F463360

General Info

Members Datasets Scaffolds Average Seq Length
557 237 557 143

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0131088|Ga0501033_0131088_825_1343
Length 172
Sequence VQVGVLNGVNLDVIGERDPELYGGVSIGELETKIYAWARELGFTARCFQTNHEGQYVDWCHDARRWANGLIVNPGAWTHYSYAIRDALDLCAVPVVEVHLSNIEQREEWRRHSVVADIVSHRVLGRGPEGYRDALVYLKEQGWTPGSTGCAPSWTPSAPRRSSPRTRATSAT

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
115 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.49
Rhizosphere 88.33
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10315729 3300005327 Bacteria 1334
2 Ga0070683_100092238 3300005329 Bacteria 2845
3 Ga0070683_101418187 3300005329 Bacteria 667
4 Ga0070682_100464052 3300005337 Bacteria 973
5 Ga0068868_100132759 3300005338 Bacteria 2039
6 Ga0070660_100073375 3300005339 Bacteria 2675
7 Ga0070689_101762774 3300005340 Bacteria 564
8 Ga0070668_100649428 3300005347 Bacteria 927
9 Ga0070674_100213316 3300005356 Bacteria 1498
10 Ga0070674_101578803 3300005356 Bacteria 591
11 Ga0070659_100733782 3300005366 Bacteria 856
12 Ga0070667_100004429 3300005367 Bacteria 11851
13 Ga0070701_10771840 3300005438 Bacteria 653
14 Ga0070711_100491322 3300005439 Bacteria 1011
15 Ga0070700_100878871 3300005441 Bacteria 728
16 Ga0070708_100040293 3300005445 Bacteria 4090
17 Ga0070678_100168360 3300005456 Bacteria 1782
18 Ga0070681_10368453 3300005458 Bacteria 1347
19 Ga0068867_100607332 3300005459 Bacteria 955
20 Ga0070706_100002089 3300005467 Bacteria 20346
21 Ga0070707_100000736 3300005468 Bacteria 32520
22 Ga0070698_100152401 3300005471 Bacteria 2259
23 Ga0070698_100163451 3300005471 Bacteria 2169
24 Ga0070699_100028631 3300005518 Bacteria 4804
25 Ga0070684_100171022 3300005535 Bacteria 1973
26 Ga0070684_100183112 3300005535 Bacteria 1905
27 Ga0070684_100361944 3300005535 Bacteria 1335
28 Ga0070697_100315422 3300005536 Bacteria 1346
29 Ga0068853_101059602 3300005539 Bacteria 781
30 Ga0070686_100048181 3300005544 Bacteria 2699
31 Ga0070696_100269235 3300005546 Bacteria 1295
32 Ga0070693_101300045 3300005547 Unclassified 562
33 Ga0068855_101814216 3300005563 Bacteria 619
34 Ga0068854_100305170 3300005578 Bacteria 1289
35 Ga0068852_101501689 3300005616 Bacteria 696
36 Ga0068852_102176085 3300005616 Bacteria 576
37 Ga0068866_10147819 3300005718 Bacteria 1357
38 Ga0068858_101059947 3300005842 Bacteria 795
39 Ga0068862_102028839 3300005844 Bacteria 586
40 Ga0081455_10025857 3300005937 Bacteria 5410
41 Ga0081455_10340862 3300005937 Bacteria 1061
42 Ga0081455_10415556 3300005937 Bacteria 929
43 Ga0081538_10002763 3300005981 Bacteria 16826
44 Ga0081538_10076814 3300005981 Bacteria 1802
45 Ga0081538_10108181 3300005981 Unclassified 1374
46 Ga0081538_10159521 3300005981 Bacteria 1005
47 Ga0070712_100321827 3300006175 Bacteria 1258
48 Ga0075431_100048271 3300006847 Bacteria 4391
49 Ga0075433_10312486 3300006852 Bacteria 1391
50 Ga0075433_10636678 3300006852 Unclassified 935
51 Ga0075434_101082357 3300006871 Unclassified 815
52 Ga0075429_100546706 3300006880 Unclassified 1015
53 Ga0105245_10072744 3300009098 Bacteria 3124
54 Ga0105245_10624107 3300009098 Bacteria 1106
55 Ga0105247_10327424 3300009101 Bacteria 1071
56 Ga0105247_11401522 3300009101 Bacteria 566
57 Ga0114129_11440329 3300009147 Bacteria 849
58 Ga0114129_11798928 3300009147 Unclassified 745
59 Ga0105243_12195320 3300009148 Bacteria 589
60 Ga0105242_10446519 3300009176 Bacteria 1218
61 Ga0105242_11691843 3300009176 Bacteria 669
62 Ga0105248_10332086 3300009177 Bacteria 1712
63 Ga0105248_12790642 3300009177 Bacteria 557
64 Ga0105237_11271284 3300009545 Bacteria 742
65 Ga0105249_10272201 3300009553 Bacteria 1687
66 Ga0105239_10774423 3300010375 Bacteria 1099
67 Ga0105239_10995366 3300010375 Bacteria 964
68 Ga0105239_11867494 3300010375 Bacteria 696
69 Ga0105246_10762444 3300011119 Bacteria 855
70 Ga0157370_10005484 3300013104 Bacteria 14227
71 Ga0157369_10230384 3300013105 Bacteria 1937
72 Ga0157378_10612481 3300013297 Bacteria 1101
73 Ga0163162_10265554 3300013306 Bacteria 1848
74 Ga0163162_11400422 3300013306 Bacteria 795
75 Ga0157375_10842164 3300013308 Bacteria 1064
76 Ga0157375_11589068 3300013308 Bacteria 773
77 Ga0163163_10357809 3300014325 Bacteria 1516
78 Ga0157380_11386722 3300014326 Bacteria 753
79 Ga0157380_12038426 3300014326 Bacteria 636
80 Ga0157377_10478155 3300014745 Unclassified 866
81 Ga0157379_10071265 3300014968 Bacteria 3109
82 Ga0157376_10194914 3300014969 Bacteria 1860
83 Ga0157376_11817108 3300014969 Bacteria 646
84 Ga0163161_10409999 3300017792 Bacteria 1088
85 Ga0163161_11771296 3300017792 Bacteria 548
86 Ga0197907_11257557 3300020069 Bacteria 1531
87 Ga0213871_10061039 3300021441 Unclassified 1050
88 Ga0207685_10239067 3300025905 Unclassified 873
89 Ga0207684_10004837 3300025910 Bacteria 12604
90 Ga0207684_11351666 3300025910 Unclassified 585
91 Ga0207707_10317187 3300025912 Bacteria 1346
92 Ga0207693_10550009 3300025915 Bacteria 900
93 Ga0207663_10119881 3300025916 Bacteria 1800
94 Ga0207663_10457810 3300025916 Bacteria 985
95 Ga0207663_11717567 3300025916 Bacteria 505
96 Ga0207657_10024716 3300025919 Bacteria 5555
