311 Ga0207698_11576741 3300026142 Bacteria 672
312 Ga0209389_1000215 3300027296 Bacteria 40569
313 Ga0209371_1014733 3300027312 Bacteria 2130
314 Ga0209996_1001297 3300027395 Bacteria 3002
315 Ga0209995_1000208 3300027471 Bacteria 9439
316 Ga0209966_1000046 3300027695 Bacteria 52323
317 Ga0268266_10053942 3300028379 Bacteria 3455
318 Ga0268266_10076779 3300028379 Bacteria 2904
319 Ga0268265_10030975 3300028380 Bacteria 3859
320 Ga0268265_10166411 3300028380 Bacteria 1879
321 Ga0268264_10002041 3300028381 Bacteria 18038
322 Ga0268264_10260372 3300028381 Bacteria 1615
323 Ga0268264_10932075 3300028381 Bacteria 873
324 Ga0265336_10000087 3300028666 Bacteria 72636
325 Ga0307517_10000394 3300028786 Bacteria 74695
326 Ga0307517_10113786 3300028786 Bacteria 2040
327 Ga0307517_10140602 3300028786 Bacteria 1696
328 Ga0307515_10000013 3300028794 Bacteria 568456
329 Ga0307515_10000037 3300028794 Bacteria 331970
330 Ga0307515_10000123 3300028794 Bacteria 186601
331 Ga0307515_10037587 3300028794 Bacteria 7780
332 Ga0307515_10121955 3300028794 Bacteria 2944
333 Ga0307515_10274273 3300028794 Bacteria 1402
334 Ga0265324_10000334 3300029957 Bacteria 34717
335 Ga0268256_1024471 3300030500 Bacteria 1549
336 Ga0307511_10074169 3300030521 Bacteria 2455
337 Ga0307512_10094851 3300030522 Bacteria 2056
338 Ga0307513_10106404 3300031456 Bacteria 2811
339 Ga0307513_10263653 3300031456 Bacteria 1511
340 Ga0307509_10000950 3300031507 Bacteria 49553
341 Ga0307509_10023601 3300031507 Bacteria 6901
342 Ga0307408_100716071 3300031548 Bacteria 901
343 Ga0307508_10000150 3300031616 Bacteria 83110
344 Ga0307508_10000912 3300031616 Bacteria 34407
345 Ga0307508_10175321 3300031616 Bacteria 1747
346 Ga0307514_10067190 3300031649 Bacteria 2707
347 Ga0307516_10000164 3300031730 Bacteria 83388
348 Ga0307516_10004805 3300031730 Bacteria 16463
349 Ga0307516_10084315 3300031730 Bacteria 3017
350 Ga0307516_10091116 3300031730 Bacteria 2877
351 Ga0307516_10137194 3300031730 Bacteria 2219
352 Ga0307516_10229868 3300031730 Bacteria 1559
353 Ga0307516_10768091 3300031730 Bacteria 624
354 Ga0307405_10201829 3300031731 Bacteria 1445
355 Ga0307413_10039868 3300031824 Bacteria 2735
356 Ga0307406_10067917 3300031901 Bacteria 2326
357 Ga0307407_10248570 3300031903 Bacteria 1217
358 Ga0307412_10004357 3300031911 Bacteria 7893
359 Ga0307412_10077563 3300031911 Bacteria 2286
360 Ga0307412_10336348 3300031911 Bacteria 1207
361 Ga0307412_11062602 3300031911 Bacteria 718
362 Ga0307416_100022472 3300032002 Bacteria 4554
363 Ga0307416_100612526 3300032002 Bacteria 1170
364 Ga0307411_11145617 3300032005 Bacteria 703
365 Ga0307507_10044515 3300033179 Bacteria 4385
366 Ga0307507_10276280 3300033179 Bacteria 1055
367 Ga0307510_10018224 3300033180 Bacteria 8266
368 Ga0307510_10024351 3300033180 Bacteria 6995
369 Ga0307510_10208656 3300033180 Bacteria 1478
370 Ga0307510_10244882 3300033180 Bacteria 1284
371 Ga0373934_0008867 3300035086 Bacteria 3758
372 Ga0373931_0107423 3300035691 Bacteria 1578
373 Ga0373935_0581205 3300035692 Bacteria 818
374 Ga0373927_0007707 3300035695 Bacteria 7286
375 Ga0373925_0175771 3300037068 Bacteria 1692
376 Ga0395900_0000904 3300037418 Bacteria 39054
377 Ga0395898_0001196 3300037466 Bacteria 39243
378 Ga0395905_0004485 3300037471 Bacteria 14482
379 Ga0395905_0036167 3300037471 Bacteria 4637
380 Ga0395905_0059846 3300037471 Bacteria 3561
381 Ga0395905_0162470 3300037471 Bacteria 2099
382 Ga0436361_0231366 3300039447 Bacteria 3282
383 Ga0436361_0264437 3300039447 Bacteria 60444
384 Ga0436361_0813098 3300039447 Bacteria 136133
385 Ga0436361_1029632 3300039447 Bacteria 7528
386 Ga0451789_0291111 3300041443 Bacteria 2276
387 Ga0451795_1056889 3300041456 Bacteria 1110
388 Ga0451798_0274987 3300041458 Bacteria 851
389 Ga0451804_0431348 3300041463 Bacteria 2788
390 Ga0451853_2456265 3300041512 Bacteria 743
391 Ga0451853_3681233 3300041512 Bacteria 1553
392 Ga0439449_0010624 3300042007 Bacteria 3478
393 Ga0439454_016864 3300042011 Bacteria 1037
394 Ga0439455_0042469 3300042012 Bacteria 1168
395 Ga0450895_020713 3300042132 Bacteria 609
396 Ga0450898_032783 3300042134 Bacteria 959
397 Ga0450898_072705 3300042134 Bacteria 691
398 Ga0450909_032635 3300042185 Bacteria 792
399 Ga0439434_0168139 3300042435 Bacteria 731
400 Ga0439464_0071330 3300042439 Bacteria 1028
401 Ga0450893_0023100 3300042532 Bacteria 1080
402 Ga0451577_0089335 3300042876 Bacteria 2749
403 Ga0451577_0919678 3300042876 Bacteria 787
404 Ga0466969_0033076 3300044656 Bacteria 2627
405 Ga0466972_0006140 3300044658 Bacteria 6037
406 Ga0466965_0015474 3300044683 Bacteria 3624
407 Ga0466965_0172534 3300044683 Bacteria 1138
408 Ga0466966_0027536 3300044684 Bacteria 3705
409 Ga0466961_0028716 3300044693 Bacteria 3577
410 Ga0466961_0253405 3300044693 Bacteria 1080
411 Ga0466963_0029617 3300044694 Bacteria 3525
412 Ga0466963_0073044 3300044694 Bacteria 2312
413 Ga0466964_0022033 3300044706 Bacteria 2468
414 Ga0466964_0163256 3300044706 Bacteria 1043
415 Ga0453684_0000365 3300044712 Bacteria 186233
416 Ga0453684_0064742 3300044712 Bacteria 4668
417 Ga0453684_0081723 3300044712 Bacteria 4029
418 Ga0453684_0269217 3300044712 Bacteria 1948
419 Ga0453684_0801738 3300044712 Bacteria 1015
420 Ga0466970_0020049 3300044765 Bacteria 3470
421 Ga0466957_0164007 3300044842 Bacteria 1444
422 Ga0466957_0307821 3300044842 Bacteria 1066
423 Ga0466959_0000916 3300045049 Bacteria 17453
424 Ga0451576_0020395 3300045051 Bacteria 7220
425 Ga0451576_0050879 3300045051 Bacteria 4344
426 Ga0466958_0055320 3300045836 Bacteria 2408
427 Ga0466958_0144732 3300045836 Bacteria 1497
428 Ga0466967_0080814 3300045976 Bacteria 2934
429 Ga0495592_0007407 3300046454 Bacteria 8216
