F463356

General Info

Members Datasets Scaffolds Average Seq Length
557 407 368 109

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0006731|Ga0496124_0006731_7427_7822
Length 131
Sequence MIAEAFTSGNVGREGIANEDKTMITCFIRYEIDPFRQDAFAAYARKWGQAIPRCGAGLIGYFGPHEGSATTAYGVYTIESLAAYEAYRSRLAADPLGRENYEFAKSERFILREDRIFLKNVSLPHAVQATS

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
14 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
15 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
16 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
17 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
18 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
19 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
20 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
21 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
22 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
23 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
24 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
25 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
26 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
27 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
28 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
29 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
30 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
31 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
32 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
33 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
34 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
35 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
36 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
37 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
38 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
39 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
40 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
41 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
42 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
43 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
44 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
45 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
46 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
47 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
48 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
49 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
50 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
51 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
52 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
53 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
54 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
55 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
56 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
57 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
58 2643221599 Rhizobium sp. Root708 Isolate Unclassified
59 2643221607 Rhizobium sp. Root73 Isolate Unclassified
60 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
61 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
62 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
63 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
64 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
65 2718217882 Rhizobium sp. N741 Isolate Nodule
66 2718217927 Rhizobium sp. N324 Isolate Nodule
67 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
68 2718218009 Rhizobium sp. N561 Isolate Nodule
69 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
70 2718218363 Rhizobium sp. N113 Isolate Nodule
71 2718218365 Rhizobium sp. N731 Isolate Nodule
72 2718218366 Rhizobium sp. N621 Isolate Nodule
73 2718218423 Rhizobium sp. N941 Isolate Nodule
74 2721755514 Rhizobium sp. N6212 Isolate Nodule
75 2721755809 Rhizobium sp. N541 Isolate Nodule
76 2721755810 Rhizobium sp. N871 Isolate Nodule
77 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
78 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
79 2728369365 Rhizobium sp. N1341 Isolate Nodule
80 2728369397 Rhizobium sp. N1314 Isolate Nodule
81 2738541293 Rhizobium sp. GV031 Isolate Unclassified
82 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
83 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
84 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
85 2791355260 Rhizobium sp. L9 Isolate Nodule
86 2791355263 Rhizobium chutanense C5 Isolate Nodule
87 2791355264 Rhizobium sp. S9 Isolate Nodule
88 2791355265 Rhizobium sp. H4 Isolate Nodule
89 2791355266 Rhizobium sp. L43 Isolate Nodule
90 2791355267 Rhizobium sp. L18 Isolate Nodule
91 2802429633 Rhizobium anhuiense J3 Isolate Nodule
92 2802429634 Rhizobium anhuiense S10 Isolate Nodule
93 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
94 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
95 2802429637 Rhizobium anhuiense C15 Isolate Nodule
96 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
97 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
98 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
99 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
100 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
101 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
102 2838048938 Rhizobium pisi 27/80 Isolate Nodule
103 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
104 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
105 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
106 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
107 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
108 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
109 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
110 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
111 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
112 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
113 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
114 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
115 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
116 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
117 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
118 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
119 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
120 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
121 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
122 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
123 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
124 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
125 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
126 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
127 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
128 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
129 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
130 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
131 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
132 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
133 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
134 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
135 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
136 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
137 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
138 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
139 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
140 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
141 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
142 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
143 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
144 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
145 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
146 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
147 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
148 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
149 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
150 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
151 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
152 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
153 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
154 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
155 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
156 2936381700 Rhizobium chutanense C16 Isolate Unclassified
157 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
158 2996887358 Rhizobium sp. R711 Isolate Nodule
159 2996893221 Rhizobium sp. R635 Isolate Nodule
160 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