97 Ga0207652_10574797 3300025921 Bacteria 1012
98 Ga0207652_10811155 3300025921 Bacteria 830
99 Ga0207646_10002219 3300025922 Bacteria 23119
100 Ga0207687_10308179 3300025927 Bacteria 1277
101 Ga0207664_10292440 3300025929 Bacteria 1432
102 Ga0207644_10718446 3300025931 Bacteria 834
103 Ga0207690_10767130 3300025932 Bacteria 796
104 Ga0207706_10139302 3300025933 Bacteria 2134
105 Ga0207686_10071604 3300025934 Bacteria 2232
106 Ga0207686_10422273 3300025934 Bacteria 1020
107 Ga0207709_11524313 3300025935 Bacteria 555
108 Ga0207669_10128942 3300025937 Bacteria 1734
109 Ga0207669_10217016 3300025937 Bacteria 1401
110 Ga0207711_10448061 3300025941 Bacteria 1202
111 Ga0207661_10135544 3300025944 Bacteria 2114
112 Ga0207661_10517849 3300025944 Bacteria 1091
113 Ga0207661_11254559 3300025944 Bacteria 681
114 Ga0207667_11027889 3300025949 Bacteria 810
115 Ga0207658_10043431 3300025986 Bacteria 3267
116 Ga0207703_10930756 3300026035 Bacteria 833
117 Ga0207708_10684771 3300026075 Bacteria 875
118 Ga0207708_11425449 3300026075 Bacteria 608
119 Ga0207683_10188629 3300026121 Bacteria 1871
120 Ga0207698_11167517 3300026142 Bacteria 784
121 Ga0207698_11297071 3300026142 Unclassified 743
122 Ga0265319_1042321 3300028563 Bacteria 1533
123 Ga0265327_10055176 3300031251 Bacteria 2053
124 Ga0307408_101224295 3300031548 Bacteria 701
125 Ga0307406_10172713 3300031901 Bacteria 1566
126 Ga0307409_100628371 3300031995 Bacteria 1065
127 Ga0307409_100905510 3300031995 Bacteria 896
128 Ga0307416_100051702 3300032002 Bacteria 3284
129 Ga0307416_100465350 3300032002 Bacteria 1321
130 Ga0307411_10321855 3300032005 Unclassified 1249
131 Ga0307415_100013692 3300032126 Bacteria 4743
132 Ga0373944_0004121 3300035089 Bacteria 3774
133 Ga0373936_0121004 3300035113 Bacteria 1118
134 Ga0373936_0203800 3300035113 Unclassified 874
135 Ga0373936_0297854 3300035113 Bacteria 727
136 Ga0373939_0375167 3300035114 Bacteria 584
137 Ga0373945_0005770 3300035116 Bacteria 3973
138 Ga0373943_0002305 3300035170 Bacteria 8671
139 Ga0373943_0031502 3300035170 Bacteria 2516
140 Ga0373935_0052047 3300035692 Bacteria 2602
141 Ga0373935_0153244 3300035692 Bacteria 1566
142 Ga0373927_0056255 3300035695 Bacteria 2543
143 Ga0373927_0161973 3300035695 Bacteria 1465
144 Ga0373927_0984951 3300035695 Bacteria 556
145 Ga0373947_0007830 3300035725 Bacteria 6172
146 Ga0373947_0010015 3300035725 Bacteria 5442
147 Ga0373947_0038701 3300035725 Bacteria 2835
148 Ga0373947_0190931 3300035725 Bacteria 1337
149 Ga0373947_0988010 3300035725 Unclassified 574
150 Ga0373947_1146217 3300035725 Bacteria 530
151 Ga0373925_0001797 3300037068 Bacteria 17876
152 Ga0373925_0015745 3300037068 Bacteria 5473
153 Ga0373925_0213952 3300037068 Bacteria 1536
154 Ga0373925_0600554 3300037068 Unclassified 906
155 Ga0395899_0160008 3300037312 Bacteria 1591
156 Ga0395900_0005056 3300037418 Bacteria 13836
157 Ga0395900_0035019 3300037418 Bacteria 5170
158 Ga0395898_0019348 3300037466 Bacteria 6931
159 Ga0395898_0047572 3300037466 Bacteria 4209
160 Ga0395898_0535222 3300037466 Bacteria 1113
161 Ga0395905_0002930 3300037471 Bacteria 18574
162 Ga0395905_0007022 3300037471 Bacteria 11255
163 Ga0395905_0816112 3300037471 Bacteria 836
164 Ga0395901_0004146 3300038443 Bacteria 14623
165 Ga0395901_0016839 3300038443 Bacteria 7449
166 Ga0395901_0302849 3300038443 Bacteria 1657
167 Ga0395901_0394087 3300038443 Bacteria 1423
168 Ga0395901_0606693 3300038443 Bacteria 1103
169 Ga0395901_1084778 3300038443 Unclassified 772
170 Ga0436360_0596939 3300039438 Bacteria 1598
171 Ga0451807_1989614 3300041486 Unclassified 550
172 Ga0451853_1402899 3300041512 Bacteria 639
173 Ga0439448_0010459 3300042005 Bacteria 2754
174 Ga0439463_044050 3300042016 Bacteria 1136
175 Ga0450905_089566 3300042142 Unclassified 542
176 Ga0439459_0011416 3300042438 Unclassified 1566
177 Ga0439460_0083059 3300042461 Bacteria 1008
178 Ga0466969_0046036 3300044656 Bacteria 2164
179 Ga0466969_0248084 3300044656 Bacteria 807
180 Ga0466966_0038274 3300044684 Bacteria 3091
181 Ga0466966_0062071 3300044684 Bacteria 2356
182 Ga0466961_0021458 3300044693 Bacteria 4156
183 Ga0466961_0088333 3300044693 Bacteria 1958
184 Ga0466963_0005668 3300044694 Bacteria 7334
185 Ga0466963_0379422 3300044694 Bacteria 996
186 Ga0466964_0566531 3300044706 Bacteria 619
187 Ga0466971_0071006 3300044719 Bacteria 1581
188 Ga0466971_0226808 3300044719 Bacteria 886
189 Ga0466968_0282683 3300044735 Bacteria 794
190 Ga0466957_0277043 3300044842 Bacteria 1122
191 Ga0466957_0396381 3300044842 Bacteria 943
192 Ga0466957_0915257 3300044842 Bacteria 627
193 Ga0466959_0031281 3300045049 Bacteria 3938
194 Ga0466959_0516760 3300045049 Bacteria 806
195 Ga0466958_0023697 3300045836 Bacteria 3606
196 Ga0466958_0039540 3300045836 Bacteria 2834
197 Ga0466958_0086002 3300045836 Bacteria 1940
198 Ga0466958_0779699 3300045836 Bacteria 623
199 Ga0466967_0088634 3300045976 Bacteria 2808
200 Ga0466967_0115612 3300045976 Bacteria 2471
201 Ga0466967_0308940 3300045976 Bacteria 1523
202 Ga0466967_0458753 3300045976 Bacteria 1246
203 Ga0495592_0098478 3300046454 Bacteria 2087