430 Ga0495638_0028172 3300046460 Bacteria 3630
431 Ga0495639_0140918 3300046475 Bacteria 1159
432 Ga0495639_0381097 3300046475 Bacteria 711
433 Ga0495585_0268530 3300046492 Bacteria 846
434 Ga0495606_0000600 3300046507 Bacteria 57013
435 Ga0495606_0084253 3300046507 Bacteria 1969
436 Ga0495620_0052156 3300046515 Bacteria 1738
437 Ga0495630_0171136 3300046517 Bacteria 1655
438 Ga0495632_0037421 3300046519 Bacteria 2462
439 Ga0495643_0103084 3300046522 Bacteria 1460
440 Ga0495648_0080880 3300046524 Bacteria 1850
441 Ga0495666_0078310 3300046526 Bacteria 1566
442 Ga0495609_0117909 3300046538 Bacteria 1143
443 Ga0495621_0077078 3300046539 Bacteria 1237
444 Ga0495668_0490787 3300046616 Bacteria 677
445 Ga0495625_0029142 3300046660 Bacteria 4132
446 Ga0495624_0044128 3300046690 Bacteria 2843
447 Ga0495624_0621157 3300046690 Bacteria 643
448 Ga0495671_0180060 3300046692 Bacteria 1027
449 Ga0495649_0000655 3300046694 Bacteria 28205
450 Ga0495649_0012421 3300046694 Bacteria 4951
451 Ga0495589_0012863 3300046794 Bacteria 4325
452 Ga0495660_0037246 3300046810 Bacteria 2710
453 Ga0495660_0155214 3300046810 Bacteria 1127
454 Ga0495676_0055352 3300047321 Bacteria 3146
455 Ga0495687_000414 3300047443 Bacteria 52840
456 Ga0495687_019317 3300047443 Bacteria 3348
457 Ga0495687_035617 3300047443 Bacteria 2235
458 Ga0495679_124727 3300047446 Bacteria 702
459 Ga0495593_0133286 3300047673 Bacteria 1260
460 Ga0495626_0005858 3300048091 Bacteria 7086
461 Ga0496102_0003913 3300048905 Bacteria 12613
462 Ga0496106_0163454 3300048909 Bacteria 1761
463 Ga0496108_0108525 3300048911 Bacteria 2371
464 Ga0496108_0113414 3300048911 Bacteria 2320
465 Ga0496109_0233412 3300048912 Bacteria 1731
466 Ga0496109_0341453 3300048912 Bacteria 1414
467 Ga0496112_0074530 3300048915 Bacteria 3355
468 Ga0496113_0190853 3300048916 Bacteria 1626
469 Ga0496113_0448783 3300048916 Bacteria 1036
470 Ga0501303_001646 3300049526 Bacteria 1681
471 Ga0501042_0126781 3300049578 Bacteria 1838
472 Ga0501043_0000012 3300049579 Bacteria 188907
473 Ga0501046_0000030 3300049580 Bacteria 187803
474 Ga0501047_0000049 3300049581 Bacteria 162513
475 Ga0501048_0001813 3300049582 Bacteria 16227
476 Ga0501206_024451 3300049653 Bacteria 875
477 Ga0501206_027179 3300049653 Bacteria 838
478 Ga0501245_031209 3300049708 Bacteria 882
479 Ga0501265_002387 3300049762 Bacteria 2132
480 Ga0501266_014677 3300049763 Bacteria 1029
481 Ga0501035_0093746 3300049822 Bacteria 2642
482 Ga0501044_0211044 3300049823 Bacteria 1896
483 Ga0501045_0002489 3300049824 Bacteria 12533
484 nmdc:mga03683_128419_c1 3300050489 Bacteria 1132
485 nmdc:mga03683_41714_c1 3300050489 Bacteria 1886
486 nmdc:mga00v17_148194_c1 3300050491 Bacteria 1507
487 nmdc:mga0yw44_253628_c1 3300050492 Bacteria 1171
488 nmdc:mga0k408_119275_c1 3300050493 Bacteria 1562
489 nmdc:mga0k408_12249_c1 3300050493 Bacteria 4686
490 nmdc:mga0k408_125778_c1 3300050493 Bacteria 1520
491 nmdc:mga0k408_16837_c1 3300050493 Bacteria 4064
492 nmdc:mga0k408_29814_c1 3300050493 Bacteria 3108
493 nmdc:mga0k408_3343_c1 3300050493 Bacteria 8489
494 nmdc:mga0k408_340706_c1 3300050493 Bacteria 894
495 nmdc:mga0k408_36271_c1 3300050493 Bacteria 2830
496 nmdc:mga0k408_37149_c1 3300050493 Bacteria 2796
497 nmdc:mga0k408_37611_c1 3300050493 Bacteria 2779
498 nmdc:mga0k408_608919_c1 3300050493 Bacteria 644
499 nmdc:mga0k408_77192_c1 3300050493 Bacteria 1948
500 nmdc:mga0k408_908_c1 3300050493 Bacteria 16172
501 nmdc:mga06z11_43224_c1 3300050494 Bacteria 2265
502 nmdc:mga06z11_67809_c1 3300050494 Bacteria 1879
503 nmdc:mga06z11_91460_c1 3300050494 Bacteria 1652
504 nmdc:mga07m45_284_c1 3300050496 Bacteria 16296
505 nmdc:mga07m45_3787_c1 3300050496 Bacteria 7320
506 nmdc:mga07m45_4440_c1 3300050496 Bacteria 6866
507 nmdc:mga07m45_5674_c1 3300050496 Bacteria 6238
508 nmdc:mga05p37_278107_c1 3300050507 Bacteria 1997
509 nmdc:mga05p37_456627_c1 3300050507 Bacteria 1477
510 nmdc:mga09592_220626_c1 3300050508 Bacteria 1643
511 nmdc:mga0qj67_281725_c1 3300050509 Bacteria 1347
512 nmdc:mga0qj67_282262_c1 3300050509 Bacteria 1346
513 nmdc:mga0sz30_31376_c1 3300050516 Bacteria 2199
514 Ga0500635_0000322 3300053080 Bacteria 16527
515 Ga0500635_0087184 3300053080 Bacteria 1130
516 Ga0500578_0139065 3300053086 Bacteria 1519
517 Ga0500644_0020880 3300053088 Bacteria 1954
518 Ga0500646_0018715 3300053090 Bacteria 1826
519 Ga0500650_0019913 3300053098 Bacteria 2937
520 Ga0500650_0048253 3300053098 Bacteria 1975
521 Ga0500562_022756 3300053108 Bacteria 1634
522 Ga0500594_0002149 3300053118 Bacteria 4266
523 Ga0500628_010170 3300053129 Bacteria 1677
524 Ga0500642_0001693 3300053130 Bacteria 6357
525 Ga0500652_002916 3300053131 Bacteria 5158
526 Ga0500655_006702 3300053133 Bacteria 2072
527 Ga0500658_0056748 3300053134 Bacteria 1616
528 Ga0500559_0004161 3300053136 Bacteria 6942
529 Ga0500559_0019920 3300053136 Bacteria 2835
530 Ga0500568_0027685 3300053139 Bacteria 2368
531 Ga0500568_0059275 3300053139 Bacteria 1486
532 Ga0500568_0100326 3300053139 Bacteria 1086
533 Ga0500604_0001619 3300053151 Bacteria 6319
534 Ga0500604_0010207 3300053151 Bacteria 2509
535 Ga0500604_0044930 3300053151 Bacteria 1346
536 Ga0500619_011735 3300053154 Bacteria 2265
537 Ga0500622_0000146 3300053156 Bacteria 74615
538 Ga0500622_0010151 3300053156 Bacteria 5180
539 Ga0500622_0154083 3300053156 Bacteria 1083
540 Ga0500636_0074806 3300053177 Bacteria 1960
541 Ga0500636_0132185 3300053177 Bacteria 1389
542 Ga0500645_024283 3300053730 Bacteria 1853
543 Ga0500587_001169 3300053739 Bacteria 3624
544 Ga0500661_037886 3300055283 Bacteria 853
545 Ga0500661_046177 3300055283 Bacteria 774
546 Ga0466962_0158800 3300061719 Bacteria 1098
547 Ga0466962_0344010 3300061719 Bacteria 742