161 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
162 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
163 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
164 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
165 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
166 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
167 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
168 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
169 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
170 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
171 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
172 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
173 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
174 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
175 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
176 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
177 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
178 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
179 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
180 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
181 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
182 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
183 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
184 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
185 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
186 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
187 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
188 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
189 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
190 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
191 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
192 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
193 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
194 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
195 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
196 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
197 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
198 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
199 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
200 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
201 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
202 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
203 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
204 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
205 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
206 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
207 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
208 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
209 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
210 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
211 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
212 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
213 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
214 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
215 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
216 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
217 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
218 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
219 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
220 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
221 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
222 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
223 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
224 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
225 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
226 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
227 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
228 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
230 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
231 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
232 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
233 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
236 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
237 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
238 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
242 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
244 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
245 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
246 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
249 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
277 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
278 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
279 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
280 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
281 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
282 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
283 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
284 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
285 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
286 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
287 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
288 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
291 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
292 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
293 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
294 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
295 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
296 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
297 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
298 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
299 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
300 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
301 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
302 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
303 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
304 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
305 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
306 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
307 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
308 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
309 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
310 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
311 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
312 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
313 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
314 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
315 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
316 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
317 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
318 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
319 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
320 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
326 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
327 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
332 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
333 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
342 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
343 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
344 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
345 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
353 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
369 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
370 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
371 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
372 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
373 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
374 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
375 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
378 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
379 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
380 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
381 8005258706 Rhizobium sp. R693 Isolate Nodule
382 8005275841 Rhizobium sp. N4311 Isolate Nodule
383 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
384 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
385 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
386 8005321885 Rhizobium sp. R72 Isolate Nodule
387 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