204 Ga0495603_0042094 3300046455 Bacteria 2731
205 Ga0495629_0005061 3300046459 Bacteria 9864
206 Ga0495629_0100694 3300046459 Bacteria 2016
207 Ga0495629_0321612 3300046459 Bacteria 1057
208 Ga0495641_0010911 3300046461 Bacteria 5220
209 Ga0495641_0025207 3300046461 Bacteria 2921
210 Ga0495641_0235884 3300046461 Bacteria 821
211 Ga0495651_0002540 3300046462 Bacteria 14126
212 Ga0495651_0086787 3300046462 Bacteria 2353
213 Ga0495653_0053030 3300046463 Bacteria 3104
214 Ga0495653_0744644 3300046463 Bacteria 592
215 Ga0495580_0117282 3300046472 Bacteria 1849
216 Ga0495580_0146138 3300046472 Bacteria 1639
217 Ga0495582_0000680 3300046473 Bacteria 18698
218 Ga0495639_0010800 3300046475 Bacteria 3931
219 Ga0495639_0119971 3300046475 Unclassified 1254
220 Ga0495639_0421274 3300046475 Unclassified 676
221 Ga0495662_0034206 3300046476 Bacteria 2454
222 Ga0495662_0050277 3300046476 Bacteria 2012
223 Ga0495662_0055886 3300046476 Bacteria 1906
224 Ga0495594_0056014 3300046499 Bacteria 2175
225 Ga0495594_0140439 3300046499 Bacteria 1370
226 Ga0495594_0385046 3300046499 Bacteria 798
227 Ga0495608_0018347 3300046511 Bacteria 4829
228 Ga0495608_0049034 3300046511 Bacteria 2805
229 Ga0495616_0097518 3300046513 Bacteria 1383
230 Ga0495618_0269956 3300046514 Bacteria 1063
231 Ga0495618_0325663 3300046514 Bacteria 951
232 Ga0495628_0119799 3300046516 Bacteria 2020
233 Ga0495628_0161539 3300046516 Bacteria 1702
234 Ga0495630_0007910 3300046517 Bacteria 7624
235 Ga0495630_0010267 3300046517 Bacteria 6756
236 Ga0495630_0017199 3300046517 Bacteria 5294
237 Ga0495630_0068616 3300046517 Bacteria 2667
238 Ga0495630_0507496 3300046517 Bacteria 925
239 Ga0495630_0600958 3300046517 Archaea 843
240 Ga0495666_0051955 3300046526 Bacteria 1968
241 Ga0495652_0075314 3300046529 Bacteria 2803
242 Ga0495652_0098540 3300046529 Bacteria 2376
243 Ga0495652_0297615 3300046529 Bacteria 1174
244 Ga0495665_0009593 3300046531 Bacteria 5244
245 Ga0495665_0047287 3300046531 Bacteria 2282
246 Ga0495665_0409597 3300046531 Bacteria 687
247 Ga0495640_0014034 3300046533 Bacteria 6077
248 Ga0495586_0197869 3300046535 Bacteria 1139
249 Ga0495587_0228260 3300046536 Bacteria 1049
250 Ga0495645_0082969 3300046543 Bacteria 2298
251 Ga0495645_0094914 3300046543 Bacteria 2127
252 Ga0495622_0205275 3300046557 Unclassified 877
253 Ga0495667_0001367 3300046559 Bacteria 16035
254 Ga0495667_0009905 3300046559 Bacteria 6455
255 Ga0495656_0066607 3300046615 Bacteria 1587
256 Ga0495634_0021950 3300046642 Bacteria 4503
257 Ga0495634_0094431 3300046642 Bacteria 1938
258 Ga0495634_0203013 3300046642 Bacteria 1230
259 Ga0495588_0070640 3300046674 Bacteria 1815
260 Ga0495588_0748000 3300046674 Bacteria 511
261 Ga0495657_0082260 3300046675 Bacteria 2081
262 Ga0495657_0104189 3300046675 Bacteria 1804
263 Ga0495599_0085639 3300046678 Bacteria 1968
264 Ga0495646_0067202 3300046680 Bacteria 2119
265 Ga0495646_0311172 3300046680 Bacteria 831
266 Ga0495647_0001871 3300046681 Bacteria 6539
267 Ga0495647_0265156 3300046681 Unclassified 767
268 Ga0495647_0355734 3300046681 Unclassified 667
269 Ga0495658_0000373 3300046683 Bacteria 25168
270 Ga0495658_0040907 3300046683 Bacteria 2579
271 Ga0495658_0103479 3300046683 Unclassified 1703
272 Ga0495658_0829514 3300046683 Unclassified 592
273 Ga0495613_0027680 3300046689 Bacteria 4218
274 Ga0495613_0057824 3300046689 Bacteria 2847
275 Ga0495613_0314620 3300046689 Bacteria 1081
276 Ga0495624_0007702 3300046690 Bacteria 7557
277 Ga0495670_0289404 3300046691 Bacteria 877
278 Ga0495600_0047806 3300046809 Bacteria 2791
279 Ga0495600_0249413 3300046809 Bacteria 1129
280 Ga0495581_0000297 3300047315 Bacteria 24170
281 Ga0495581_0102076 3300047315 Bacteria 1666
282 Ga0495581_0227643 3300047315 Bacteria 1091
283 Ga0495604_0045456 3300047317 Bacteria 3427
284 Ga0495604_0579194 3300047317 Unclassified 721
285 Ga0495674_0005291 3300047319 Bacteria 12377
286 Ga0495676_0003643 3300047321 Bacteria 13975
287 Ga0495676_0063592 3300047321 Bacteria 2875
288 Ga0495676_0074715 3300047321 Bacteria 2594
289 Ga0495676_0093442 3300047321 Bacteria 2243
290 Ga0495676_0327001 3300047321 Bacteria 1029
291 Ga0495680_0001468 3300047322 Bacteria 25451
292 Ga0495680_0004258 3300047322 Bacteria 13738
293 Ga0495680_0005969 3300047322 Bacteria 11389
294 Ga0495675_0269352 3300047444 Bacteria 1018
295 Ga0495679_071112 3300047446 Bacteria 1002
296 Ga0495684_0008984 3300047471 Bacteria 7717
297 Ga0495684_0025878 3300047471 Bacteria 4509
298 Ga0495684_0062334 3300047471 Bacteria 2836
299 Ga0495593_0006569 3300047673 Bacteria 6805
300 Ga0495614_0079770 3300048089 Bacteria 1417
301 Ga0496100_0025861 3300048903 Bacteria 3592
302 Ga0496100_0065217 3300048903 Bacteria 2412
303 Ga0496100_0269469 3300048903 Bacteria 1266
304 Ga0496100_0562816 3300048903 Unclassified 883
305 Ga0496101_0021871 3300048904 Bacteria 4396
306 Ga0496101_0061306 3300048904 Bacteria 2731
307 Ga0496101_0397798 3300048904 Bacteria 1085
308 Ga0496101_0440242 3300048904 Bacteria 1028
309 Ga0496102_0083722 3300048905 Bacteria 2943
310 Ga0496102_0465011 3300048905 Bacteria 1186