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030521 Ga0307511_10074169 Ga0307511_100741692 145
2 3300046507 Ga0495606_0000600 Ga0495606_0000600_38792_39376 145
3 3300046694 Ga0495649_0000655 Ga0495649_0000655_3066_3650 145
4 3300026067 Ga0207678_10705588 Ga0207678_107055881 146
5 3300028666 Ga0265336_10000087 Ga0265336_1000008736 148
6 3300029957 Ga0265324_10000334 Ga0265324_100003343 148
7 3300053177 Ga0500636_0074806 Ga0500636_0074806_1289_1852 148
8 3300005328 Ga0070676_10063737 Ga0070676_100637372 155
9 3300025907 Ga0207645_10027108 Ga0207645_100271082 155
10 3300025945 Ga0207679_10338004 Ga0207679_103380042 155
11 3300003775 Ga0055524_1023386 Ga0055524_10233863 156
12 3300003794 Ga0055531_10004238 Ga0055531_100042382 156
13 3300006942 Ga0099824_1029266 Ga0099824_10292662 156
14 3300006944 Ga0099823_1000025 Ga0099823_100002537 156
15 3300025273 Ga0209673_1009751 Ga0209673_10097512 156
16 3300025298 Ga0209050_1011160 Ga0209050_10111605 156
17 3300025299 Ga0209256_1021065 Ga0209256_10210652 156
18 3300025303 Ga0209051_1000920 Ga0209051_10009206 156
19 3300025304 Ga0209257_1004193 Ga0209257_10041935 156
20 3300027296 Ga0209389_1000215 Ga0209389_10002159 156
21 3300027312 Ga0209371_1014733 Ga0209371_10147333 156
22 3300030500 Ga0268256_1024471 Ga0268256_10244712 156
23 3300031730 Ga0307516_10768091 Ga0307516_107680911 156
24 3300042011 Ga0439454_016864 Ga0439454_016864_132_740 156
25 3300044712 Ga0453684_0000365 Ga0453684_0000365_62304_62831 156
26 3300044694 Ga0466963_0073044 Ga0466963_0073044_1658_2245 157
27 3300046616 Ga0495668_0490787 Ga0495668_0490787_100_639 158
28 3300047446 Ga0495679_124727 Ga0495679_124727_162_692 158
29 3300053108 Ga0500562_022756 Ga0500562_022756_440_970 158
30 3300053118 Ga0500594_0002149 Ga0500594_0002149_2634_3164 158
31 3300053139 Ga0500568_0100326 Ga0500568_0100326_536_1066 158
32 3300053177 Ga0500636_0132185 Ga0500636_0132185_511_1041 158
33 3300053739 Ga0500587_001169 Ga0500587_001169_445_975 158
34 3300005355 Ga0070671_100238993 Ga0070671_1002389932 159
35 3300048911 Ga0496108_0113414 Ga0496108_0113414_1508_2125 159
36 3300048912 Ga0496109_0341453 Ga0496109_0341453_255_872 159
37 3300003761 Ga0055535_1002530 Ga0055535_10025302 160
38 3300003763 Ga0055529_1000464 Ga0055529_10004644 160
39 3300003763 Ga0055529_1001234 Ga0055529_10012344 160
40 3300025228 Ga0209672_103024 Ga0209672_1030243 160
41 3300025242 Ga0209258_100129 Ga0209258_10012926 160
42 3300025256 Ga0209759_1001180 Ga0209759_10011802 160
43 3300025272 Ga0209455_1000083 Ga0209455_1000083129 160
44 3300003775 Ga0055524_1002162 Ga0055524_100216210 161
45 3300005844 Ga0068862_101147603 Ga0068862_1011476031 161
46 3300006177 Ga0075362_10055625 Ga0075362_100556252 161
47 3300006195 Ga0075366_10003496 Ga0075366_100034969 161
48 3300012497 Ga0157319_1000014 Ga0157319_100001468 161
49 3300025299 Ga0209256_1000391 Ga0209256_100039124 161
50 3300050489 nmdc:mga03683_128419_c1 nmdc:mga03683_128419_c1_258_788 161
51 3300050493 nmdc:mga0k408_12249_c1 nmdc:mga0k408_12249_c1_3328_3855 161
52 3300050493 nmdc:mga0k408_908_c1 nmdc:mga0k408_908_c1_15459_15989 161
53 3300050507 nmdc:mga05p37_456627_c1 nmdc:mga05p37_456627_c1_289_810 161
54 3300053080 Ga0500635_0087184 Ga0500635_0087184_342_899 161
55 3300053151 Ga0500604_0010207 Ga0500604_0010207_1343_1900 161
56 3300003759 Ga0055525_1000056 Ga0055525_100005634 162
57 3300025230 Ga0209563_100014 Ga0209563_100014160 162
58 3300025303 Ga0209051_1002680 Ga0209051_10026808 162
59 3300025907 Ga0207645_10118511 Ga0207645_101185112 162
60 3300025960 Ga0207651_10697904 Ga0207651_106979041 162
61 3300028794 Ga0307515_10000123 Ga0307515_10000123142 162
62 3300031456 Ga0307513_10263653 Ga0307513_102636532 162
63 3300031731 Ga0307405_10201829 Ga0307405_102018292 162
64 3300031911 Ga0307412_10077563 Ga0307412_100775632 162
65 3300032002 Ga0307416_100612526 Ga0307416_1006125262 162
66 3300033179 Ga0307507_10044515 Ga0307507_100445154 162
67 3300046507 Ga0495606_0084253 Ga0495606_0084253_823_1380 162
68 3300053129 Ga0500628_010170 Ga0500628_010170_771_1337 162
69 3300053156 Ga0500622_0154083 Ga0500622_0154083_213_776 162
70 3300003320 rootH2_10020702 rootH2_100207022 163
71 3300005366 Ga0070659_100102567 Ga0070659_1001025672 163
72 3300006846 Ga0075430_100114689 Ga0075430_1001146892 163
73 3300006880 Ga0075429_100129999 Ga0075429_1001299992 163
74 3300021361 Ga0213872_10000219 Ga0213872_1000021933 163
75 3300021361 Ga0213872_10284374 Ga0213872_102843741 163
76 3300025960 Ga0207651_10000982 Ga0207651_100009824 163
77 3300026142 Ga0207698_11576741 Ga0207698_115767411 163
78 3300031911 Ga0307412_10336348 Ga0307412_103363482 163
79 3300032002 Ga0307416_100022472 Ga0307416_1000224724 163
80 3300035692 Ga0373935_0581205 Ga0373935_0581205_112_711 163
81 3300035695 Ga0373927_0007707 Ga0373927_0007707_5136_5735 163
82 3300039447 Ga0436361_0264437 Ga0436361_0264437_43494_44036 163
83 3300039447 Ga0436361_1029632 Ga0436361_1029632_6604_7152 163
84 3300049526 Ga0501303_001646 Ga0501303_001646_814_1341 163
85 3300049653 Ga0501206_024451 Ga0501206_024451_316_843 163
86 3300049708 Ga0501245_031209 Ga0501245_031209_248_775 163
87 3300049762 Ga0501265_002387 Ga0501265_002387_1419_1946 163
88 3300050508 nmdc:mga09592_220626_c1 nmdc:mga09592_220626_c1_303_863 163
89 3300050509 nmdc:mga0qj67_282262_c1 nmdc:mga0qj67_282262_c1_274_834 163
90 3300005334 Ga0068869_100110461 Ga0068869_1001104612 164
91 3300005356 Ga0070674_100048225 Ga0070674_1000482251 164
92 3300005459 Ga0068867_100004831 Ga0068867_10000483111 164
93 3300005539 Ga0068853_100582169 Ga0068853_1005821692 164
94 3300005617 Ga0068859_100245015 Ga0068859_1002450152 164