388 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
389 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
390 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
391 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
392 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
393 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
394 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
395 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
396 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
397 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
398 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
399 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
400 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
401 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
402 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
403 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
404 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
405 8056382006 Rhizobium croatiense 13T Isolate Nodule
406 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
407 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.89
Metatranscriptomes 0.18
Isolates 33.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.44
Nodule 24.42
Rhizoplane 2.33
Rhizosphere 29.44
Stem 0
Stem Tuber 0
Unclassified 21.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000006 3300002704 Bacteria 244109
2 JGI25156J39149_1000019 3300002705 Bacteria 160845
3 JGI25162J39368_1000694 3300002737 Bacteria 23425
4 JGI25154J39366_1000055 3300002738 Bacteria 115597
5 JGI25154J39366_1000085 3300002738 Bacteria 87994
6 JGI25157J39369_1000024 3300002741 Bacteria 160844
7 JGI25152J39213_1000535 3300002773 Bacteria 20987
8 JGI25152J39213_1011298 3300002773 Bacteria 1982
9 JGI25152J39213_1011306 3300002773 Bacteria 1982
10 JGI25150J39212_1001554 3300002774 Bacteria 6283
11 JGI25151J46595_10000101 3300003187 Bacteria 115630
12 JGI25151J46595_10060082 3300003187 Bacteria 1218
13 JGI25151J46595_10072163 3300003187 Bacteria 1039
14 JGI25165J46597_1000579 3300003214 Bacteria 32228
15 JGI25165J46597_1000786 3300003214 Bacteria 24098
16 JGI25165J46597_1010477 3300003214 Bacteria 1350
17 JGI25153J46596_10006266 3300003215 Bacteria 6079
18 JGI25153J46596_10027659 3300003215 Bacteria 1982
19 JGI25153J46596_10027667 3300003215 Bacteria 1982
20 JGI25153J46596_10110244 3300003215 Bacteria 633
21 rootH1_10089087 3300003323 Bacteria 1234
22 rootH1_10089088 3300003323 Bacteria 2266
23 JGI25160J50197_1000053 3300003354 Bacteria 127632
24 JGI25161J50226_1000039 3300003374 Bacteria 127632
25 Ga0006562J51391_1093880 3300003578 Bacteria 1510
26 Ga0055539_1015486 3300003752 Bacteria 927
27 Ga0055529_1008764 3300003763 Bacteria 1340
28 Ga0055526_1001894 3300003771 Bacteria 14507
29 Ga0055526_1011312 3300003771 Bacteria 4038
30 Ga0055526_1042331 3300003771 Bacteria 1123
31 Ga0055524_1001954 3300003775 Bacteria 11078
32 Ga0055524_1011735 3300003775 Bacteria 3404
33 Ga0055524_1014428 3300003775 Bacteria 2927
34 Ga0055524_1042462 3300003775 Bacteria 1131
35 Ga0055524_1061896 3300003775 Bacteria 771
36 Ga0055528_1000462 3300003790 Bacteria 32478
37 Ga0055528_1001362 3300003790 Bacteria 15061
38 Ga0055528_1001502 3300003790 Bacteria 14137
39 Ga0055528_1061242 3300003790 Bacteria 710
40 Ga0055540_1015016 3300003792 Bacteria 2277
41 Ga0055531_10078369 3300003794 Bacteria 736
42 Ga0055543_1000015 3300004625 Bacteria 177197
43 Ga0065165_1000361 3300005262 Bacteria 74514
44 Ga0070658_10006679 3300005327 Bacteria 9349
45 Ga0070658_11010442 3300005327 Bacteria 723
46 Ga0070683_100019651 3300005329 Bacteria 6002
47 Ga0070668_101939959 3300005347 Bacteria 543
48 Ga0070671_100223664 3300005355 Bacteria 1597
49 Ga0070663_100157295 3300005455 Bacteria 1747
50 Ga0070684_100103824 3300005535 Bacteria 2543
51 Ga0068853_100513520 3300005539 Bacteria 1132
52 Ga0070665_100033014 3300005548 Bacteria 5208
53 Ga0070665_100391632 3300005548 Bacteria 1397
54 Ga0070664_100834079 3300005564 Bacteria 863
55 Ga0068854_100013817 3300005578 Bacteria 5310
56 Ga0068856_100379304 3300005614 Bacteria 1433
57 Ga0068852_100059793 3300005616 Bacteria 3306
58 Ga0068851_10030219 3300005834 Bacteria 2686
59 Ga0068858_100839150 3300005842 Bacteria 897
60 Ga0068860_101169690 3300005843 Bacteria 789
61 Ga0075363_100470256 3300006048 Bacteria 744
62 Ga0075364_10000158 3300006051 Bacteria 29918
63 Ga0075364_10334368 3300006051 Bacteria 1032
64 Ga0075362_10449014 3300006177 Bacteria 655
65 Ga0075367_10203792 3300006178 Bacteria 1236
66 Ga0075370_10010900 3300006353 Bacteria 4765
67 Ga0075370_10845167 3300006353 Bacteria 559
68 Ga0105251_10010458 3300009011 Bacteria 5382
69 Ga0105244_10103175 3300009036 Bacteria 1393
70 Ga0105250_10250128 3300009092 Bacteria 757
71 Ga0105240_10000027 3300009093 Bacteria 348486
72 Ga0105248_10103549 3300009177 Bacteria 3208
73 Ga0105248_11148307 3300009177 Bacteria 878
74 Ga0105248_11951652 3300009177 Bacteria 666
75 Ga0105237_10003395 3300009545 Bacteria 18937
76 Ga0105249_10136101 3300009553 Bacteria 2351
77 Ga0123341_1000528 3300009765 Bacteria 23671
78 Ga0105239_10434811 3300010375 Bacteria 1487
79 Ga0157322_1000837 3300012490 Bacteria 1335
80 Ga0157373_10173694 3300013100 Bacteria 1516
81 Ga0157371_11272899 3300013102 Bacteria 568
82 Ga0157370_10000048 3300013104 Bacteria 124683
83 Ga0157369_10621337 3300013105 Bacteria 1115
84 Ga0157375_10141092 3300013308 Bacteria 2536
85 Ga0157380_10790653 3300014326 Bacteria 965
86 Ga0182008_10007814 3300014497 Bacteria 5882
87 Ga0182007_10004419 3300015262 Bacteria 6372
88 Ga0182005_1006489 3300015265 Bacteria 3569
89 Ga0163161_11023337 3300017792 Bacteria 706
90 Ga0163161_11237222 3300017792 Bacteria 647
91 Ga0214542_1021364 3300021321 Bacteria 4470
92 Ga0214543_1000003 3300021327 Bacteria 692327
93 Ga0209435_100011 3300025206 Bacteria 413027
94 Ga0209435_120067 3300025206 Bacteria 659
95 Ga0209672_111310 3300025228 Bacteria 1160
96 Ga0209437_100033 3300025233 Bacteria 512520
97 Ga0209437_100036 3300025233 Bacteria 469153
98 Ga0207425_1000071 3300025245 Bacteria 116125
99 Ga0207425_1006231 3300025245 Bacteria 3286
100 Ga0209646_1000024 3300025246 Bacteria 413027
101 Ga0209646_1007038 3300025246 Bacteria 1859
102 Ga0209646_1029059 3300025246 Bacteria 752
103 Ga0209026_1000030 3300025250 Bacteria 329811
104 Ga0209677_100188 3300025253 Bacteria 50341
105 Ga0209148_1008523 3300025254 Bacteria 2054
106 Ga0209759_1000011 3300025256 Bacteria 413027
107 Ga0209129_1000143 3300025258 Bacteria 116125
108 Ga0209129_1000688 3300025258 Bacteria 22158
109 Ga0209129_1000804 3300025258 Bacteria 19806
110 Ga0209129_1002350 3300025258 Bacteria 9354
111 Ga0209233_1000056 3300025261 Bacteria 438104
112 Ga0209233_1000152 3300025261 Bacteria 175910
113 Ga0209233_1000271 3300025261 Bacteria 73658
114 Ga0209565_1082977 3300025263 Bacteria 525
115 Ga0209455_1010365 3300025272 Bacteria 2374
116 Ga0209673_1000015 3300025273 Bacteria 530618
117 Ga0209673_1000091 3300025273 Bacteria 201875
118 Ga0209673_1002233 3300025273 Bacteria 14035
119 Ga0209673_1006307 3300025273 Bacteria 5758
120 Ga0209673_1008282 3300025273 Bacteria 4642
121 Ga0209673_1042870 3300025273 Bacteria 1269
122 Ga0209673_1124176 3300025273 Bacteria 522
123 Ga0209130_1000038 3300025284 Bacteria 264226
124 Ga0209130_1018558 3300025284 Bacteria 1630
125 Ga0209130_1035718 3300025284 Bacteria 992
126 Ga0209676_1022774 3300025292 Bacteria 2067
127 Ga0209676_1023249 3300025292 Bacteria 2032
128 Ga0209025_1000280 3300025294 Bacteria 116125
129 Ga0209025_1002313 3300025294 Bacteria 20641
130 Ga0209025_1005340 3300025294 Bacteria 10539
131 Ga0209025_1012947 3300025294 Bacteria 5290
132 Ga0209025_1020786 3300025294 Bacteria 3567
133 Ga0209025_1023281 3300025294 Bacteria 3244
134 Ga0209025_1047656 3300025294 Bacteria 1747
135 Ga0209025_1077025 3300025294 Bacteria 1152
136 Ga0209564_1001024 3300025295 Bacteria 34391
137 Ga0209564_1006842 3300025295 Bacteria 6022
138 Ga0209564_1024099 3300025295 Bacteria 2089
139 Ga0209564_1041814 3300025295 Bacteria 1224
140 Ga0209564_1056831 3300025295 Bacteria 906
141 Ga0209758_1000235 3300025297 Bacteria 116093
142 Ga0209758_1001580 3300025297 Bacteria 26036
143 Ga0209758_1001626 3300025297 Bacteria 25578
144 Ga0209758_1010498 3300025297 Bacteria 5530
145 Ga0209758_1016297 3300025297 Bacteria 3784
146 Ga0209050_1020363 3300025298 Bacteria 2472
147 Ga0209256_1000461 3300025299 Bacteria 61432
148 Ga0209256_1002464 3300025299 Bacteria 15050
149 Ga0209256_1002564 3300025299 Bacteria 14518
150 Ga0209256_1008615 3300025299 Bacteria 4679
151 Ga0209256_1025268 3300025299 Bacteria 1734
152 Ga0209256_1037338 3300025299 Bacteria 1266