311 Ga0496103_0166775 3300048906 Bacteria 1413
312 Ga0496104_0137767 3300048907 Bacteria 2345
313 Ga0496104_0160854 3300048907 Bacteria 2154
314 Ga0496104_0161326 3300048907 Bacteria 2150
315 Ga0496104_0420889 3300048907 Bacteria 1248
316 Ga0496105_0053623 3300048908 Bacteria 3330
317 Ga0496105_0129377 3300048908 Bacteria 2082
318 Ga0496105_0185920 3300048908 Bacteria 1700
319 Ga0496105_0749748 3300048908 Bacteria 746
320 Ga0496106_0040747 3300048909 Bacteria 3479
321 Ga0496107_0024447 3300048910 Bacteria 4273
322 Ga0496107_0037509 3300048910 Bacteria 3478
323 Ga0496107_0587995 3300048910 Bacteria 823
324 Ga0496107_0841614 3300048910 Bacteria 670
325 Ga0496108_0000473 3300048911 Bacteria 32225
326 Ga0496108_0234153 3300048911 Bacteria 1597
327 Ga0496108_0601621 3300048911 Bacteria 958
328 Ga0496109_0001891 3300048912 Bacteria 17380
329 Ga0496109_0032682 3300048912 Bacteria 4679
330 Ga0496109_0076205 3300048912 Bacteria 3085
331 Ga0496110_0001277 3300048913 Bacteria 18022
332 Ga0496110_0005568 3300048913 Bacteria 9887
333 Ga0496110_0219156 3300048913 Bacteria 1730
334 Ga0496110_0332564 3300048913 Bacteria 1384
335 Ga0496110_0468310 3300048913 Unclassified 1148
336 Ga0496111_0005116 3300048914 Bacteria 8350
337 Ga0496111_0206644 3300048914 Unclassified 1459
338 Ga0496111_0249770 3300048914 Bacteria 1317
339 Ga0496111_0518275 3300048914 Bacteria 877
340 Ga0496111_0649037 3300048914 Bacteria 770
341 Ga0496112_0014155 3300048915 Bacteria 7390
342 Ga0496112_0077189 3300048915 Bacteria 3294
343 Ga0496112_0141408 3300048915 Bacteria 2376
344 Ga0496112_0150410 3300048915 Bacteria 2295
345 Ga0496112_0492476 3300048915 Bacteria 1162
346 Ga0496112_0889968 3300048915 Bacteria 813
347 Ga0496112_0945111 3300048915 Bacteria 783
348 Ga0496112_0959035 3300048915 Bacteria 776
349 Ga0496113_0078575 3300048916 Bacteria 2525
350 Ga0496113_0275921 3300048916 Unclassified 1344
351 Ga0496113_1207796 3300048916 Bacteria 590
352 Ga0496114_0041623 3300048917 Bacteria 3808
353 Ga0496114_0222209 3300048917 Bacteria 1658
354 Ga0496114_0328602 3300048917 Bacteria 1352
355 Ga0496114_0527308 3300048917 Bacteria 1044
356 Ga0496114_0664760 3300048917 Bacteria 915
357 Ga0496114_1300977 3300048917 Unclassified 614
358 Ga0496115_0012781 3300048918 Bacteria 6329
359 Ga0496115_0068442 3300048918 Bacteria 2875
360 Ga0496115_0127518 3300048918 Bacteria 2097
361 Ga0496115_0221611 3300048918 Bacteria 1561
362 Ga0496115_0235427 3300048918 Bacteria 1510
363 Ga0496115_0514378 3300048918 Bacteria 961
364 Ga0501031_0000073 3300049568 Bacteria 53081
365 Ga0501031_0009256 3300049568 Bacteria 6400
366 Ga0501031_0043095 3300049568 Unclassified 2945
367 Ga0501031_0143023 3300049568 Bacteria 1563
368 Ga0501032_0002296 3300049569 Bacteria 15020
369 Ga0501032_0006787 3300049569 Bacteria 8399
370 Ga0501033_0000257 3300049570 Bacteria 50975
371 Ga0501033_0029843 3300049570 Bacteria 4098
372 Ga0501033_0071475 3300049570 Bacteria 2549
373 Ga0501033_0131088 3300049570 Bacteria 1816
374 Ga0501034_0005355 3300049571 Bacteria 14048
375 Ga0501034_0047696 3300049571 Bacteria 4324
376 Ga0501034_0207298 3300049571 Bacteria 1916
377 Ga0501036_0000089 3300049572 Bacteria 57499
378 Ga0501036_0003155 3300049572 Bacteria 13148
379 Ga0501036_0004205 3300049572 Bacteria 11607
380 Ga0501036_0047738 3300049572 Bacteria 3625
381 Ga0501036_0148046 3300049572 Bacteria 1980
382 Ga0501036_0425845 3300049572 Bacteria 1106
383 Ga0501037_0000070 3300049573 Bacteria 94985
384 Ga0501037_0018666 3300049573 Bacteria 5111
385 Ga0501038_0000082 3300049574 Bacteria 80551
386 Ga0501038_0042651 3300049574 Bacteria 3951
387 Ga0501038_0167774 3300049574 Bacteria 1779
388 Ga0501038_0188238 3300049574 Bacteria 1662
389 Ga0501038_0456729 3300049574 Bacteria 981
390 Ga0501038_1317500 3300049574 Bacteria 521
391 Ga0501038_1359779 3300049574 Bacteria 511
392 Ga0501039_0000077 3300049575 Bacteria 74065
393 Ga0501039_0004657 3300049575 Bacteria 10369
394 Ga0501039_0043024 3300049575 Bacteria 3489
395 Ga0501039_0065767 3300049575 Bacteria 2813
396 Ga0501040_0000048 3300049576 Bacteria 55371
397 Ga0501040_0000749 3300049576 Bacteria 20128
398 Ga0501040_0001645 3300049576 Bacteria 14257
399 Ga0501040_0005765 3300049576 Bacteria 8016
400 Ga0501040_0062754 3300049576 Bacteria 2556
401 Ga0501040_0409239 3300049576 Bacteria 974
402 Ga0501040_0559863 3300049576 Bacteria 825
403 Ga0501040_0662315 3300049576 Bacteria 754
404 Ga0501041_0000007 3300049577 Bacteria 64272
405 Ga0501041_0010709 3300049577 Bacteria 5411
406 Ga0501041_0019054 3300049577 Bacteria 4091
407 Ga0501041_0038863 3300049577 Bacteria 2886
408 Ga0501041_0086057 3300049577 Bacteria 1939
409 Ga0501041_0130626 3300049577 Bacteria 1564
410 Ga0501041_0143116 3300049577 Bacteria 1491
411 Ga0501041_0710536 3300049577 Bacteria 643
412 Ga0501042_0000329 3300049578 Bacteria 23679
413 Ga0501042_0016667 3300049578 Bacteria 5050
414 Ga0501042_0033344 3300049578 Bacteria 3650
415 Ga0501042_0040388 3300049578 Bacteria 3317
416 Ga0501042_0445964 3300049578 Bacteria 938
417 Ga0501043_0000208 3300049579 Bacteria 53881
418 Ga0501043_0017096 3300049579 Bacteria 5686