95 3300005844 Ga0068862_100038190 Ga0068862_1000381903 164
96 3300006195 Ga0075366_10034758 Ga0075366_100347582 164
97 3300006195 Ga0075366_10525754 Ga0075366_105257541 164
98 3300006353 Ga0075370_10052585 Ga0075370_100525852 164
99 3300006881 Ga0068865_100006375 Ga0068865_1000063758 164
100 3300006931 Ga0097620_100245005 Ga0097620_1002450052 164
101 3300013306 Ga0163162_10004897 Ga0163162_100048972 164
102 3300014326 Ga0157380_10117420 Ga0157380_101174202 164
103 3300014968 Ga0157379_10013046 Ga0157379_100130462 164
104 3300014968 Ga0157379_10263498 Ga0157379_102634982 164
105 3300014969 Ga0157376_10818040 Ga0157376_108180402 164
106 3300017792 Ga0163161_10188798 Ga0163161_101887982 164
107 3300025910 Ga0207684_10976875 Ga0207684_109768751 164
108 3300025938 Ga0207704_10006505 Ga0207704_100065055 164
109 3300025940 Ga0207691_10036588 Ga0207691_100365882 164
110 3300025961 Ga0207712_10101436 Ga0207712_101014362 164
111 3300026035 Ga0207703_10712501 Ga0207703_107125012 164
112 3300026089 Ga0207648_10004810 Ga0207648_1000481017 164
113 3300028380 Ga0268265_10030975 Ga0268265_100309754 164
114 3300028381 Ga0268264_10002041 Ga0268264_1000204118 164
115 3300031548 Ga0307408_100716071 Ga0307408_1007160712 164
116 3300044712 Ga0453684_0064742 Ga0453684_0064742_3600_4160 164
117 3300050493 nmdc:mga0k408_608919_c1 nmdc:mga0k408_608919_c1_80_616 164
118 iso_pu_bacteria 2585428057 2587730714 164
119 iso_pu_bacteria 2643221654 2644305597 164
120 3300005456 Ga0070678_100122683 Ga0070678_1001226832 165
121 3300005548 Ga0070665_100608374 Ga0070665_1006083742 165
122 3300005616 Ga0068852_100694675 Ga0068852_1006946751 165
123 3300009093 Ga0105240_10034475 Ga0105240_100344754 165
124 3300009545 Ga0105237_10005880 Ga0105237_100058803 165
125 3300009551 Ga0105238_10010462 Ga0105238_100104622 165
126 3300010375 Ga0105239_10067265 Ga0105239_100672652 165
127 3300025913 Ga0207695_10019455 Ga0207695_100194554 165
128 3300025914 Ga0207671_10017873 Ga0207671_100178732 165
129 3300025924 Ga0207694_10003197 Ga0207694_100031973 165
130 3300026041 Ga0207639_10650509 Ga0207639_106505091 165
131 3300026142 Ga0207698_10610224 Ga0207698_106102241 165
132 3300031616 Ga0307508_10000150 Ga0307508_1000015076 165
133 3300033179 Ga0307507_10276280 Ga0307507_102762802 165
134 3300033180 Ga0307510_10244882 Ga0307510_102448822 165
135 3300037471 Ga0395905_0004485 Ga0395905_0004485_897_1499 165
136 3300039447 Ga0436361_0813098 Ga0436361_0813098_81163_81723 165
137 3300044712 Ga0453684_0269217 Ga0453684_0269217_791_1330 165
138 3300050493 nmdc:mga0k408_37611_c1 nmdc:mga0k408_37611_c1_17_571 165
139 iso_pu_bacteria 2588253510 2588294897 165
140 3300005719 Ga0068861_101459382 Ga0068861_1014593821 166
141 3300005843 Ga0068860_100045649 Ga0068860_1000456494 166
142 3300028381 Ga0268264_10260372 Ga0268264_102603722 166
143 3300041458 Ga0451798_0274987 Ga0451798_0274987_135_725 166
144 3300042876 Ga0451577_0089335 Ga0451577_0089335_1498_2076 166
145 3300044712 Ga0453684_0801738 Ga0453684_0801738_305_883 166
146 3300045051 Ga0451576_0050879 Ga0451576_0050879_2386_2964 166
147 3300049822 Ga0501035_0093746 Ga0501035_0093746_1737_2279 166
148 3300005367 Ga0070667_100018817 Ga0070667_1000188172 167
149 3300005455 Ga0070663_100004945 Ga0070663_1000049455 167
150 3300005459 Ga0068867_100000439 Ga0068867_1000004396 167
151 3300005563 Ga0068855_100594642 Ga0068855_1005946422 167
152 3300005937 Ga0081455_10192841 Ga0081455_101928412 167
153 3300006881 Ga0068865_100224577 Ga0068865_1002245771 167
154 3300009148 Ga0105243_10000562 Ga0105243_1000056218 167
155 3300013100 Ga0157373_10734771 Ga0157373_107347711 167
156 3300013308 Ga0157375_10152003 Ga0157375_101520032 167
157 3300014745 Ga0157377_10000160 Ga0157377_1000016023 167
158 3300014968 Ga0157379_10076813 Ga0157379_100768132 167
159 3300025935 Ga0207709_10002023 Ga0207709_100020234 167
160 3300025949 Ga0207667_10358662 Ga0207667_103586622 167
161 3300025986 Ga0207658_10000533 Ga0207658_100005335 167
162 3300025986 Ga0207658_10596696 Ga0207658_105966962 167
163 3300026067 Ga0207678_10002475 Ga0207678_100024752 167
164 3300026089 Ga0207648_10000574 Ga0207648_1000057420 167
165 3300027395 Ga0209996_1001297 Ga0209996_10012972 167
166 3300027471 Ga0209995_1000208 Ga0209995_10002084 167
167 3300027695 Ga0209966_1000046 Ga0209966_100004633 167
168 3300028379 Ga0268266_10053942 Ga0268266_100539422 167
169 3300037068 Ga0373925_0175771 Ga0373925_0175771_713_1273 167
170 3300037471 Ga0395905_0036167 Ga0395905_0036167_3980_4519 167
171 3300037471 Ga0395905_0059846 Ga0395905_0059846_957_1499 167
172 3300042132 Ga0450895_020713 Ga0450895_020713_34_588 167
173 3300042185 Ga0450909_032635 Ga0450909_032635_199_759 167
174 3300046475 Ga0495639_0381097 Ga0495639_0381097_38_622 167
175 3300046517 Ga0495630_0171136 Ga0495630_0171136_221_805 167
176 3300046526 Ga0495666_0078310 Ga0495666_0078310_658_1242 167
177 3300046690 Ga0495624_0044128 Ga0495624_0044128_1060_1644 167
178 3300047321 Ga0495676_0055352 Ga0495676_0055352_1691_2275 167
179 3300047673 Ga0495593_0133286 Ga0495593_0133286_55_639 167
180 3300048909 Ga0496106_0163454 Ga0496106_0163454_882_1442 167
181 3300048916 Ga0496113_0448783 Ga0496113_0448783_49_609 167
182 3300049653 Ga0501206_027179 Ga0501206_027179_248_787 167
183 3300049763 Ga0501266_014677 Ga0501266_014677_216_755 167
184 3300053086 Ga0500578_0139065 Ga0500578_0139065_239_799 167
185 3300053730 Ga0500645_024283 Ga0500645_024283_568_1128 167
186 3300005467 Ga0070706_100040369 Ga0070706_1000403692 168
187 3300005564 Ga0070664_101182758 Ga0070664_1011827581 168
188 3300009101 Ga0105247_10427240 Ga0105247_104272401 168
189 3300009553 Ga0105249_11199012 Ga0105249_111990121 168