153 Ga0209256_1112985 3300025299 Bacteria 543
154 Ga0207426_1000081 3300025302 Bacteria 304502
155 Ga0207426_1002120 3300025302 Bacteria 13610
156 Ga0209051_1000408 3300025303 Bacteria 59354
157 Ga0209051_1014063 3300025303 Bacteria 3757
158 Ga0209051_1080656 3300025303 Bacteria 940
159 Ga0209051_1106932 3300025303 Bacteria 739
160 Ga0209257_1010762 3300025304 Bacteria 4551
161 Ga0207656_10022995 3300025321 Bacteria 2505
162 Ga0207696_1119549 3300025711 Bacteria 711
163 Ga0207680_10310163 3300025903 Bacteria 1101
164 Ga0207645_10421828 3300025907 Bacteria 899
165 Ga0207705_10032543 3300025909 Bacteria 3727
166 Ga0207705_10426639 3300025909 Bacteria 1027
167 Ga0207695_10000024 3300025913 Bacteria 632311
168 Ga0207671_10001033 3300025914 Bacteria 33897
169 Ga0207650_11339117 3300025925 Bacteria 609
170 Ga0207644_10106023 3300025931 Bacteria 2118
171 Ga0207711_10809904 3300025941 Bacteria 872
172 Ga0207661_10021885 3300025944 Bacteria 4800
173 Ga0207679_12053353 3300025945 Bacteria 520
174 Ga0207667_10248227 3300025949 Bacteria 1821
175 Ga0207668_11954032 3300025972 Bacteria 529
176 Ga0207640_10141992 3300025981 Bacteria 1752
177 Ga0207658_10690167 3300025986 Bacteria 922
178 Ga0207703_10882770 3300026035 Bacteria 856
179 Ga0207639_11105766 3300026041 Bacteria 743
180 Ga0207678_10789674 3300026067 Bacteria 838
181 Ga0207702_10377999 3300026078 Bacteria 1362
182 Ga0207698_10025819 3300026142 Bacteria 4146
183 Ga0209371_1001704 3300027312 Bacteria 13933
184 Ga0268266_10039757 3300028379 Bacteria 4007
185 Ga0268266_10085470 3300028379 Bacteria 2756
186 Ga0268266_10184364 3300028379 Bacteria 1902
187 Ga0268265_11577352 3300028380 Bacteria 661
188 Ga0268264_11806533 3300028381 Bacteria 621
189 Ga0307515_10216907 3300028794 Bacteria 1742
190 Ga0268256_1003117 3300030500 Bacteria 7730
191 Ga0268256_1077058 3300030500 Bacteria 631
192 Ga0307513_10002593 3300031456 Bacteria 24972
193 Ga0307513_10305939 3300031456 Bacteria 1354
194 Ga0307408_100007792 3300031548 Bacteria 7078
195 Ga0307408_100558167 3300031548 Bacteria 1011
196 Ga0307405_10007316 3300031731 Bacteria 5508
197 Ga0307405_10333131 3300031731 Bacteria 1164
198 Ga0307413_11527859 3300031824 Bacteria 591
199 Ga0307410_10436440 3300031852 Bacteria 1065
200 Ga0307406_10137171 3300031901 Bacteria 1726
201 Ga0307412_10000826 3300031911 Bacteria 17849
202 Ga0307412_10191344 3300031911 Bacteria 1547
203 Ga0307412_12283315 3300031911 Bacteria 505
204 Ga0307409_100609938 3300031995 Bacteria 1080
205 Ga0307416_101177752 3300032002 Bacteria 872
206 Ga0307416_101989295 3300032002 Bacteria 684
207 Ga0307414_10376612 3300032004 Bacteria 1226
208 Ga0373927_0000105 3300035695 Bacteria 63459
209 Ga0373925_0027305 3300037068 Bacteria 4180
210 Ga0400483_036611 3300039062 Bacteria 1070
211 Ga0436365_0552110 3300039437 Bacteria 658
212 Ga0439436_0025905 3300041404 Bacteria 1721
213 Ga0439438_036844 3300041405 Bacteria 1281
214 Ga0439466_0029961 3300041411 Bacteria 1869
215 Ga0439465_0020462 3300041413 Bacteria 2073
216 Ga0451793_0650579 3300041452 Bacteria 1368
217 Ga0451807_2355181 3300041486 Bacteria 605
218 Ga0451833_0611574 3300041491 Bacteria 1612
219 Ga0451839_1317335 3300041496 Bacteria 3928
220 Ga0451839_1390509 3300041496 Bacteria 1104
221 Ga0451841_0264814 3300041498 Bacteria 1428
222 Ga0451845_0053732 3300041501 Bacteria 1300
223 Ga0451847_0198349 3300041503 Bacteria 1226
224 Ga0451849_0596962 3300041505 Bacteria 667
225 Ga0451853_1550108 3300041512 Bacteria 2903
226 Ga0451853_2367273 3300041512 Bacteria 1043
227 Ga0439431_0047912 3300041997 Bacteria 1103
228 Ga0439445_0262303 3300042004 Bacteria 517
229 Ga0439432_115634 3300042006 Bacteria 796
230 Ga0439449_0021920 3300042007 Bacteria 2391
231 Ga0439449_0124863 3300042007 Bacteria 956
232 Ga0439462_0007255 3300042015 Bacteria 2771
233 Ga0450907_038840 3300042146 Bacteria 814
234 Ga0439434_0051994 3300042435 Bacteria 1271
235 Ga0466966_0294614 3300044684 Bacteria 975
236 Ga0466963_0005516 3300044694 Bacteria 7404
237 Ga0466971_0123112 3300044719 Bacteria 1201
238 Ga0466970_0005605 3300044765 Bacteria 6237
239 Ga0466958_0011112 3300045836 Bacteria 5064
240 Ga0466967_0132900 3300045976 Bacteria 2312
241 Ga0466967_1370606 3300045976 Bacteria 704
242 Ga0495590_0097916 3300046457 Bacteria 1041
243 Ga0495585_0050694 3300046492 Bacteria 2302
244 Ga0495607_0038132 3300046501 Bacteria 2881
245 Ga0495583_0007111 3300046506 Bacteria 7140
246 Ga0495606_0305162 3300046507 Bacteria 861
247 Ga0495610_0276423 3300046512 Bacteria 656
248 Ga0495610_0385936 3300046512 Bacteria 520
249 Ga0495620_0123451 3300046515 Bacteria 1019
250 Ga0495643_0113920 3300046522 Bacteria 1372
251 Ga0495643_0157703 3300046522 Bacteria 1119
252 Ga0495648_0066874 3300046524 Bacteria 2105
253 Ga0495654_0000043 3300046530 Bacteria 161913
254 Ga0495625_0025943 3300046660 Bacteria 4434
255 Ga0495625_0242059 3300046660 Bacteria 1174
256 Ga0495625_0420480 3300046660 Bacteria 831
257 Ga0495588_0459366 3300046674 Bacteria 668
258 Ga0495670_0395614 3300046691 Bacteria 746
259 Ga0495671_0242894 3300046692 Bacteria 870
260 Ga0495671_0258810 3300046692 Bacteria 840
261 Ga0495649_0137782 3300046694 Bacteria 1286
262 Ga0495681_0234678 3300047470 Bacteria 730
263 Ga0496101_0188327 3300048904 Bacteria 1592
264 Ga0496102_0015629 3300048905 Bacteria 6612
265 Ga0496102_1745533 3300048905 Bacteria 540
266 Ga0496103_0005197 3300048906 Bacteria 7831
267 Ga0496106_0182695 3300048909 Bacteria 1665
268 Ga0496107_1270836 3300048910 Bacteria 527
269 Ga0496110_0093484 3300048913 Bacteria 2692
270 Ga0496111_0005942 3300048914 Bacteria 7873
271 Ga0496111_0216752 3300048914 Bacteria 1422
272 Ga0496116_0002550 3300048919 Bacteria 19037
273 Ga0496116_0022034 3300048919 Bacteria 4790
274 Ga0496116_0026017 3300048919 Bacteria 4289
275 Ga0496116_0066095 3300048919 Bacteria 2315
276 Ga0496116_0094360 3300048919 Bacteria 1809
277 Ga0496116_0323225 3300048919 Bacteria 721
278 Ga0496117_0004982 3300048920 Bacteria 14248
279 Ga0496117_0019927 3300048920 Bacteria 5488
280 Ga0496117_0086382 3300048920 Bacteria 2038
281 Ga0496118_0001729 3300048921 Bacteria 31774
282 Ga0496118_0014319 3300048921 Bacteria 7433
283 Ga0496118_0017468 3300048921 Bacteria 6527
284 Ga0496118_0031246 3300048921 Bacteria 4419
285 Ga0496118_0034536 3300048921 Bacteria 4123
286 Ga0496119_0017955 3300048922 Bacteria 5291
287 Ga0496119_0030450 3300048922 Bacteria 3637
288 Ga0496119_0154454 3300048922 Bacteria 1227
289 Ga0496120_0130065 3300048923 Bacteria 1290
290 Ga0496120_0228998 3300048923 Bacteria 883
291 Ga0496120_0323887 3300048923 Bacteria 699
292 Ga0496121_0003867 3300048924 Bacteria 20816
293 Ga0496121_0007012 3300048924 Bacteria 13688
294 Ga0496121_0024967 3300048924 Bacteria 5693
295 Ga0496121_0027206 3300048924 Bacteria 5357
296 Ga0496121_0029286 3300048924 Bacteria 5098
297 Ga0496121_0032514 3300048924 Bacteria 4740
298 Ga0496121_0080845 3300048924 Bacteria 2574
299 Ga0496121_0149552 3300048924 Bacteria 1720
300 Ga0496121_0178319 3300048924 Bacteria 1536
301 Ga0496121_0187809 3300048924 Bacteria 1485
302 Ga0496121_0466864 3300048924 Bacteria 809
303 Ga0496122_0000009 3300048925 Bacteria 584024
304 Ga0496122_0014830 3300048925 Bacteria 7505
305 Ga0496122_0024378 3300048925 Bacteria 5295
306 Ga0496122_0031680 3300048925 Bacteria 4392
307 Ga0496122_0038296 3300048925 Bacteria 3844
308 Ga0496122_0047345 3300048925 Bacteria 3320
309 Ga0496122_0048600 3300048925 Bacteria 3258
310 Ga0496122_0061134 3300048925 Bacteria 2767
311 Ga0496122_0117323 3300048925 Bacteria 1728
312 Ga0496123_0000020 3300048926 Bacteria 388748
313 Ga0496123_0007813 3300048926 Bacteria 9957
314 Ga0496123_0013063 3300048926 Bacteria 7009
315 Ga0496123_0014722 3300048926 Bacteria 6462
316 Ga0496123_0017732 3300048926 Bacteria 5708
317 Ga0496123_0026033 3300048926 Bacteria 4395
318 Ga0496123_0041383 3300048926 Bacteria 3195
319 Ga0496124_0006731 3300048927 Bacteria 12430
320 Ga0496124_0018298 3300048927 Bacteria 6565
321 Ga0496124_0021655 3300048927 Bacteria 5920
322 Ga0496124_0032000 3300048927 Bacteria 4652
323 Ga0496124_0059972 3300048927 Bacteria 3194
324 Ga0496124_0083799 3300048927 Bacteria 2615
325 Ga0496124_0087306 3300048927 Bacteria 2551
326 Ga0496124_0091653 3300048927 Bacteria 2476
327 Ga0496124_0144374 3300048927 Bacteria 1874
328 Ga0496124_0447051 3300048927 Bacteria 882
329 Ga0496125_0006739 3300048928 Bacteria 12344
330 Ga0496125_0016874 3300048928 Bacteria 6992
331 Ga0496125_0022378 3300048928 Bacteria 5871
332 Ga0496125_0181915 3300048928 Bacteria 1399
333 Ga0496125_0214834 3300048928 Bacteria 1245
334 Ga0496126_0002880 3300048929 Bacteria 22450