419 Ga0501043_0049296 3300049579 Bacteria 3311
420 Ga0501043_0429283 3300049579 Bacteria 995
421 Ga0501046_0000089 3300049580 Bacteria 99031
422 Ga0501046_0001637 3300049580 Bacteria 21444
423 Ga0501046_0015160 3300049580 Bacteria 6482
424 Ga0501046_0075839 3300049580 Bacteria 2606
425 Ga0501046_0137608 3300049580 Bacteria 1849
426 Ga0501047_0000237 3300049581 Bacteria 65237
427 Ga0501047_0014137 3300049581 Bacteria 7585
428 Ga0501047_0284744 3300049581 Bacteria 1497
429 Ga0501048_0001295 3300049582 Bacteria 18970
430 Ga0501048_0001477 3300049582 Bacteria 17834
431 Ga0501048_0003497 3300049582 Bacteria 11940
432 Ga0501048_0007671 3300049582 Bacteria 8179
433 Ga0501067_0055792 3300049583 Bacteria 2189
434 Ga0501067_0124833 3300049583 Unclassified 1433
435 Ga0501068_0000736 3300049584 Bacteria 16780
436 Ga0501068_0017251 3300049584 Bacteria 4173
437 Ga0501068_0070229 3300049584 Bacteria 2136
438 Ga0501068_0420036 3300049584 Bacteria 863
439 Ga0501069_0000139 3300049585 Bacteria 31998
440 Ga0501069_0050748 3300049585 Bacteria 2307
441 Ga0501070_0005427 3300049586 Bacteria 10884
442 Ga0501070_0005438 3300049586 Bacteria 10873
443 Ga0501070_0007027 3300049586 Bacteria 9576
444 Ga0501070_0439902 3300049586 Bacteria 1052
445 Ga0501070_0523065 3300049586 Bacteria 951
446 Ga0501071_0000004 3300049587 Bacteria 79181
447 Ga0501071_0016545 3300049587 Bacteria 5073
448 Ga0501071_0034713 3300049587 Bacteria 3591
449 Ga0501072_0000805 3300049588 Bacteria 23084
450 Ga0501072_0001596 3300049588 Bacteria 16941
451 Ga0501072_0002135 3300049588 Bacteria 14738
452 Ga0501072_0003604 3300049588 Bacteria 11650
453 Ga0501072_0007897 3300049588 Bacteria 8079
454 Ga0501072_0037377 3300049588 Bacteria 3808
455 Ga0501072_0829250 3300049588 Bacteria 723
456 Ga0501073_0001338 3300049589 Bacteria 18161
457 Ga0501073_0125766 3300049589 Bacteria 1777
458 Ga0501073_0235833 3300049589 Bacteria 1263
459 Ga0501073_0292035 3300049589 Bacteria 1125
460 Ga0501074_0000002 3300049590 Bacteria 121767
461 Ga0501074_0001932 3300049590 Bacteria 14241
462 Ga0501074_0014194 3300049590 Bacteria 5794
463 Ga0501074_0022361 3300049590 Bacteria 4593
464 Ga0501074_0052455 3300049590 Bacteria 2944
465 Ga0501074_0061819 3300049590 Bacteria 2698
466 Ga0501074_0133228 3300049590 Bacteria 1777
467 Ga0501074_0215168 3300049590 Bacteria 1369
468 Ga0501075_0001346 3300049591 Bacteria 15950
469 Ga0501075_0001710 3300049591 Bacteria 14420
470 Ga0501075_0002681 3300049591 Bacteria 11896
471 Ga0501075_0032129 3300049591 Bacteria 3898
472 Ga0501075_0236965 3300049591 Bacteria 1391
473 Ga0501075_0634602 3300049591 Bacteria 815
474 Ga0501076_0000246 3300049592 Bacteria 33219
475 Ga0501076_0000835 3300049592 Bacteria 20024
476 Ga0501076_0000918 3300049592 Bacteria 19216
477 Ga0501076_0002323 3300049592 Bacteria 13027
478 Ga0501076_0130900 3300049592 Bacteria 2034
479 Ga0501076_0192489 3300049592 Bacteria 1664
480 Ga0501076_0762372 3300049592 Bacteria 798
481 Ga0501077_0000090 3300049593 Bacteria 46393
482 Ga0501077_0000235 3300049593 Bacteria 32729
483 Ga0501077_0018165 3300049593 Bacteria 4446
484 Ga0501077_0089337 3300049593 Bacteria 1952
485 Ga0501077_0135273 3300049593 Bacteria 1563
486 Ga0501077_0299451 3300049593 Bacteria 1024
487 Ga0501079_0000679 3300049741 Bacteria 22874
488 Ga0501079_0006539 3300049741 Bacteria 8761
489 Ga0501079_0012020 3300049741 Bacteria 6608
490 Ga0501079_0018169 3300049741 Bacteria 5370
491 Ga0501079_0043700 3300049741 Bacteria 3459
492 Ga0501079_0087911 3300049741 Bacteria 2406
493 Ga0501079_0196071 3300049741 Bacteria 1576
494 Ga0501079_0232272 3300049741 Bacteria 1441
495 Ga0501080_0014379 3300049742 Bacteria 7288
496 Ga0501080_0159085 3300049742 Bacteria 2086
497 Ga0501080_0504797 3300049742 Bacteria 1080
498 Ga0501081_0000112 3300049743 Bacteria 34866
499 Ga0501081_0000598 3300049743 Bacteria 20594
500 Ga0501081_0002712 3300049743 Bacteria 11205
501 Ga0501081_0013081 3300049743 Bacteria 5458
502 Ga0501081_0193213 3300049743 Bacteria 1474
503 Ga0501081_0385265 3300049743 Bacteria 1036
504 Ga0501083_0000183 3300049744 Bacteria 40280
505 Ga0501083_0002925 3300049744 Bacteria 11824
506 Ga0501083_0005190 3300049744 Bacteria 9216
507 Ga0501083_0056217 3300049744 Bacteria 2637
508 Ga0501083_0686236 3300049744 Bacteria 666
509 Ga0501035_0001595 3300049822 Bacteria 22950
510 Ga0501035_0014801 3300049822 Bacteria 7200
511 Ga0501035_0105383 3300049822 Bacteria 2472
512 Ga0501035_0203391 3300049822 Bacteria 1697
513 Ga0501035_0244617 3300049822 Bacteria 1525
514 Ga0501035_0586669 3300049822 Bacteria 910
515 Ga0501044_0003997 3300049823 Bacteria 16516
516 Ga0501044_0008307 3300049823 Bacteria 11375
517 Ga0501045_0000014 3300049824 Bacteria 73464
518 Ga0501045_0023236 3300049824 Bacteria 4443
519 Ga0501045_0024794 3300049824 Bacteria 4308
520 Ga0501045_0143490 3300049824 Bacteria 1776
521 Ga0501045_0150156 3300049824 Bacteria 1733
522 nmdc:mga05p37_486243_c1 3300050507 Unclassified 1420
523 nmdc:mga09592_685651_c1 3300050508 Unclassified 873
524 nmdc:mga06r32_284897_c1 3300050510 Bacteria 1639
525 nmdc:mga08y16_915242_c1 3300050511 Bacteria 862