190 3300013306 Ga0163162_10731170 Ga0163162_107311702 168
191 3300014326 Ga0157380_10698502 Ga0157380_106985022 168
192 3300025907 Ga0207645_10663452 Ga0207645_106634521 168
193 3300025910 Ga0207684_10169008 Ga0207684_101690082 168
194 3300028794 Ga0307515_10000013 Ga0307515_100000132 168
195 3300028794 Ga0307515_10000037 Ga0307515_10000037280 168
196 3300028794 Ga0307515_10037587 Ga0307515_100375879 168
197 3300031730 Ga0307516_10000164 Ga0307516_1000016433 168
198 3300031730 Ga0307516_10091116 Ga0307516_100911165 168
199 3300031911 Ga0307412_10004357 Ga0307412_100043573 168
200 3300031911 Ga0307412_11062602 Ga0307412_110626021 168
201 3300037471 Ga0395905_0162470 Ga0395905_0162470_989_1531 168
202 3300042007 Ga0439449_0010624 Ga0439449_0010624_2161_2703 168
203 3300042012 Ga0439455_0042469 Ga0439455_0042469_265_807 168
204 3300042134 Ga0450898_032783 Ga0450898_032783_39_581 168
205 3300042435 Ga0439434_0168139 Ga0439434_0168139_138_680 168
206 3300042439 Ga0439464_0071330 Ga0439464_0071330_263_820 168
207 3300042876 Ga0451577_0919678 Ga0451577_0919678_60_608 168
208 3300044683 Ga0466965_0172534 Ga0466965_0172534_384_926 168
209 3300044693 Ga0466961_0028716 Ga0466961_0028716_2281_2823 168
210 3300044706 Ga0466964_0163256 Ga0466964_0163256_308_850 168
211 3300044712 Ga0453684_0081723 Ga0453684_0081723_2350_2940 168
212 3300045051 Ga0451576_0020395 Ga0451576_0020395_3704_4294 168
213 3300045836 Ga0466958_0055320 Ga0466958_0055320_334_876 168
214 3300046475 Ga0495639_0140918 Ga0495639_0140918_350_916 168
215 3300048905 Ga0496102_0003913 Ga0496102_0003913_8183_8749 168
216 3300050509 nmdc:mga0qj67_281725_c1 nmdc:mga0qj67_281725_c1_48_605 168
217 iso_pu_bacteria 2585428058 2587736987 168
218 iso_pu_bacteria 2585428062 2587758086 168
219 iso_pu_bacteria 2643221592 2643967747 168
220 iso_pu_bacteria 2643221625 2644140569 168
221 iso_pu_bacteria 2643221648 2644273536 168
222 3300005330 Ga0070690_100001384 Ga0070690_10000138411 169
223 3300005353 Ga0070669_100056439 Ga0070669_1000564392 169
224 3300005364 Ga0070673_100660681 Ga0070673_1006606811 169
225 3300005367 Ga0070667_100279892 Ga0070667_1002798921 169
226 3300005445 Ga0070708_100073412 Ga0070708_1000734122 169
227 3300005459 Ga0068867_100574282 Ga0068867_1005742821 169
228 3300005543 Ga0070672_100136539 Ga0070672_1001365393 169
229 3300006178 Ga0075367_10117792 Ga0075367_101177922 169
230 3300006195 Ga0075366_10029464 Ga0075366_100294642 169
231 3300009094 Ga0111539_12217070 Ga0111539_122170701 169
232 3300009147 Ga0114129_10886992 Ga0114129_108869922 169
233 3300009148 Ga0105243_10238029 Ga0105243_102380292 169
234 3300009545 Ga0105237_11180532 Ga0105237_111805321 169
235 3300009553 Ga0105249_10574562 Ga0105249_105745622 169
236 3300013297 Ga0157378_10048638 Ga0157378_100486382 169
237 3300014325 Ga0163163_10311560 Ga0163163_103115602 169
238 3300014968 Ga0157379_10921037 Ga0157379_109210371 169
239 3300025253 Ga0209677_101817 Ga0209677_10181710 169
240 3300025893 Ga0207682_10076560 Ga0207682_100765602 169
241 3300025923 Ga0207681_10163776 Ga0207681_101637762 169
242 3300025935 Ga0207709_10509075 Ga0207709_105090751 169
243 3300025937 Ga0207669_10330611 Ga0207669_103306111 169
244 3300025941 Ga0207711_10919367 Ga0207711_109193671 169
245 3300025942 Ga0207689_10020983 Ga0207689_100209834 169
246 3300025960 Ga0207651_10353571 Ga0207651_103535712 169
247 3300026089 Ga0207648_10276104 Ga0207648_102761042 169
248 3300026121 Ga0207683_10110942 Ga0207683_101109423 169
249 3300028786 Ga0307517_10000394 Ga0307517_1000039432 169
250 3300028786 Ga0307517_10113786 Ga0307517_101137862 169
251 3300028786 Ga0307517_10140602 Ga0307517_101406022 169
252 3300028794 Ga0307515_10121955 Ga0307515_101219553 169
253 3300028794 Ga0307515_10274273 Ga0307515_102742732 169
254 3300031507 Ga0307509_10023601 Ga0307509_100236013 169
255 3300031616 Ga0307508_10000912 Ga0307508_1000091229 169
256 3300031730 Ga0307516_10137194 Ga0307516_101371941 169
257 3300031824 Ga0307413_10039868 Ga0307413_100398683 169
258 3300031903 Ga0307407_10248570 Ga0307407_102485702 169
259 3300033180 Ga0307510_10208656 Ga0307510_102086562 169
260 3300039447 Ga0436361_0231366 Ga0436361_0231366_2178_2720 169
261 3300044658 Ga0466972_0006140 Ga0466972_0006140_432_1007 169
262 3300044842 Ga0466957_0307821 Ga0466957_0307821_300_875 169
263 3300046492 Ga0495585_0268530 Ga0495585_0268530_277_834 169
264 3300046539 Ga0495621_0077078 Ga0495621_0077078_313_885 169
265 3300046660 Ga0495625_0029142 Ga0495625_0029142_1439_2029 169
266 3300046794 Ga0495589_0012863 Ga0495589_0012863_2511_3086 169
267 3300049578 Ga0501042_0126781 Ga0501042_0126781_1233_1787 169
268 3300049579 Ga0501043_0000012 Ga0501043_0000012_172368_172922 169
269 3300049580 Ga0501046_0000030 Ga0501046_0000030_172340_172894 169
270 3300049581 Ga0501047_0000049 Ga0501047_0000049_147037_147591 169
271 3300049582 Ga0501048_0001813 Ga0501048_0001813_14562_15116 169
272 3300049823 Ga0501044_0211044 Ga0501044_0211044_656_1210 169
273 3300049824 Ga0501045_0002489 Ga0501045_0002489_132_686 169
274 3300050493 nmdc:mga0k408_77192_c1 nmdc:mga0k408_77192_c1_233_793 169
275 3300050494 nmdc:mga06z11_91460_c1 nmdc:mga06z11_91460_c1_564_1124 169
276 3300050507 nmdc:mga05p37_278107_c1 nmdc:mga05p37_278107_c1_632_1192 169
277 3300053098 Ga0500650_0019913 Ga0500650_0019913_517_1107 169
278 3300053139 Ga0500568_0059275 Ga0500568_0059275_264_836 169
279 3300002773 JGI25152J39213_1011981 JGI25152J39213_10119812 170
280 3300003215 JGI25153J46596_10000416 JGI25153J46596_1000041620 170
281 3300003215 JGI25153J46596_10009702 JGI25153J46596_100097022 170
282 3300003322 rootL2_10006362 rootL2_100063622 170
283 3300005364 Ga0070673_100867174 Ga0070673_1008671741 170