335 Ga0496126_0118626 3300048929 Bacteria 2297
336 Ga0496126_0237241 3300048929 Bacteria 1525
337 Ga0495678_097919 3300049459 Bacteria 1021
338 Ga0501031_0823798 3300049568 Bacteria 595
339 Ga0501032_0066920 3300049569 Bacteria 2401
340 Ga0501037_0357394 3300049573 Bacteria 1007
341 Ga0501040_0347641 3300049576 Bacteria 1062
342 Ga0501070_0433625 3300049586 Bacteria 1061
343 Ga0501073_0567016 3300049589 Bacteria 784
344 Ga0501075_0846522 3300049591 Bacteria 696
345 Ga0501080_0110078 3300049742 Bacteria 2553
346 Ga0501083_0117843 3300049744 Bacteria 1742
347 nmdc:mga03683_124960_c1 3300050489 Bacteria 1147
348 nmdc:mga03683_393764_c1 3300050489 Bacteria 661
349 nmdc:mga03n38_140840_c1 3300050490 Bacteria 1204
350 nmdc:mga00v17_522598_c1 3300050491 Bacteria 768
351 nmdc:mga0yw44_50810_c2 3300050492 Bacteria 2181
352 nmdc:mga07m45_899237_c1 3300050496 Bacteria 506
353 nmdc:mga0sz30_193617_c1 3300050516 Bacteria 902
354 Ga0500654_059149 3300053099 Bacteria 1979
355 Ga0500594_0251806 3300053118 Bacteria 588
356 Ga0500597_235443 3300053120 Bacteria 755
357 Ga0500618_000007 3300053125 Bacteria 226268
358 Ga0500618_011357 3300053125 Bacteria 2364
359 Ga0500618_048423 3300053125 Bacteria 965
360 Ga0500655_009320 3300053133 Bacteria 1769
361 Ga0500658_0001892 3300053134 Bacteria 8209
362 Ga0500568_0005330 3300053139 Bacteria 6667
363 Ga0500568_0183901 3300053139 Bacteria 768
364 Ga0500604_0050244 3300053151 Bacteria 1285
365 Ga0500622_0000326 3300053156 Bacteria 47479
366 Ga0500627_0117594 3300053158 Bacteria 1198
367 Ga0500638_384020 3300053162 Bacteria 509
368 Ga0500636_0487564 3300053177 Bacteria 547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0000105 Ga0373927_0000105_44282_44671 92
2 3300037068 Ga0373925_0027305 Ga0373925_0027305_833_1222 92
3 3300046522 Ga0495643_0157703 Ga0495643_0157703_26_379 93
4 3300046530 Ga0495654_0000043 Ga0495654_0000043_88271_88672 93
5 3300048924 Ga0496121_0007012 Ga0496121_0007012_1663_2031 96
6 iso_pu_bacteria 2838736955 2838739106 100
7 iso_pu_bacteria 2841840854 2841843004 100
8 iso_pu_bacteria 2842140634 2842142786 100
9 3300025907 Ga0207645_10421828 Ga0207645_104218283 102
10 3300048924 Ga0496121_0029286 Ga0496121_0029286_405_782 104
11 3300048927 Ga0496124_0087306 Ga0496124_0087306_1542_1919 104
12 iso_pu_bacteria 2821123053 2821123865 104
13 iso_pu_bacteria 2857531043 2857531427 104
14 3300009177 Ga0105248_11951652 Ga0105248_119516522 105
15 3300048923 Ga0496120_0323887 Ga0496120_0323887_143_460 105
16 iso_pu_bacteria 2508501122 2509107330 105
17 iso_pu_bacteria 2509276019 2509374704 105
18 iso_pu_bacteria 2509276021 2509388129 105
19 iso_pu_bacteria 2509276033 2509443726 105
20 iso_pu_bacteria 2510065019 2510131757 105
21 iso_pu_bacteria 2510461076 2510898050 105
22 iso_pu_bacteria 2510917022 2511133908 105
23 iso_pu_bacteria 2510917030 2511196200 105
24 iso_pu_bacteria 2513237084 2513571336 105
25 iso_pu_bacteria 2513237085 2513579105 105
26 iso_pu_bacteria 2513237088 2513598667 105
27 iso_pu_bacteria 2513237093 2513632421 105
28 iso_pu_bacteria 2513237103 2513711758 105
29 iso_pu_bacteria 2513237138 2513868030 105
30 iso_pu_bacteria 2513237144 2513907853 105
31 iso_pu_bacteria 2513237146 2513927512 105
32 iso_pu_bacteria 2513237159 2513999257 105
33 iso_pu_bacteria 2513237162 2514023378 105
34 iso_pu_bacteria 2515075009 2515110698 105
35 iso_pu_bacteria 2515154113 2515637975 105
36 iso_pu_bacteria 2515154114 2515645856 105
37 iso_pu_bacteria 2515154116 2515660664 105
38 iso_pu_bacteria 2515154134 2515742797 105
39 iso_pu_bacteria 2516653077 2517039401 105
40 iso_pu_bacteria 2516653085 2517079642 105
41 iso_pu_bacteria 2517093000 2517093574 105
42 iso_pu_bacteria 2517287029 2517405280 105
43 iso_pu_bacteria 2534681796 2535515320 105
44 iso_pu_bacteria 2558860100 2558863696 105
45 iso_pu_bacteria 2582581283 2585165265 105
46 iso_pu_bacteria 2582581294 2585204104 105
47 iso_pu_bacteria 2582581298 2585225631 105
48 iso_pu_bacteria 2582581299 2585229215 105
49 iso_pu_bacteria 2582581306 2585266517 105
50 iso_pu_bacteria 2582581307 2585276680 105
51 iso_pu_bacteria 2582581308 2585278631 105
52 iso_pu_bacteria 2582581315 2585325754 105
53 iso_pu_bacteria 2582581316 2585329920 105
54 iso_pu_bacteria 2582581865 2585387534 105
55 iso_pu_bacteria 2582581867 2585403849 105
56 iso_pu_bacteria 2585427526 2585525098 105
57 iso_pu_bacteria 2585427527 2585536303 105
58 iso_pu_bacteria 2585427528 2585539953 105
59 iso_pu_bacteria 2585427529 2585548094 105
60 iso_pu_bacteria 2585427530 2585554177 105
61 iso_pu_bacteria 2585427531 2585560348 105
62 iso_pu_bacteria 2585427590 2585824342 105
63 iso_pu_bacteria 2585427593 2585837934 105
64 iso_pu_bacteria 2585427594 2585844389 105
65 iso_pu_bacteria 2585427609 2585905466 105
66 iso_pu_bacteria 2585427633 2585994740 105
67 iso_pu_bacteria 2585428125 2587979418 105
68 iso_pu_bacteria 2599185170 2599418943 105
69 iso_pu_bacteria 2599185236 2599719332 105
70 iso_pu_bacteria 2615840626 2616306094 105
71 iso_pu_bacteria 2615840698 2616553652 105
72 iso_pu_bacteria 2617270742 2617382075 105
73 iso_pu_bacteria 2643221599 2644007582 105
74 iso_pu_bacteria 2643221607 2644046884 105
75 iso_pu_bacteria 2643221634 2644190830 105
76 iso_pu_bacteria 2643221636 2644202576 105
77 iso_pu_bacteria 2643221643 2644241326 105
78 iso_pu_bacteria 2643221686 2644479673 105
79 iso_pu_bacteria 2667528174 2671112599 105
80 iso_pu_bacteria 2718217882 2719179820 105
81 iso_pu_bacteria 2718217927 2719384436 105
82 iso_pu_bacteria 2718217997 2719664170 105
83 iso_pu_bacteria 2718218009 2719730490 105
84 iso_pu_bacteria 2718218199 2720490589 105
85 iso_pu_bacteria 2718218363 2721145913 105
86 iso_pu_bacteria 2718218365 2721157451 105
87 iso_pu_bacteria 2718218366 2721162792 105
88 iso_pu_bacteria 2718218423 2721398150 105
89 iso_pu_bacteria 2721755514 2722838962 105
90 iso_pu_bacteria 2721755809 2724036960 105
91 iso_pu_bacteria 2721755810 2724043246 105
92 iso_pu_bacteria 2721755823 2724108904 105
93 iso_pu_bacteria 2724679232 2725952077 105
94 iso_pu_bacteria 2728369365 2730163057 105
95 iso_pu_bacteria 2728369397 2730297083 105
96 iso_pu_bacteria 2738541293 2738802441 105
97 iso_pu_bacteria 2765235942 2766062475 105
98 iso_pu_bacteria 2775507266 2778174396 105
99 iso_pu_bacteria 2791355259 2793318328 105
100 iso_pu_bacteria 2791355260 2793320034 105
101 iso_pu_bacteria 2791355263 2793342858 105
102 iso_pu_bacteria 2791355264 2793349425 105
103 iso_pu_bacteria 2791355265 2793353137 105
104 iso_pu_bacteria 2791355266 2793360930 105
105 iso_pu_bacteria 2791355267 2793364953 105
106 iso_pu_bacteria 2802429633 2806044107 105
107 iso_pu_bacteria 2802429634 2806052077 105
108 iso_pu_bacteria 2802429635 2806058378 105
109 iso_pu_bacteria 2802429636 2806066873 105
110 iso_pu_bacteria 2802429637 2806074614 105
111 iso_pu_bacteria 2818991453 2819639525 105
112 iso_pu_bacteria 2838016132 2838021741 105
113 iso_pu_bacteria 2838022645 2838026565 105
114 iso_pu_bacteria 2838035591 2838037370 105
115 iso_pu_bacteria 2838042994 2838048821 105
116 iso_pu_bacteria 2838048938 2838054521 105
117 iso_pu_bacteria 2838661181 2838663444 105
118 iso_pu_bacteria 2838680041 2838680853 105
119 iso_pu_bacteria 2838686498 2838692376 105
120 iso_pu_bacteria 2838694306 2838695114 105
121 iso_pu_bacteria 2838707686 2838708490 105
122 iso_pu_bacteria 2838729681 2838732528 105
123 iso_pu_bacteria 2838742623 2838745423 105
124 iso_pu_bacteria 2841851746 2841855067 105
125 iso_pu_bacteria 2841864319 2841866544 105
126 iso_pu_bacteria 2842077413 2842080275 105
127 iso_pu_bacteria 2842110456 2842117709 105
128 iso_pu_bacteria 2842118031 2842120895 105
129 iso_pu_bacteria 2842156927 2842161903 105
130 iso_pu_bacteria 2842163707 2842169282 105
131 iso_pu_bacteria 2842180545 2842185520 105
132 iso_pu_bacteria 2842198810 2842203101 105
133 iso_pu_bacteria 2842217011 2842224087 105
134 iso_pu_bacteria 2842229732 2842233458 105
135 iso_pu_bacteria 2842237096 2842237902 105
136 iso_pu_bacteria 2842243621 2842249612 105
137 iso_pu_bacteria 2842257432 2842261681 105
138 iso_pu_bacteria 2842271015 2842276845 105
139 iso_pu_bacteria 2842291075 2842293935 105
140 iso_pu_bacteria 2842304105 2842306187 105
141 iso_pu_bacteria 2842311132 2842315901 105
142 iso_pu_bacteria 2842341865 2842342793 105
143 iso_pu_bacteria 2842363717 2842368660 105
144 iso_pu_bacteria 2842370503 2842371316 105
145 iso_pu_bacteria 2842377471 2842380331 105
146 iso_pu_bacteria 2842384541 2842387403 105
147 iso_pu_bacteria 2842395702 2842400816 105
148 iso_pu_bacteria 2842482326 2842482589 105
149 iso_pu_bacteria 2842509118 2842509435 105
150 iso_pu_bacteria 2842521101 2842525049 105