526 nmdc:mga0n895_93719_c1 3300050512 Bacteria 3006
527 nmdc:mga0rr50_1807275_c1 3300050513 Unclassified 514
528 nmdc:mga0a205_171672_c1 3300050515 Bacteria 2064
529 nmdc:mga0a205_684230_c1 3300050515 Bacteria 876
530 Ga0495601_0057513 3300053077 Bacteria 2463
531 Ga0495601_0464306 3300053077 Unclassified 818
532 Ga0495595_0031455 3300053084 Bacteria 2385
533 Ga0495595_0038490 3300053084 Bacteria 2179
534 Ga0495619_0001234 3300053085 Bacteria 16741
535 Ga0495619_0021199 3300053085 Bacteria 4147
536 Ga0501084_0000332 3300054114 Bacteria 36149
537 Ga0501084_0002377 3300054114 Bacteria 15134
538 Ga0501084_0002602 3300054114 Bacteria 14534
539 Ga0501084_0048316 3300054114 Bacteria 3562
540 Ga0501084_0061493 3300054114 Bacteria 3144
541 Ga0501084_0197932 3300054114 Bacteria 1695
542 Ga0501084_1353440 3300054114 Bacteria 596
543 Ga0501082_0000241 3300060353 Bacteria 47793
544 Ga0501082_0003201 3300060353 Bacteria 14267
545 Ga0501082_0037270 3300060353 Bacteria 4190
546 Ga0501082_0050830 3300060353 Bacteria 3574
547 Ga0501082_0064711 3300060353 Bacteria 3149
548 Ga0501082_0066595 3300060353 Bacteria 3102
549 Ga0501082_0362403 3300060353 Unclassified 1264
550 Ga0501082_0399517 3300060353 Bacteria 1199
551 Ga0530510_0000299 3300061734 Bacteria 31454
552 Ga0530510_0003188 3300061734 Bacteria 11276
553 Ga0530510_0003553 3300061734 Bacteria 10735
554 Ga0530510_0025538 3300061734 Bacteria 4225
555 Ga0530510_0173725 3300061734 Bacteria 1596
556 Ga0530510_0180658 3300061734 Bacteria 1565
557 Ga0530510_0418326 3300061734 Bacteria 1011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1084778 Ga0395901_1084778_156_575 139
2 3300005356 Ga0070674_100213316 Ga0070674_1002133162 141
3 3300005356 Ga0070674_101578803 Ga0070674_1015788031 141
4 3300005366 Ga0070659_100733782 Ga0070659_1007337821 141
5 3300005456 Ga0070678_100168360 Ga0070678_1001683602 141
6 3300005459 Ga0068867_100607332 Ga0068867_1006073322 141
7 3300005844 Ga0068862_102028839 Ga0068862_1020288392 141
8 3300009148 Ga0105243_12195320 Ga0105243_121953201 141
9 3300009176 Ga0105242_11691843 Ga0105242_116918431 141
10 3300014325 Ga0163163_10357809 Ga0163163_103578092 141
11 3300014326 Ga0157380_11386722 Ga0157380_113867222 141
12 3300014745 Ga0157377_10478155 Ga0157377_104781552 141
13 3300025932 Ga0207690_10767130 Ga0207690_107671301 141
14 3300025933 Ga0207706_10139302 Ga0207706_101393023 141
15 3300025934 Ga0207686_10422273 Ga0207686_104222732 141
16 3300025935 Ga0207709_11524313 Ga0207709_115243131 141
17 3300025937 Ga0207669_10128942 Ga0207669_101289422 141
18 3300026075 Ga0207708_11425449 Ga0207708_114254492 141
19 3300026121 Ga0207683_10188629 Ga0207683_101886292 141
20 3300031548 Ga0307408_101224295 Ga0307408_1012242952 141
21 3300031995 Ga0307409_100628371 Ga0307409_1006283712 141
22 3300031995 Ga0307409_100905510 Ga0307409_1009055101 141
23 3300032002 Ga0307416_100465350 Ga0307416_1004653502 141
24 3300032005 Ga0307411_10321855 Ga0307411_103218552 141
25 3300046513 Ga0495616_0097518 Ga0495616_0097518_858_1283 141
26 3300046615 Ga0495656_0066607 Ga0495656_0066607_120_545 141
27 3300046691 Ga0495670_0289404 Ga0495670_0289404_99_524 141
28 3300047446 Ga0495679_071112 Ga0495679_071112_82_507 141
29 3300050511 nmdc:mga08y16_915242_c1 nmdc:mga08y16_915242_c1_178_603 141
30 3300005327 Ga0070658_10315729 Ga0070658_103157292 142
31 3300005329 Ga0070683_100092238 Ga0070683_1000922382 142
32 3300005329 Ga0070683_101418187 Ga0070683_1014181872 142
33 3300005337 Ga0070682_100464052 Ga0070682_1004640521 142
34 3300005338 Ga0068868_100132759 Ga0068868_1001327591 142
35 3300005339 Ga0070660_100073375 Ga0070660_1000733752 142
36 3300005340 Ga0070689_101762774 Ga0070689_1017627741 142
37 3300005347 Ga0070668_100649428 Ga0070668_1006494281 142
38 3300005367 Ga0070667_100004429 Ga0070667_1000044292 142
39 3300005438 Ga0070701_10771840 Ga0070701_107718402 142
40 3300005439 Ga0070711_100491322 Ga0070711_1004913221 142
41 3300005441 Ga0070700_100878871 Ga0070700_1008788712 142
42 3300005445 Ga0070708_100040293 Ga0070708_1000402934 142
43 3300005458 Ga0070681_10368453 Ga0070681_103684531 142
44 3300005467 Ga0070706_100002089 Ga0070706_10000208910 142
45 3300005468 Ga0070707_100000736 Ga0070707_1000007365 142
46 3300005471 Ga0070698_100152401 Ga0070698_1001524012 142
47 3300005471 Ga0070698_100163451 Ga0070698_1001634513 142
48 3300005518 Ga0070699_100028631 Ga0070699_1000286313 142
49 3300005535 Ga0070684_100171022 Ga0070684_1001710222 142
50 3300005535 Ga0070684_100183112 Ga0070684_1001831122 142
51 3300005535 Ga0070684_100361944 Ga0070684_1003619442 142
52 3300005536 Ga0070697_100315422 Ga0070697_1003154222 142
53 3300005539 Ga0068853_101059602 Ga0068853_1010596021 142
54 3300005544 Ga0070686_100048181 Ga0070686_1000481812 142
55 3300005546 Ga0070696_100269235 Ga0070696_1002692351 142
56 3300005547 Ga0070693_101300045 Ga0070693_1013000451 142
57 3300005563 Ga0068855_101814216 Ga0068855_1018142161 142
58 3300005578 Ga0068854_100305170 Ga0068854_1003051702 142
59 3300005616 Ga0068852_101501689 Ga0068852_1015016892 142