284 3300005468 Ga0070707_100019837 Ga0070707_1000198372 170
285 3300005471 Ga0070698_100137461 Ga0070698_1001374612 170
286 3300005843 Ga0068860_100732141 Ga0068860_1007321412 170
287 3300005844 Ga0068862_100029865 Ga0068862_1000298656 170
288 3300006178 Ga0075367_10138155 Ga0075367_101381552 170
289 3300006195 Ga0075366_10049715 Ga0075366_100497154 170
290 3300009553 Ga0105249_11198510 Ga0105249_111985101 170
291 3300010375 Ga0105239_12086160 Ga0105239_120861601 170
292 3300025245 Ga0207425_1004340 Ga0207425_10043402 170
293 3300025258 Ga0209129_1000113 Ga0209129_1000113103 170
294 3300025273 Ga0209673_1011242 Ga0209673_10112422 170
295 3300025295 Ga0209564_1000186 Ga0209564_1000186103 170
296 3300025297 Ga0209758_1000172 Ga0209758_1000172103 170
297 3300025297 Ga0209758_1000304 Ga0209758_100030441 170
298 3300025299 Ga0209256_1083914 Ga0209256_10839141 170
299 3300025910 Ga0207684_10017578 Ga0207684_100175782 170
300 3300025922 Ga0207646_10624381 Ga0207646_106243811 170
301 3300025923 Ga0207681_10360200 Ga0207681_103602001 170
302 3300025961 Ga0207712_10603064 Ga0207712_106030641 170
303 3300028380 Ga0268265_10166411 Ga0268265_101664112 170
304 3300028381 Ga0268264_10932075 Ga0268264_109320752 170
305 3300031730 Ga0307516_10084315 Ga0307516_100843152 170
306 3300037418 Ga0395900_0000904 Ga0395900_0000904_3993_4550 170
307 3300037466 Ga0395898_0001196 Ga0395898_0001196_34666_35223 170
308 3300044656 Ga0466969_0033076 Ga0466969_0033076_2026_2583 170
309 3300044683 Ga0466965_0015474 Ga0466965_0015474_2633_3190 170
310 3300044684 Ga0466966_0027536 Ga0466966_0027536_2170_2727 170
311 3300044693 Ga0466961_0253405 Ga0466961_0253405_177_734 170
312 3300044694 Ga0466963_0029617 Ga0466963_0029617_485_1042 170
313 3300044706 Ga0466964_0022033 Ga0466964_0022033_1360_1917 170
314 3300044765 Ga0466970_0020049 Ga0466970_0020049_2369_2926 170
315 3300044842 Ga0466957_0164007 Ga0466957_0164007_835_1392 170
316 3300045049 Ga0466959_0000916 Ga0466959_0000916_12528_13085 170
317 3300045836 Ga0466958_0144732 Ga0466958_0144732_436_993 170
318 3300045976 Ga0466967_0080814 Ga0466967_0080814_38_595 170
319 3300050493 nmdc:mga0k408_119275_c1 nmdc:mga0k408_119275_c1_97_666 170
320 3300050493 nmdc:mga0k408_125778_c1 nmdc:mga0k408_125778_c1_800_1369 170
321 3300050494 nmdc:mga06z11_67809_c1 nmdc:mga06z11_67809_c1_415_984 170
322 3300061719 Ga0466962_0158800 Ga0466962_0158800_406_963 170
323 iso_pu_bacteria 2643221660 2644339185 170
324 3300005262 Ga0065165_1003834 Ga0065165_10038342 171
325 3300005328 Ga0070676_10232881 Ga0070676_102328812 171
326 3300005328 Ga0070676_10453022 Ga0070676_104530221 171
327 3300005355 Ga0070671_100381437 Ga0070671_1003814372 171
328 3300005364 Ga0070673_100506425 Ga0070673_1005064251 171
329 3300005457 Ga0070662_100286379 Ga0070662_1002863792 171
330 3300005539 Ga0068853_100033051 Ga0068853_1000330514 171
331 3300005577 Ga0068857_100015412 Ga0068857_1000154125 171
332 3300005578 Ga0068854_100080311 Ga0068854_1000803112 171
333 3300005616 Ga0068852_100111343 Ga0068852_1001113431 171
334 3300006048 Ga0075363_100021255 Ga0075363_1000212554 171
335 3300006051 Ga0075364_10035455 Ga0075364_100354553 171
336 3300006177 Ga0075362_10025128 Ga0075362_100251282 171
337 3300006177 Ga0075362_10026634 Ga0075362_100266342 171
338 3300006178 Ga0075367_10056484 Ga0075367_100564842 171
339 3300006178 Ga0075367_10105072 Ga0075367_101050722 171
340 3300006178 Ga0075367_10349311 Ga0075367_103493111 171
341 3300006195 Ga0075366_10046639 Ga0075366_100466393 171
342 3300006195 Ga0075366_10083402 Ga0075366_100834022 171
343 3300006195 Ga0075366_10092684 Ga0075366_100926842 171
344 3300006353 Ga0075370_10002677 Ga0075370_100026772 171
345 3300006353 Ga0075370_10004667 Ga0075370_100046672 171
346 3300006353 Ga0075370_10109744 Ga0075370_101097442 171
347 3300006353 Ga0075370_10298737 Ga0075370_102987371 171
348 3300006881 Ga0068865_100672638 Ga0068865_1006726382 171
349 3300009093 Ga0105240_10034252 Ga0105240_100342522 171
350 3300009098 Ga0105245_10230852 Ga0105245_102308522 171
351 3300009148 Ga0105243_10143730 Ga0105243_101437302 171
352 3300009148 Ga0105243_10633497 Ga0105243_106334972 171
353 3300009174 Ga0105241_10278483 Ga0105241_102784832 171
354 3300009545 Ga0105237_10004426 Ga0105237_100044265 171
355 3300009551 Ga0105238_10488470 Ga0105238_104884702 171
356 3300009553 Ga0105249_10547905 Ga0105249_105479052 171
357 3300010375 Ga0105239_10063541 Ga0105239_100635412 171
358 3300013308 Ga0157375_10290287 Ga0157375_102902873 171
359 3300025298 Ga0209050_1000489 Ga0209050_100048942 171
360 3300025303 Ga0209051_1012113 Ga0209051_10121133 171
361 3300025903 Ga0207680_10236408 Ga0207680_102364081 171
362 3300025907 Ga0207645_10192359 Ga0207645_101923592 171
363 3300025913 Ga0207695_10031958 Ga0207695_100319582 171
364 3300025914 Ga0207671_10024660 Ga0207671_100246602 171
365 3300025931 Ga0207644_10807861 Ga0207644_108078611 171
366 3300025933 Ga0207706_10146367 Ga0207706_101463672 171
367 3300025933 Ga0207706_10509119 Ga0207706_105091192 171
368 3300025934 Ga0207686_10369294 Ga0207686_103692942 171
369 3300025935 Ga0207709_10046945 Ga0207709_100469452 171
370 3300025935 Ga0207709_10351273 Ga0207709_103512731 171
371 3300025938 Ga0207704_10428517 Ga0207704_104285171 171
372 3300025942 Ga0207689_10033149 Ga0207689_100331492 171
373 3300025960 Ga0207651_10799199 Ga0207651_107991991 171
374 3300025961 Ga0207712_11281557 Ga0207712_112815571 171
375 3300025981 Ga0207640_10051812 Ga0207640_100518124 171
376 3300026041 Ga0207639_10027284 Ga0207639_100272842 171
377 3300026067 Ga0207678_10060519 Ga0207678_100605194 171
378 3300026116 Ga0207674_10018439 Ga0207674_100184392 171