151 iso_pu_bacteria 2844454524 2844455682 105
152 iso_pu_bacteria 2852387548 2852388766 105
153 iso_pu_bacteria 2857516855 2857523941 105
154 iso_pu_bacteria 2899803654 2899805902 105
155 iso_pu_bacteria 2919100787 2919101108 105
156 iso_pu_bacteria 2919408235 2919409033 105
157 iso_pu_bacteria 2933016740 2933017325 105
158 iso_pu_bacteria 2933570622 2933573256 105
159 iso_pu_bacteria 2933586486 2933593752 105
160 iso_pu_bacteria 2935894831 2935895637 105
161 iso_pu_bacteria 2935901341 2935907440 105
162 iso_pu_bacteria 2936367885 2936368660 105
163 iso_pu_bacteria 2936375103 2936377754 105
164 iso_pu_bacteria 2936381700 2936383910 105
165 iso_pu_bacteria 2989771324 2989774178 105
166 iso_pu_bacteria 2996887358 2996891956 105
167 iso_pu_bacteria 2996893221 2996893699 105
168 iso_pu_bacteria 3005416602 3005417574 105
169 iso_pu_bacteria 3005445848 3005446400 105
170 iso_pu_bacteria 639633055 639646954 105
171 iso_pu_bacteria 8005258706 8005263721 105
172 iso_pu_bacteria 8005275841 8005279151 105
173 iso_pu_bacteria 8005301065 8005304109 105
174 iso_pu_bacteria 8005307578 8005311040 105
175 iso_pu_bacteria 8005314921 8005314929 105
176 iso_pu_bacteria 8005321885 8005326483 105
177 iso_pu_bacteria 8005376324 8005377166 105
178 iso_pu_bacteria 8005430974 8005436772 105
179 iso_pu_bacteria 8005460587 8005461341 105
180 iso_pu_bacteria 8005484373 8005485908 105
181 iso_pu_bacteria 8005542996 8005544002 105
182 iso_pu_bacteria 8005556819 8005559190 105
183 iso_pu_bacteria 8005563573 8005569896 105
184 iso_pu_bacteria 8005570704 8005577200 105
185 iso_pu_bacteria 8005619151 8005620102 105
186 iso_pu_bacteria 8005682033 8005684879 105
187 iso_pu_bacteria 8005688590 8005690531 105
188 iso_pu_bacteria 8005695170 8005697123 105
189 iso_pu_bacteria 8018127388 8018133376 105
190 iso_pu_bacteria 8018150411 8018151882 105
191 iso_pu_bacteria 8018163183 8018167097 105
192 iso_pu_bacteria 8023680758 8023683859 105
193 iso_pu_bacteria 8024479707 8024480562 105
194 iso_pu_bacteria 8056375014 8056379154 105
195 iso_pu_bacteria 8056382006 8056386207 105
196 iso_pu_bacteria 8057575449 8057577363 105
197 iso_pu_bacteria 8057874678 8057881237 105
198 3300003775 Ga0055524_1001954 Ga0055524_100195410 106
199 3300025263 Ga0209565_1082977 Ga0209565_10829771 106
200 3300025294 Ga0209025_1047656 Ga0209025_10476561 106
201 3300025295 Ga0209564_1056831 Ga0209564_10568311 106
202 3300025299 Ga0209256_1000461 Ga0209256_100046139 106
203 3300042004 Ga0439445_0262303 Ga0439445_0262303_75_422 106
204 3300042015 Ga0439462_0007255 Ga0439462_0007255_1975_2322 106
205 iso_pu_bacteria 2847417321 2847417901 106
206 iso_pu_bacteria 2848992105 2848992742 106
207 3300002704 JGI25155J39150_1000006 JGI25155J39150_100000693 109
208 3300002705 JGI25156J39149_1000019 JGI25156J39149_1000019152 109
209 3300002737 JGI25162J39368_1000694 JGI25162J39368_100069411 109
210 3300002738 JGI25154J39366_1000055 JGI25154J39366_100005536 109
211 3300002738 JGI25154J39366_1000085 JGI25154J39366_100008583 109
212 3300002741 JGI25157J39369_1000024 JGI25157J39369_100002410 109
213 3300002773 JGI25152J39213_1000535 JGI25152J39213_10005352 109
214 3300002773 JGI25152J39213_1011298 JGI25152J39213_10112983 109
215 3300002773 JGI25152J39213_1011306 JGI25152J39213_10113062 109
216 3300002774 JGI25150J39212_1001554 JGI25150J39212_10015545 109
217 3300003187 JGI25151J46595_10000101 JGI25151J46595_100001016 109
218 3300003187 JGI25151J46595_10060082 JGI25151J46595_100600822 109
219 3300003187 JGI25151J46595_10072163 JGI25151J46595_100721631 109
220 3300003214 JGI25165J46597_1000579 JGI25165J46597_100057915 109
221 3300003214 JGI25165J46597_1000786 JGI25165J46597_100078614 109
222 3300003214 JGI25165J46597_1010477 JGI25165J46597_10104772 109
223 3300003215 JGI25153J46596_10006266 JGI25153J46596_100062665 109
224 3300003215 JGI25153J46596_10027659 JGI25153J46596_100276593 109
225 3300003215 JGI25153J46596_10027667 JGI25153J46596_100276673 109
226 3300003215 JGI25153J46596_10110244 JGI25153J46596_101102441 109
227 3300003323 rootH1_10089087 rootH1_100890872 109
228 3300003323 rootH1_10089088 rootH1_100890882 109
229 3300003354 JGI25160J50197_1000053 JGI25160J50197_1000053112 109
230 3300003374 JGI25161J50226_1000039 JGI25161J50226_1000039112 109
231 3300003578 Ga0006562J51391_1093880 Ga0006562J51391_10938802 109
232 3300003752 Ga0055539_1015486 Ga0055539_10154862 109
233 3300003763 Ga0055529_1008764 Ga0055529_10087642 109
234 3300003771 Ga0055526_1001894 Ga0055526_100189412 109
235 3300003771 Ga0055526_1011312 Ga0055526_10113124 109
236 3300003771 Ga0055526_1042331 Ga0055526_10423311 109
237 3300003775 Ga0055524_1011735 Ga0055524_10117353 109
238 3300003775 Ga0055524_1014428 Ga0055524_10144283 109
239 3300003775 Ga0055524_1042462 Ga0055524_10424621 109
240 3300003775 Ga0055524_1061896 Ga0055524_10618962 109
241 3300003790 Ga0055528_1000462 Ga0055528_10004623 109
242 3300003790 Ga0055528_1001362 Ga0055528_100136213 109
243 3300003790 Ga0055528_1001502 Ga0055528_10015023 109
244 3300003790 Ga0055528_1061242 Ga0055528_10612421 109
245 3300003792 Ga0055540_1015016 Ga0055540_10150162 109
246 3300003794 Ga0055531_10078369 Ga0055531_100783692 109
247 3300004625 Ga0055543_1000015 Ga0055543_100001576 109
248 3300005262 Ga0065165_1000361 Ga0065165_10003618 109
249 3300005327 Ga0070658_10006679 Ga0070658_100066794 109
250 3300005327 Ga0070658_11010442 Ga0070658_110104422 109
251 3300005329 Ga0070683_100019651 Ga0070683_1000196515 109
252 3300005347 Ga0070668_101939959 Ga0070668_1019399591 109
253 3300005355 Ga0070671_100223664 Ga0070671_1002236642 109
254 3300005455 Ga0070663_100157295 Ga0070663_1001572953 109
255 3300005535 Ga0070684_100103824 Ga0070684_1001038242 109
256 3300005539 Ga0068853_100513520 Ga0068853_1005135201 109
257 3300005548 Ga0070665_100033014 Ga0070665_1000330146 109
258 3300005548 Ga0070665_100391632 Ga0070665_1003916322 109
259 3300005564 Ga0070664_100834079 Ga0070664_1008340792 109
260 3300005578 Ga0068854_100013817 Ga0068854_1000138176 109
261 3300005614 Ga0068856_100379304 Ga0068856_1003793043 109
262 3300005616 Ga0068852_100059793 Ga0068852_1000597936 109
263 3300005834 Ga0068851_10030219 Ga0068851_100302193 109
264 3300005842 Ga0068858_100839150 Ga0068858_1008391502 109
265 3300005843 Ga0068860_101169690 Ga0068860_1011696902 109
266 3300006048 Ga0075363_100470256 Ga0075363_1004702561 109
267 3300006051 Ga0075364_10000158 Ga0075364_100001587 109
268 3300006051 Ga0075364_10334368 Ga0075364_103343682 109
269 3300006177 Ga0075362_10449014 Ga0075362_104490141 109
270 3300006178 Ga0075367_10203792 Ga0075367_102037923 109
271 3300006353 Ga0075370_10010900 Ga0075370_100109006 109
272 3300006353 Ga0075370_10845167 Ga0075370_108451672 109
273 3300009011 Ga0105251_10010458 Ga0105251_100104588 109
274 3300009036 Ga0105244_10103175 Ga0105244_101031753 109
275 3300009092 Ga0105250_10250128 Ga0105250_102501282 109
276 3300009093 Ga0105240_10000027 Ga0105240_10000027134 109
277 3300009177 Ga0105248_10103549 Ga0105248_101035493 109
278 3300009177 Ga0105248_11148307 Ga0105248_111483072 109
279 3300009545 Ga0105237_10003395 Ga0105237_1000339516 109
280 3300009553 Ga0105249_10136101 Ga0105249_101361013 109
281 3300009765 Ga0123341_1000528 Ga0123341_100052815 109
282 3300010375 Ga0105239_10434811 Ga0105239_104348111 109
283 3300012490 Ga0157322_1000837 Ga0157322_10008373 109
284 3300013100 Ga0157373_10173694 Ga0157373_101736942 109
285 3300013102 Ga0157371_11272899 Ga0157371_112728992 109
286 3300013104 Ga0157370_10000048 Ga0157370_10000048114 109
287 3300013105 Ga0157369_10621337 Ga0157369_106213372 109
288 3300013308 Ga0157375_10141092 Ga0157375_101410924 109
289 3300014326 Ga0157380_10790653 Ga0157380_107906532 109
290 3300014497 Ga0182008_10007814 Ga0182008_100078145 109
291 3300015262 Ga0182007_10004419 Ga0182007_100044194 109
292 3300015265 Ga0182005_1006489 Ga0182005_10064895 109
293 3300017792 Ga0163161_11023337 Ga0163161_110233372 109
294 3300017792 Ga0163161_11237222 Ga0163161_112372221 109
295 3300021321 Ga0214542_1021364 Ga0214542_10213645 109
296 3300021327 Ga0214543_1000003 Ga0214543_1000003265 109
297 3300025206 Ga0209435_100011 Ga0209435_10001191 109
298 3300025206 Ga0209435_120067 Ga0209435_1200672 109
299 3300025228 Ga0209672_111310 Ga0209672_1113102 109
300 3300025233 Ga0209437_100033 Ga0209437_10003311 109
301 3300025233 Ga0209437_100036 Ga0209437_100036261 109
302 3300025245 Ga0207425_1000071 Ga0207425_10000717 109
303 3300025245 Ga0207425_1006231 Ga0207425_10062313 109
304 3300025246 Ga0209646_1000024 Ga0209646_1000024320 109
305 3300025246 Ga0209646_1007038 Ga0209646_10070382 109