60 3300005616 Ga0068852_102176085 Ga0068852_1021760852 142
61 3300005718 Ga0068866_10147819 Ga0068866_101478192 142
62 3300005842 Ga0068858_101059947 Ga0068858_1010599472 142
63 3300005937 Ga0081455_10025857 Ga0081455_100258575 142
64 3300005937 Ga0081455_10340862 Ga0081455_103408622 142
65 3300005937 Ga0081455_10415556 Ga0081455_104155561 142
66 3300005981 Ga0081538_10002763 Ga0081538_1000276310 142
67 3300005981 Ga0081538_10076814 Ga0081538_100768143 142
68 3300005981 Ga0081538_10108181 Ga0081538_101081812 142
69 3300005981 Ga0081538_10159521 Ga0081538_101595212 142
70 3300006175 Ga0070712_100321827 Ga0070712_1003218272 142
71 3300006847 Ga0075431_100048271 Ga0075431_1000482715 142
72 3300006852 Ga0075433_10312486 Ga0075433_103124863 142
73 3300006852 Ga0075433_10636678 Ga0075433_106366782 142
74 3300006871 Ga0075434_101082357 Ga0075434_1010823572 142
75 3300006880 Ga0075429_100546706 Ga0075429_1005467062 142
76 3300009098 Ga0105245_10072744 Ga0105245_100727442 142
77 3300009098 Ga0105245_10624107 Ga0105245_106241072 142
78 3300009101 Ga0105247_10327424 Ga0105247_103274242 142
79 3300009101 Ga0105247_11401522 Ga0105247_114015221 142
80 3300009147 Ga0114129_11440329 Ga0114129_114403292 142
81 3300009147 Ga0114129_11798928 Ga0114129_117989282 142
82 3300009176 Ga0105242_10446519 Ga0105242_104465192 142
83 3300009177 Ga0105248_10332086 Ga0105248_103320862 142
84 3300009177 Ga0105248_12790642 Ga0105248_127906422 142
85 3300009545 Ga0105237_11271284 Ga0105237_112712842 142
86 3300009553 Ga0105249_10272201 Ga0105249_102722012 142
87 3300010375 Ga0105239_10774423 Ga0105239_107744232 142
88 3300010375 Ga0105239_10995366 Ga0105239_109953662 142
89 3300010375 Ga0105239_11867494 Ga0105239_118674941 142
90 3300011119 Ga0105246_10762444 Ga0105246_107624442 142
91 3300013104 Ga0157370_10005484 Ga0157370_100054842 142
92 3300013105 Ga0157369_10230384 Ga0157369_102303842 142
93 3300013297 Ga0157378_10612481 Ga0157378_106124811 142
94 3300013306 Ga0163162_10265554 Ga0163162_102655542 142
95 3300013306 Ga0163162_11400422 Ga0163162_114004222 142
96 3300013308 Ga0157375_10842164 Ga0157375_108421642 142
97 3300013308 Ga0157375_11589068 Ga0157375_115890682 142
98 3300014326 Ga0157380_12038426 Ga0157380_120384262 142
99 3300014968 Ga0157379_10071265 Ga0157379_100712652 142
100 3300014969 Ga0157376_10194914 Ga0157376_101949142 142
101 3300014969 Ga0157376_11817108 Ga0157376_118171082 142
102 3300017792 Ga0163161_10409999 Ga0163161_104099992 142
103 3300017792 Ga0163161_11771296 Ga0163161_117712962 142
104 3300020069 Ga0197907_11257557 Ga0197907_112575572 142
105 3300021441 Ga0213871_10061039 Ga0213871_100610392 142
106 3300025905 Ga0207685_10239067 Ga0207685_102390672 142
107 3300025910 Ga0207684_10004837 Ga0207684_100048375 142
108 3300025910 Ga0207684_11351666 Ga0207684_113516662 142
109 3300025912 Ga0207707_10317187 Ga0207707_103171871 142
110 3300025915 Ga0207693_10550009 Ga0207693_105500092 142
111 3300025916 Ga0207663_10119881 Ga0207663_101198812 142
112 3300025916 Ga0207663_10457810 Ga0207663_104578101 142
113 3300025916 Ga0207663_11717567 Ga0207663_117175671 142
114 3300025919 Ga0207657_10024716 Ga0207657_100247163 142
115 3300025921 Ga0207652_10574797 Ga0207652_105747972 142
116 3300025921 Ga0207652_10811155 Ga0207652_108111552 142
117 3300025922 Ga0207646_10002219 Ga0207646_1000221911 142
118 3300025927 Ga0207687_10308179 Ga0207687_103081792 142
119 3300025929 Ga0207664_10292440 Ga0207664_102924402 142
120 3300025931 Ga0207644_10718446 Ga0207644_107184462 142
121 3300025934 Ga0207686_10071604 Ga0207686_100716042 142
122 3300025937 Ga0207669_10217016 Ga0207669_102170162 142
123 3300025941 Ga0207711_10448061 Ga0207711_104480612 142
124 3300025944 Ga0207661_10135544 Ga0207661_101355443 142
125 3300025944 Ga0207661_10517849 Ga0207661_105178492 142
126 3300025944 Ga0207661_11254559 Ga0207661_112545591 142
127 3300025949 Ga0207667_11027889 Ga0207667_110278891 142
128 3300025986 Ga0207658_10043431 Ga0207658_100434312 142
129 3300026035 Ga0207703_10930756 Ga0207703_109307562 142
130 3300026075 Ga0207708_10684771 Ga0207708_106847712 142
131 3300026142 Ga0207698_11167517 Ga0207698_111675172 142
132 3300026142 Ga0207698_11297071 Ga0207698_112970711 142
133 3300028563 Ga0265319_1042321 Ga0265319_10423212 142
134 3300031251 Ga0265327_10055176 Ga0265327_100551762 142
135 3300031901 Ga0307406_10172713 Ga0307406_101727132 142
136 3300032002 Ga0307416_100051702 Ga0307416_1000517023 142
137 3300032126 Ga0307415_100013692 Ga0307415_1000136922 142
138 3300035089 Ga0373944_0004121 Ga0373944_0004121_3001_3429 142
139 3300035113 Ga0373936_0121004 Ga0373936_0121004_327_764 142
140 3300035113 Ga0373936_0203800 Ga0373936_0203800_379_819 142
141 3300035113 Ga0373936_0297854 Ga0373936_0297854_247_681 142
142 3300035114 Ga0373939_0375167 Ga0373939_0375167_123_551 142
143 3300035116 Ga0373945_0005770 Ga0373945_0005770_435_872 142
144 3300035170 Ga0373943_0002305 Ga0373943_0002305_5620_6057 142
145 3300035170 Ga0373943_0031502 Ga0373943_0031502_167_595 142
146 3300035692 Ga0373935_0052047 Ga0373935_0052047_2099_2536 142