379 3300026142 Ga0207698_10200976 Ga0207698_102009761 171
380 3300031456 Ga0307513_10106404 Ga0307513_101064043 171
381 3300031616 Ga0307508_10175321 Ga0307508_101753212 171
382 3300031649 Ga0307514_10067190 Ga0307514_100671902 171
383 3300031730 Ga0307516_10004805 Ga0307516_100048054 171
384 3300031730 Ga0307516_10229868 Ga0307516_102298682 171
385 3300041443 Ga0451789_0291111 Ga0451789_0291111_1501_2067 171
386 3300041456 Ga0451795_1056889 Ga0451795_1056889_490_1053 171
387 3300041463 Ga0451804_0431348 Ga0451804_0431348_1602_2168 171
388 3300041512 Ga0451853_2456265 Ga0451853_2456265_105_659 171
389 3300041512 Ga0451853_3681233 Ga0451853_3681233_186_752 171
390 3300042134 Ga0450898_072705 Ga0450898_072705_41_613 171
391 3300042532 Ga0450893_0023100 Ga0450893_0023100_446_1018 171
392 3300046460 Ga0495638_0028172 Ga0495638_0028172_2761_3327 171
393 3300046515 Ga0495620_0052156 Ga0495620_0052156_278_844 171
394 3300046519 Ga0495632_0037421 Ga0495632_0037421_1148_1708 171
395 3300046522 Ga0495643_0103084 Ga0495643_0103084_385_942 171
396 3300046538 Ga0495609_0117909 Ga0495609_0117909_547_1107 171
397 3300046692 Ga0495671_0180060 Ga0495671_0180060_428_988 171
398 3300046694 Ga0495649_0012421 Ga0495649_0012421_2705_3265 171
399 3300046810 Ga0495660_0037246 Ga0495660_0037246_1088_1648 171
400 3300047443 Ga0495687_000414 Ga0495687_000414_22510_23067 171
401 3300047443 Ga0495687_019317 Ga0495687_019317_1343_1903 171
402 3300047443 Ga0495687_035617 Ga0495687_035617_230_790 171
403 3300048091 Ga0495626_0005858 Ga0495626_0005858_309_869 171
404 3300050489 nmdc:mga03683_41714_c1 nmdc:mga03683_41714_c1_1283_1843 171
405 3300050491 nmdc:mga00v17_148194_c1 nmdc:mga00v17_148194_c1_396_953 171
406 3300050492 nmdc:mga0yw44_253628_c1 nmdc:mga0yw44_253628_c1_529_1086 171
407 3300050493 nmdc:mga0k408_16837_c1 nmdc:mga0k408_16837_c1_2375_2932 171
408 3300050493 nmdc:mga0k408_29814_c1 nmdc:mga0k408_29814_c1_1415_1972 171
409 3300050493 nmdc:mga0k408_3343_c1 nmdc:mga0k408_3343_c1_6212_6772 171
410 3300050493 nmdc:mga0k408_340706_c1 nmdc:mga0k408_340706_c1_297_857 171
411 3300050493 nmdc:mga0k408_36271_c1 nmdc:mga0k408_36271_c1_172_729 171
412 3300050493 nmdc:mga0k408_37149_c1 nmdc:mga0k408_37149_c1_1292_1852 171
413 3300050494 nmdc:mga06z11_43224_c1 nmdc:mga06z11_43224_c1_589_1146 171
414 3300050496 nmdc:mga07m45_3787_c1 nmdc:mga07m45_3787_c1_6539_7099 171
415 3300050496 nmdc:mga07m45_4440_c1 nmdc:mga07m45_4440_c1_3385_3945 171
416 3300050496 nmdc:mga07m45_5674_c1 nmdc:mga07m45_5674_c1_5424_5981 171
417 3300050516 nmdc:mga0sz30_31376_c1 nmdc:mga0sz30_31376_c1_1604_2164 171
418 3300053088 Ga0500644_0020880 Ga0500644_0020880_350_916 171
419 3300053090 Ga0500646_0018715 Ga0500646_0018715_479_1045 171
420 3300053098 Ga0500650_0048253 Ga0500650_0048253_1077_1643 171
421 3300053130 Ga0500642_0001693 Ga0500642_0001693_3056_3622 171
422 3300053131 Ga0500652_002916 Ga0500652_002916_2009_2575 171
423 3300053133 Ga0500655_006702 Ga0500655_006702_590_1156 171
424 3300053134 Ga0500658_0056748 Ga0500658_0056748_445_1005 171
425 3300053139 Ga0500568_0027685 Ga0500568_0027685_1333_1893 171
426 3300053151 Ga0500604_0001619 Ga0500604_0001619_233_805 171
427 3300053151 Ga0500604_0044930 Ga0500604_0044930_258_824 171
428 3300053156 Ga0500622_0000146 Ga0500622_0000146_43740_44306 171
429 3300055283 Ga0500661_046177 Ga0500661_046177_94_675 171
430 3300061719 Ga0466962_0344010 Ga0466962_0344010_19_639 171
431 iso_pu_bacteria 2886848708 2886853429 171
432 3300025918 Ga0207662_10211102 Ga0207662_102111021 172
433 3300030522 Ga0307512_10094851 Ga0307512_100948512 172
434 3300031507 Ga0307509_10000950 Ga0307509_1000095018 172
435 3300031901 Ga0307406_10067917 Ga0307406_100679172 172
436 3300032005 Ga0307411_11145617 Ga0307411_111456171 172
437 3300033180 Ga0307510_10018224 Ga0307510_100182246 172
438 3300033180 Ga0307510_10024351 Ga0307510_100243512 172
439 3300035691 Ga0373931_0107423 Ga0373931_0107423_567_1157 172
440 3300046454 Ga0495592_0007407 Ga0495592_0007407_6334_6912 172
441 3300046524 Ga0495648_0080880 Ga0495648_0080880_396_974 172
442 3300046690 Ga0495624_0621157 Ga0495624_0621157_24_617 172
443 3300053136 Ga0500559_0004161 Ga0500559_0004161_1162_1740 172
444 3300053154 Ga0500619_011735 Ga0500619_011735_761_1339 172
445 3300053156 Ga0500622_0010151 Ga0500622_0010151_1817_2395 172
446 3300055283 Ga0500661_037886 Ga0500661_037886_182_760 172
447 3300003752 Ga0055539_1000303 Ga0055539_10003032 173
448 3300003756 Ga0055533_1000043 Ga0055533_1000043134 173
449 3300003759 Ga0055525_1001652 Ga0055525_10016523 173
450 3300005328 Ga0070676_10003518 Ga0070676_100035182 173
451 3300005331 Ga0070670_100245930 Ga0070670_1002459302 173
452 3300005338 Ga0068868_100164969 Ga0068868_1001649692 173
453 3300005354 Ga0070675_100031487 Ga0070675_1000314877 173
454 3300005355 Ga0070671_100096575 Ga0070671_1000965752 173
455 3300005459 Ga0068867_100013526 Ga0068867_1000135262 173
456 3300005564 Ga0070664_100216756 Ga0070664_1002167562 173
457 3300005840 Ga0068870_10011020 Ga0068870_100110203 173
458 3300005841 Ga0068863_100166600 Ga0068863_1001666003 173
459 3300006353 Ga0075370_10030758 Ga0075370_100307582 173
460 3300006881 Ga0068865_100218226 Ga0068865_1002182262 173
461 3300009177 Ga0105248_10004608 Ga0105248_100046082 173
462 3300014745 Ga0157377_10603255 Ga0157377_106032551 173
463 3300025226 Ga0209674_100067 Ga0209674_100067135 173
464 3300025230 Ga0209563_100068 Ga0209563_100068135 173
465 3300025231 Ga0207427_100458 Ga0207427_10045815 173
466 3300025253 Ga0209677_100049 Ga0209677_10004926 173
467 3300025907 Ga0207645_10003682 Ga0207645_1000368214 173
468 3300025908 Ga0207643_10186592 Ga0207643_101865922 173