306 3300025246 Ga0209646_1029059 Ga0209646_10290592 109
307 3300025250 Ga0209026_1000030 Ga0209026_1000030320 109
308 3300025253 Ga0209677_100188 Ga0209677_10018814 109
309 3300025254 Ga0209148_1008523 Ga0209148_10085234 109
310 3300025256 Ga0209759_1000011 Ga0209759_100001191 109
311 3300025258 Ga0209129_1000143 Ga0209129_10001437 109
312 3300025258 Ga0209129_1000688 Ga0209129_100068826 109
313 3300025258 Ga0209129_1000804 Ga0209129_10008045 109
314 3300025258 Ga0209129_1002350 Ga0209129_10023503 109
315 3300025261 Ga0209233_1000056 Ga0209233_1000056331 109
316 3300025261 Ga0209233_1000152 Ga0209233_1000152167 109
317 3300025261 Ga0209233_1000271 Ga0209233_100027139 109
318 3300025272 Ga0209455_1010365 Ga0209455_10103652 109
319 3300025273 Ga0209673_1000015 Ga0209673_1000015163 109
320 3300025273 Ga0209673_1000091 Ga0209673_10000912 109
321 3300025273 Ga0209673_1002233 Ga0209673_100223310 109
322 3300025273 Ga0209673_1006307 Ga0209673_10063073 109
323 3300025273 Ga0209673_1008282 Ga0209673_10082823 109
324 3300025273 Ga0209673_1042870 Ga0209673_10428702 109
325 3300025273 Ga0209673_1124176 Ga0209673_11241761 109
326 3300025284 Ga0209130_1000038 Ga0209130_1000038112 109
327 3300025284 Ga0209130_1018558 Ga0209130_10185581 109
328 3300025284 Ga0209130_1035718 Ga0209130_10357182 109
329 3300025292 Ga0209676_1022774 Ga0209676_10227743 109
330 3300025292 Ga0209676_1023249 Ga0209676_10232492 109
331 3300025294 Ga0209025_1000280 Ga0209025_10002807 109
332 3300025294 Ga0209025_1002313 Ga0209025_10023136 109
333 3300025294 Ga0209025_1005340 Ga0209025_10053408 109
334 3300025294 Ga0209025_1012947 Ga0209025_10129476 109
335 3300025294 Ga0209025_1020786 Ga0209025_10207863 109
336 3300025294 Ga0209025_1023281 Ga0209025_10232813 109
337 3300025294 Ga0209025_1077025 Ga0209025_10770252 109
338 3300025295 Ga0209564_1001024 Ga0209564_10010242 109
339 3300025295 Ga0209564_1006842 Ga0209564_10068426 109
340 3300025295 Ga0209564_1024099 Ga0209564_10240992 109
341 3300025295 Ga0209564_1041814 Ga0209564_10418142 109
342 3300025297 Ga0209758_1000235 Ga0209758_10002357 109
343 3300025297 Ga0209758_1001580 Ga0209758_100158026 109
344 3300025297 Ga0209758_1001626 Ga0209758_100162624 109
345 3300025297 Ga0209758_1010498 Ga0209758_10104986 109
346 3300025297 Ga0209758_1016297 Ga0209758_10162973 109
347 3300025298 Ga0209050_1020363 Ga0209050_10203632 109
348 3300025299 Ga0209256_1002464 Ga0209256_10024642 109
349 3300025299 Ga0209256_1002564 Ga0209256_100256412 109
350 3300025299 Ga0209256_1008615 Ga0209256_10086154 109
351 3300025299 Ga0209256_1025268 Ga0209256_10252681 109
352 3300025299 Ga0209256_1037338 Ga0209256_10373382 109
353 3300025299 Ga0209256_1112985 Ga0209256_11129851 109
354 3300025302 Ga0207426_1000081 Ga0207426_1000081152 109
355 3300025302 Ga0207426_1002120 Ga0207426_100212011 109
356 3300025303 Ga0209051_1000408 Ga0209051_100040855 109
357 3300025303 Ga0209051_1014063 Ga0209051_10140634 109
358 3300025303 Ga0209051_1080656 Ga0209051_10806562 109
359 3300025303 Ga0209051_1106932 Ga0209051_11069322 109
360 3300025304 Ga0209257_1010762 Ga0209257_10107626 109
361 3300025321 Ga0207656_10022995 Ga0207656_100229954 109
362 3300025711 Ga0207696_1119549 Ga0207696_11195491 109
363 3300025903 Ga0207680_10310163 Ga0207680_103101632 109
364 3300025909 Ga0207705_10032543 Ga0207705_100325434 109
365 3300025909 Ga0207705_10426639 Ga0207705_104266392 109
366 3300025913 Ga0207695_10000024 Ga0207695_10000024496 109
367 3300025914 Ga0207671_10001033 Ga0207671_1000103320 109
368 3300025925 Ga0207650_11339117 Ga0207650_113391172 109
369 3300025931 Ga0207644_10106023 Ga0207644_101060232 109
370 3300025941 Ga0207711_10809904 Ga0207711_108099042 109
371 3300025944 Ga0207661_10021885 Ga0207661_100218855 109
372 3300025945 Ga0207679_12053353 Ga0207679_120533531 109
373 3300025949 Ga0207667_10248227 Ga0207667_102482272 109
374 3300025972 Ga0207668_11954032 Ga0207668_119540321 109
375 3300025981 Ga0207640_10141992 Ga0207640_101419922 109
376 3300025986 Ga0207658_10690167 Ga0207658_106901672 109
377 3300026035 Ga0207703_10882770 Ga0207703_108827702 109
378 3300026041 Ga0207639_11105766 Ga0207639_111057661 109
379 3300026067 Ga0207678_10789674 Ga0207678_107896742 109
380 3300026078 Ga0207702_10377999 Ga0207702_103779993 109
381 3300026142 Ga0207698_10025819 Ga0207698_100258196 109
382 3300027312 Ga0209371_1001704 Ga0209371_10017045 109
383 3300028379 Ga0268266_10039757 Ga0268266_100397576 109
384 3300028379 Ga0268266_10085470 Ga0268266_100854704 109
385 3300028379 Ga0268266_10184364 Ga0268266_101843643 109
386 3300028380 Ga0268265_11577352 Ga0268265_115773522 109
387 3300028381 Ga0268264_11806533 Ga0268264_118065332 109
388 3300028794 Ga0307515_10216907 Ga0307515_102169071 109
389 3300030500 Ga0268256_1003117 Ga0268256_10031173 109
390 3300030500 Ga0268256_1077058 Ga0268256_10770582 109
391 3300031456 Ga0307513_10002593 Ga0307513_100025931 109
392 3300031456 Ga0307513_10305939 Ga0307513_103059393 109
393 3300031548 Ga0307408_100007792 Ga0307408_1000077926 109
394 3300031548 Ga0307408_100558167 Ga0307408_1005581672 109
395 3300031731 Ga0307405_10007316 Ga0307405_100073164 109
396 3300031731 Ga0307405_10333131 Ga0307405_103331311 109
397 3300031824 Ga0307413_11527859 Ga0307413_115278592 109
398 3300031852 Ga0307410_10436440 Ga0307410_104364401 109
399 3300031901 Ga0307406_10137171 Ga0307406_101371714 109
400 3300031911 Ga0307412_10000826 Ga0307412_1000082614 109
401 3300031911 Ga0307412_10191344 Ga0307412_101913442 109
402 3300031911 Ga0307412_12283315 Ga0307412_122833152 109
403 3300031995 Ga0307409_100609938 Ga0307409_1006099382 109
404 3300032002 Ga0307416_101177752 Ga0307416_1011777523 109
405 3300032002 Ga0307416_101989295 Ga0307416_1019892952 109
406 3300032004 Ga0307414_10376612 Ga0307414_103766122 109
407 3300039062 Ga0400483_036611 Ga0400483_036611_190_534 109
408 3300039437 Ga0436365_0552110 Ga0436365_0552110_24_389 109
409 3300041404 Ga0439436_0025905 Ga0439436_0025905_379_708 109
410 3300041405 Ga0439438_036844 Ga0439438_036844_903_1232 109
411 3300041411 Ga0439466_0029961 Ga0439466_0029961_546_914 109
412 3300041413 Ga0439465_0020462 Ga0439465_0020462_659_1027 109
413 3300041452 Ga0451793_0650579 Ga0451793_0650579_959_1288 109
414 3300041486 Ga0451807_2355181 Ga0451807_2355181_45_374 109
415 3300041491 Ga0451833_0611574 Ga0451833_0611574_149_478 109
416 3300041496 Ga0451839_1317335 Ga0451839_1317335_354_683 109
417 3300041496 Ga0451839_1390509 Ga0451839_1390509_50_379 109
418 3300041498 Ga0451841_0264814 Ga0451841_0264814_792_1121 109
419 3300041501 Ga0451845_0053732 Ga0451845_0053732_530_859 109
420 3300041503 Ga0451847_0198349 Ga0451847_0198349_530_859 109
421 3300041505 Ga0451849_0596962 Ga0451849_0596962_96_425 109
422 3300041512 Ga0451853_1550108 Ga0451853_1550108_2149_2478 109
423 3300041512 Ga0451853_2367273 Ga0451853_2367273_476_805 109
424 3300041997 Ga0439431_0047912 Ga0439431_0047912_152_481 109
425 3300042006 Ga0439432_115634 Ga0439432_115634_95_463 109
426 3300042007 Ga0439449_0021920 Ga0439449_0021920_1025_1393 109
427 3300042007 Ga0439449_0124863 Ga0439449_0124863_474_803 109
428 3300042146 Ga0450907_038840 Ga0450907_038840_114_443 109
429 3300042435 Ga0439434_0051994 Ga0439434_0051994_567_896 109
430 3300044684 Ga0466966_0294614 Ga0466966_0294614_440_769 109
431 3300044694 Ga0466963_0005516 Ga0466963_0005516_5820_6149 109
432 3300044719 Ga0466971_0123112 Ga0466971_0123112_482_811 109
433 3300044765 Ga0466970_0005605 Ga0466970_0005605_4926_5255 109
434 3300045836 Ga0466958_0011112 Ga0466958_0011112_592_921 109
435 3300045976 Ga0466967_0132900 Ga0466967_0132900_740_1069 109
436 3300045976 Ga0466967_1370606 Ga0466967_1370606_87_416 109
437 3300046457 Ga0495590_0097916 Ga0495590_0097916_77_406 109
438 3300046492 Ga0495585_0050694 Ga0495585_0050694_560_889 109
439 3300046501 Ga0495607_0038132 Ga0495607_0038132_186_515 109
440 3300046506 Ga0495583_0007111 Ga0495583_0007111_4925_5254 109
441 3300046507 Ga0495606_0305162 Ga0495606_0305162_435_764 109
442 3300046512 Ga0495610_0276423 Ga0495610_0276423_270_599 109
443 3300046512 Ga0495610_0385936 Ga0495610_0385936_71_400 109
444 3300046515 Ga0495620_0123451 Ga0495620_0123451_395_724 109
445 3300046522 Ga0495643_0113920 Ga0495643_0113920_380_709 109
446 3300046524 Ga0495648_0066874 Ga0495648_0066874_1181_1510 109
447 3300046660 Ga0495625_0025943 Ga0495625_0025943_522_851 109
448 3300046660 Ga0495625_0242059 Ga0495625_0242059_395_739 109
449 3300046660 Ga0495625_0420480 Ga0495625_0420480_49_378 109
450 3300046674 Ga0495588_0459366 Ga0495588_0459366_68_448 109
451 3300046691 Ga0495670_0395614 Ga0495670_0395614_121_450 109
452 3300046692 Ga0495671_0242894 Ga0495671_0242894_256_585 109
453 3300046692 Ga0495671_0258810 Ga0495671_0258810_324_653 109
454 3300046694 Ga0495649_0137782 Ga0495649_0137782_676_1005 109
455 3300047470 Ga0495681_0234678 Ga0495681_0234678_116_445 109
456 3300048904 Ga0496101_0188327 Ga0496101_0188327_939_1268 109
457 3300048905 Ga0496102_0015629 Ga0496102_0015629_3385_3714 109
458 3300048905 Ga0496102_1745533 Ga0496102_1745533_119_448 109
459 3300048906 Ga0496103_0005197 Ga0496103_0005197_2793_3122 109
460 3300048909 Ga0496106_0182695 Ga0496106_0182695_200_565 109
461 3300048910 Ga0496107_1270836 Ga0496107_1270836_97_426 109
462 3300048913 Ga0496110_0093484 Ga0496110_0093484_336_677 109
463 3300048914 Ga0496111_0005942 Ga0496111_0005942_3590_3931 109
464 3300048914 Ga0496111_0216752 Ga0496111_0216752_521_850 109
465 3300048919 Ga0496116_0002550 Ga0496116_0002550_3765_4094 109
466 3300048919 Ga0496116_0022034 Ga0496116_0022034_1078_1443 109
467 3300048919 Ga0496116_0026017 Ga0496116_0026017_2744_3073 109
468 3300048919 Ga0496116_0066095 Ga0496116_0066095_900_1229 109
469 3300048919 Ga0496116_0094360 Ga0496116_0094360_517_846 109
470 3300048919 Ga0496116_0323225 Ga0496116_0323225_172_501 109
471 3300048920 Ga0496117_0004982 Ga0496117_0004982_9150_9479 109
472 3300048920 Ga0496117_0019927 Ga0496117_0019927_3753_4082 109
473 3300048920 Ga0496117_0086382 Ga0496117_0086382_517_846 109
474 3300048921 Ga0496118_0001729 Ga0496118_0001729_13133_13462 109
475 3300048921 Ga0496118_0014319 Ga0496118_0014319_6301_6666 109
476 3300048921 Ga0496118_0017468 Ga0496118_0017468_5223_5552 109
477 3300048921 Ga0496118_0031246 Ga0496118_0031246_626_955 109
478 3300048921 Ga0496118_0034536 Ga0496118_0034536_1021_1350 109
479 3300048922 Ga0496119_0017955 Ga0496119_0017955_3360_3689 109
480 3300048922 Ga0496119_0030450 Ga0496119_0030450_2855_3184 109
481 3300048922 Ga0496119_0154454 Ga0496119_0154454_617_982 109
482 3300048923 Ga0496120_0130065 Ga0496120_0130065_639_968 109
483 3300048923 Ga0496120_0228998 Ga0496120_0228998_147_476 109
484 3300048924 Ga0496121_0003867 Ga0496121_0003867_4682_5011 109
485 3300048924 Ga0496121_0024967 Ga0496121_0024967_490_819 109
486 3300048924 Ga0496121_0027206 Ga0496121_0027206_3740_4069 109
487 3300048924 Ga0496121_0032514 Ga0496121_0032514_3116_3445 109
488 3300048924 Ga0496121_0080845 Ga0496121_0080845_1113_1442 109
489 3300048924 Ga0496121_0149552 Ga0496121_0149552_1165_1530 109
490 3300048924 Ga0496121_0178319 Ga0496121_0178319_297_626 109
491 3300048924 Ga0496121_0187809 Ga0496121_0187809_739_1068 109
492 3300048924 Ga0496121_0466864 Ga0496121_0466864_16_345 109
493 3300048925 Ga0496122_0000009 Ga0496122_0000009_303849_304178 109
494 3300048925 Ga0496122_0014830 Ga0496122_0014830_1600_1929 109
495 3300048925 Ga0496122_0024378 Ga0496122_0024378_3765_4094 109
496 3300048925 Ga0496122_0031680 Ga0496122_0031680_2910_3239 109
497 3300048925 Ga0496122_0038296 Ga0496122_0038296_758_1087 109
498 3300048925 Ga0496122_0047345 Ga0496122_0047345_2280_2621 109
499 3300048925 Ga0496122_0048600 Ga0496122_0048600_1607_1936 109
500 3300048925 Ga0496122_0061134 Ga0496122_0061134_745_1074 109
501 3300048925 Ga0496122_0117323 Ga0496122_0117323_105_470 109
502 3300048926 Ga0496123_0000020 Ga0496123_0000020_108301_108630 109
503 3300048926 Ga0496123_0007813 Ga0496123_0007813_4451_4780 109
504 3300048926 Ga0496123_0013063 Ga0496123_0013063_1598_1939 109
505 3300048926 Ga0496123_0014722 Ga0496123_0014722_2371_2700 109
506 3300048926 Ga0496123_0017732 Ga0496123_0017732_1306_1635 109
507 3300048926 Ga0496123_0026033 Ga0496123_0026033_2942_3271 109
508 3300048926 Ga0496123_0041383 Ga0496123_0041383_1168_1497 109
509 3300048927 Ga0496124_0006731 Ga0496124_0006731_7427_7822 109
510 3300048927 Ga0496124_0018298 Ga0496124_0018298_5717_6046 109
511 3300048927 Ga0496124_0021655 Ga0496124_0021655_1827_2156 109
512 3300048927 Ga0496124_0032000 Ga0496124_0032000_1513_1842 109
513 3300048927 Ga0496124_0059972 Ga0496124_0059972_1961_2290 109
514 3300048927 Ga0496124_0083799 Ga0496124_0083799_235_564 109
515 3300048927 Ga0496124_0091653 Ga0496124_0091653_2072_2401 109
516 3300048927 Ga0496124_0144374 Ga0496124_0144374_108_437 109
517 3300048927 Ga0496124_0447051 Ga0496124_0447051_491_820 109
518 3300048928 Ga0496125_0006739 Ga0496125_0006739_5136_5465 109
519 3300048928 Ga0496125_0016874 Ga0496125_0016874_3316_3645 109
520 3300048928 Ga0496125_0022378 Ga0496125_0022378_3763_4092 109
521 3300048928 Ga0496125_0181915 Ga0496125_0181915_559_888 109
522 3300048928 Ga0496125_0214834 Ga0496125_0214834_430_759 109
523 3300048929 Ga0496126_0002880 Ga0496126_0002880_2845_3240 109
524 3300048929 Ga0496126_0118626 Ga0496126_0118626_1313_1642 109
525 3300048929 Ga0496126_0237241 Ga0496126_0237241_996_1361 109
526 3300049459 Ga0495678_097919 Ga0495678_097919_77_406 109
527 3300049568 Ga0501031_0823798 Ga0501031_0823798_106_582 109
528 3300049569 Ga0501032_0066920 Ga0501032_0066920_264_635 109
529 3300049573 Ga0501037_0357394 Ga0501037_0357394_148_477 109
530 3300049576 Ga0501040_0347641 Ga0501040_0347641_435_803 109
531 3300049586 Ga0501070_0433625 Ga0501070_0433625_158_490 109
532 3300049589 Ga0501073_0567016 Ga0501073_0567016_395_724 109
533 3300049591 Ga0501075_0846522 Ga0501075_0846522_195_524 109
534 3300049742 Ga0501080_0110078 Ga0501080_0110078_607_936 109
535 3300049744 Ga0501083_0117843 Ga0501083_0117843_1308_1637 109
536 3300050489 nmdc:mga03683_124960_c1 nmdc:mga03683_124960_c1_156_485 109
537 3300050489 nmdc:mga03683_393764_c1 nmdc:mga03683_393764_c1_291_620 109
538 3300050490 nmdc:mga03n38_140840_c1 nmdc:mga03n38_140840_c1_118_447 109
539 3300050491 nmdc:mga00v17_522598_c1 nmdc:mga00v17_522598_c1_144_473 109
540 3300050492 nmdc:mga0yw44_50810_c2 nmdc:mga0yw44_50810_c2_270_611 109
541 3300050496 nmdc:mga07m45_899237_c1 nmdc:mga07m45_899237_c1_48_428 109
542 3300050516 nmdc:mga0sz30_193617_c1 nmdc:mga0sz30_193617_c1_165_494 109
543 3300053099 Ga0500654_059149 Ga0500654_059149_1107_1451 109
544 3300053118 Ga0500594_0251806 Ga0500594_0251806_168_497 109
545 3300053120 Ga0500597_235443 Ga0500597_235443_329_658 109
546 3300053125 Ga0500618_000007 Ga0500618_000007_201884_202225 109
547 3300053125 Ga0500618_011357 Ga0500618_011357_884_1213 109
548 3300053125 Ga0500618_048423 Ga0500618_048423_20_349 109
549 3300053133 Ga0500655_009320 Ga0500655_009320_712_1041 109
550 3300053134 Ga0500658_0001892 Ga0500658_0001892_6413_6742 109
551 3300053139 Ga0500568_0005330 Ga0500568_0005330_838_1167 109
552 3300053139 Ga0500568_0183901 Ga0500568_0183901_185_544 109
553 3300053151 Ga0500604_0050244 Ga0500604_0050244_382_711 109
554 3300053156 Ga0500622_0000326 Ga0500622_0000326_42024_42353 109
555 3300053158 Ga0500627_0117594 Ga0500627_0117594_710_1075 109
556 3300053162 Ga0500638_384020 Ga0500638_384020_27_356 109
557 3300053177 Ga0500636_0487564 Ga0500636_0487564_158_487 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07978

NIPSNAP

NIPSNAP

25

124

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ap6-assembly1.cif.gz_A x-ray crystal structure of protein atu4242 from agrobacterium tumefaciens. northeast strucutral genomics consortium target atr43. 0.86 1 101
3tvz-assembly3.cif.gz_C structure of bacillus subtilis hmob 0.8272 2 65
5k9f-assembly1.cif.gz_A crystal structure of a nipsnap domain protein from burkholderia xenovorans 0.8255 1 101
2ap6-assembly1.cif.gz_A x-ray crystal structure of protein atu4242 from agrobacterium tumefaciens. northeast strucutral genomics consortium target atr43. 0.823 1 101
1vqs-assembly1.cif.gz_B crystal structure of a nipsnap family protein with unknown function (atu4242) from agrobacterium tumefaciens str. c58 at 1.50 a resolution 0.8199 1 98
ID Description Score Start End Superfamily
af_Q54I58_127_223_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8554 3 101 3.30.70.100
af_Q54I58_127_223_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8397 3 101 3.30.70.100
af_F1QWR0_51_160_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8319 2 101 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8255 1 101 3.30.70.100
5ixuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8193 1 101 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2W5SGK8-F1-model_v4 NIPSNAP family protein 0.9897 1 99
AF-A0A6P1SZ15-F1-model_v4 NIPSNAP family protein 0.9832 1 99
AF-A0A0M6YJS7-F1-model_v4 NIPSNAP domain-containing protein 0.9832 1 99
AF-A0A520IH13-F1-model_v4 NIPSNAP family protein 0.9819 1 85
AF-A0A328AC38-F1-model_v4 NIPSNAP family protein 0.9807 1 100

Feature Viewer

pLDDT pTM Quality
95.39 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map