469 3300025925 Ga0207650_10112642 Ga0207650_101126422 173
470 3300025926 Ga0207659_10108646 Ga0207659_101086462 173
471 3300025931 Ga0207644_10050850 Ga0207644_100508502 173
472 3300025931 Ga0207644_10375023 Ga0207644_103750232 173
473 3300025933 Ga0207706_10135113 Ga0207706_101351132 173
474 3300025938 Ga0207704_10158481 Ga0207704_101584812 173
475 3300025941 Ga0207711_10040465 Ga0207711_100404652 173
476 3300025942 Ga0207689_10078525 Ga0207689_100785252 173
477 3300025981 Ga0207640_11034052 Ga0207640_110340521 173
478 3300026088 Ga0207641_10149112 Ga0207641_101491121 173
479 3300026089 Ga0207648_10003174 Ga0207648_1000317412 173
480 3300026116 Ga0207674_10068767 Ga0207674_100687672 173
481 3300046810 Ga0495660_0155214 Ga0495660_0155214_201_803 173
482 3300048911 Ga0496108_0108525 Ga0496108_0108525_1408_2013 173
483 3300048912 Ga0496109_0233412 Ga0496109_0233412_657_1262 173
484 3300048915 Ga0496112_0074530 Ga0496112_0074530_454_1059 173
485 3300048916 Ga0496113_0190853 Ga0496113_0190853_393_998 173
486 3300050496 nmdc:mga07m45_284_c1 nmdc:mga07m45_284_c1_2889_3452 173
487 3300005333 Ga0070677_10005141 Ga0070677_100051414 174
488 3300005333 Ga0070677_10216629 Ga0070677_102166291 174
489 3300005353 Ga0070669_100041589 Ga0070669_1000415892 174
490 3300005354 Ga0070675_100000811 Ga0070675_10000081121 174
491 3300005355 Ga0070671_100029927 Ga0070671_1000299271 174
492 3300005356 Ga0070674_100011059 Ga0070674_1000110592 174
493 3300005456 Ga0070678_100032954 Ga0070678_1000329541 174
494 3300005459 Ga0068867_100048805 Ga0068867_1000488053 174
495 3300005543 Ga0070672_100003173 Ga0070672_10000317311 174
496 3300005618 Ga0068864_100092822 Ga0068864_1000928222 174
497 3300005834 Ga0068851_10388426 Ga0068851_103884262 174
498 3300005840 Ga0068870_10085964 Ga0068870_100859642 174
499 3300006881 Ga0068865_100309765 Ga0068865_1003097652 174
500 3300017792 Ga0163161_10161461 Ga0163161_101614612 174
501 3300025315 Ga0207697_10076701 Ga0207697_100767012 174
502 3300025893 Ga0207682_10000902 Ga0207682_100009022 174
503 3300025893 Ga0207682_10208450 Ga0207682_102084501 174
504 3300025901 Ga0207688_10227998 Ga0207688_102279982 174
505 3300025907 Ga0207645_10224234 Ga0207645_102242342 174
506 3300025908 Ga0207643_10089492 Ga0207643_100894922 174
507 3300025923 Ga0207681_10035054 Ga0207681_100350542 174
508 3300025925 Ga0207650_10000580 Ga0207650_100005806 174
509 3300025926 Ga0207659_10001304 Ga0207659_100013045 174
510 3300025931 Ga0207644_10175200 Ga0207644_101752002 174
511 3300025937 Ga0207669_10004641 Ga0207669_100046418 174
512 3300025937 Ga0207669_10041839 Ga0207669_100418393 174
513 3300025938 Ga0207704_10184182 Ga0207704_101841822 174
514 3300025940 Ga0207691_10009625 Ga0207691_1000962511 174
515 3300025941 Ga0207711_10809730 Ga0207711_108097301 174
516 3300025986 Ga0207658_10687325 Ga0207658_106873251 174
517 3300026089 Ga0207648_10003741 Ga0207648_100037412 174
518 3300026095 Ga0207676_10041455 Ga0207676_100414552 174
519 3300026121 Ga0207683_10051560 Ga0207683_100515601 174
520 3300028379 Ga0268266_10076779 Ga0268266_100767792 174
521 3300025920 Ga0207649_11043061 Ga0207649_110430611 176
522 3300011119 Ga0105246_10272765 Ga0105246_102727652 177
523 3300003320 rootH2_10007281 rootH2_100072812 178
524 3300002705 JGI25156J39149_1000063 JGI25156J39149_100006325 179
525 3300002738 JGI25154J39366_1000533 JGI25154J39366_100053313 179
526 3300002741 JGI25157J39369_1000082 JGI25157J39369_100008248 179
527 3300005327 Ga0070658_10309099 Ga0070658_103090991 179
528 3300005563 Ga0068855_100002610 Ga0068855_1000026102 179
529 3300005563 Ga0068855_100628480 Ga0068855_1006284802 179
530 3300005577 Ga0068857_100013771 Ga0068857_1000137712 179
531 3300005578 Ga0068854_100009344 Ga0068854_1000093442 179
532 3300005614 Ga0068856_100157132 Ga0068856_1001571322 179
533 3300005616 Ga0068852_100425956 Ga0068852_1004259561 179
534 3300009093 Ga0105240_10333179 Ga0105240_103331792 179
535 3300009545 Ga0105237_10257989 Ga0105237_102579892 179
536 3300009551 Ga0105238_10014149 Ga0105238_100141496 179
537 3300010375 Ga0105239_10029492 Ga0105239_100294924 179
538 3300013105 Ga0157369_10103155 Ga0157369_101031552 179
539 3300013306 Ga0163162_10058038 Ga0163162_100580384 179
540 3300013307 Ga0157372_10512941 Ga0157372_105129412 179
541 3300025242 Ga0209258_100459 Ga0209258_10045935 179
542 3300025246 Ga0209646_1000244 Ga0209646_100024425 179
543 3300025250 Ga0209026_1000004 Ga0209026_1000004700 179
544 3300025253 Ga0209677_100413 Ga0209677_10041322 179
545 3300025256 Ga0209759_1000003 Ga0209759_100000325 179
546 3300025913 Ga0207695_10233155 Ga0207695_102331552 179
547 3300025944 Ga0207661_10191831 Ga0207661_101918312 179
548 3300025949 Ga0207667_10011062 Ga0207667_100110621 179
549 3300025981 Ga0207640_10091037 Ga0207640_100910371 179
550 3300026078 Ga0207702_10000525 Ga0207702_100005254 179
551 3300026089 Ga0207648_10467623 Ga0207648_104676231 179
552 3300026116 Ga0207674_10145160 Ga0207674_101451602 179
553 3300026121 Ga0207683_10383060 Ga0207683_103830602 179
554 3300026142 Ga0207698_10284767 Ga0207698_102847672 179
555 3300035086 Ga0373934_0008867 Ga0373934_0008867_2444_3094 179
556 3300053080 Ga0500635_0000322 Ga0500635_0000322_14246_14821 179
557 3300053136 Ga0500559_0019920 Ga0500559_0019920_1652_2227 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13404

HTH_AsnC-type

AsnC-type helix-turn-helix domain

60

101

0.99

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

60

107

0.98

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

126

200

0.94

Feature Viewer

pLDDT pTM Quality
68.98 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map