147 3300035692 Ga0373935_0153244 Ga0373935_0153244_812_1240 142
148 3300035695 Ga0373927_0056255 Ga0373927_0056255_1215_1652 142
149 3300035695 Ga0373927_0161973 Ga0373927_0161973_850_1278 142
150 3300035695 Ga0373927_0984951 Ga0373927_0984951_72_503 142
151 3300035725 Ga0373947_0007830 Ga0373947_0007830_310_738 142
152 3300035725 Ga0373947_0010015 Ga0373947_0010015_1968_2405 142
153 3300035725 Ga0373947_0038701 Ga0373947_0038701_669_1100 142
154 3300035725 Ga0373947_0190931 Ga0373947_0190931_380_814 142
155 3300035725 Ga0373947_0988010 Ga0373947_0988010_105_545 142
156 3300035725 Ga0373947_1146217 Ga0373947_1146217_35_469 142
157 3300037068 Ga0373925_0001797 Ga0373925_0001797_5406_5843 142
158 3300037068 Ga0373925_0015745 Ga0373925_0015745_310_738 142
159 3300037068 Ga0373925_0213952 Ga0373925_0213952_475_906 142
160 3300037068 Ga0373925_0600554 Ga0373925_0600554_349_789 142
161 3300037312 Ga0395899_0160008 Ga0395899_0160008_770_1204 142
162 3300037418 Ga0395900_0005056 Ga0395900_0005056_7487_7915 142
163 3300037418 Ga0395900_0035019 Ga0395900_0035019_4713_5147 142
164 3300037466 Ga0395898_0019348 Ga0395898_0019348_3808_4242 142
165 3300037466 Ga0395898_0047572 Ga0395898_0047572_2795_3223 142
166 3300037466 Ga0395898_0535222 Ga0395898_0535222_107_535 142
167 3300037471 Ga0395905_0002930 Ga0395905_0002930_3246_3674 142
168 3300037471 Ga0395905_0007022 Ga0395905_0007022_3724_4158 142
169 3300037471 Ga0395905_0816112 Ga0395905_0816112_268_702 142
170 3300038443 Ga0395901_0004146 Ga0395901_0004146_8055_8483 142
171 3300038443 Ga0395901_0016839 Ga0395901_0016839_6246_6680 142
172 3300038443 Ga0395901_0302849 Ga0395901_0302849_97_531 142
173 3300038443 Ga0395901_0394087 Ga0395901_0394087_465_893 142
174 3300038443 Ga0395901_0606693 Ga0395901_0606693_377_811 142
175 3300039438 Ga0436360_0596939 Ga0436360_0596939_260_691 142
176 3300041486 Ga0451807_1989614 Ga0451807_1989614_110_538 142
177 3300041512 Ga0451853_1402899 Ga0451853_1402899_115_549 142
178 3300042005 Ga0439448_0010459 Ga0439448_0010459_1177_1605 142
179 3300042016 Ga0439463_044050 Ga0439463_044050_372_800 142
180 3300042142 Ga0450905_089566 Ga0450905_089566_21_458 142
181 3300042438 Ga0439459_0011416 Ga0439459_0011416_143_571 142
182 3300042461 Ga0439460_0083059 Ga0439460_0083059_462_890 142
183 3300044656 Ga0466969_0046036 Ga0466969_0046036_875_1306 142
184 3300044656 Ga0466969_0248084 Ga0466969_0248084_45_479 142
185 3300044684 Ga0466966_0038274 Ga0466966_0038274_2517_2951 142
186 3300044684 Ga0466966_0062071 Ga0466966_0062071_1692_2123 142
187 3300044693 Ga0466961_0021458 Ga0466961_0021458_3235_3666 142
188 3300044693 Ga0466961_0088333 Ga0466961_0088333_100_534 142
189 3300044694 Ga0466963_0005668 Ga0466963_0005668_1105_1539 142
190 3300044694 Ga0466963_0379422 Ga0466963_0379422_414_845 142
191 3300044706 Ga0466964_0566531 Ga0466964_0566531_11_442 142
192 3300044719 Ga0466971_0071006 Ga0466971_0071006_646_1077 142
193 3300044719 Ga0466971_0226808 Ga0466971_0226808_411_839 142
194 3300044735 Ga0466968_0282683 Ga0466968_0282683_271_705 142
195 3300044842 Ga0466957_0277043 Ga0466957_0277043_646_1083 142
196 3300044842 Ga0466957_0396381 Ga0466957_0396381_392_823 142
197 3300044842 Ga0466957_0915257 Ga0466957_0915257_14_448 142
198 3300045049 Ga0466959_0031281 Ga0466959_0031281_3303_3737 142
199 3300045049 Ga0466959_0516760 Ga0466959_0516760_292_723 142
200 3300045836 Ga0466958_0023697 Ga0466958_0023697_1643_2077 142
201 3300045836 Ga0466958_0039540 Ga0466958_0039540_1442_1873 142
202 3300045836 Ga0466958_0086002 Ga0466958_0086002_947_1384 142
203 3300045836 Ga0466958_0779699 Ga0466958_0779699_84_512 142
204 3300045976 Ga0466967_0088634 Ga0466967_0088634_731_1165 142
205 3300045976 Ga0466967_0115612 Ga0466967_0115612_771_1202 142
206 3300045976 Ga0466967_0308940 Ga0466967_0308940_733_1164 142
207 3300045976 Ga0466967_0458753 Ga0466967_0458753_186_623 142
208 3300046454 Ga0495592_0098478 Ga0495592_0098478_690_1124 142
209 3300046455 Ga0495603_0042094 Ga0495603_0042094_145_576 142
210 3300046459 Ga0495629_0005061 Ga0495629_0005061_1861_2298 142
211 3300046459 Ga0495629_0100694 Ga0495629_0100694_1299_1733 142
212 3300046459 Ga0495629_0321612 Ga0495629_0321612_82_513 142
213 3300046461 Ga0495641_0010911 Ga0495641_0010911_3939_4376 142
214 3300046461 Ga0495641_0025207 Ga0495641_0025207_1006_1446 142
215 3300046461 Ga0495641_0235884 Ga0495641_0235884_133_561 142
216 3300046462 Ga0495651_0002540 Ga0495651_0002540_12121_12555 142
217 3300046462 Ga0495651_0086787 Ga0495651_0086787_1840_2277 142
218 3300046463 Ga0495653_0053030 Ga0495653_0053030_1753_2190 142
219 3300046463 Ga0495653_0744644 Ga0495653_0744644_80_514 142
220 3300046472 Ga0495580_0117282 Ga0495580_0117282_986_1426 142
221 3300046472 Ga0495580_0146138 Ga0495580_0146138_43_471 142
222 3300046473 Ga0495582_0000680 Ga0495582_0000680_8114_8551 142
223 3300046475 Ga0495639_0010800 Ga0495639_0010800_1209_1646 142
224 3300046475 Ga0495639_0119971 Ga0495639_0119971_507_947 142
225 3300046475 Ga0495639_0421274 Ga0495639_0421274_104_532 142
226 3300046476 Ga0495662_0034206 Ga0495662_0034206_1262_1696 142
227 3300046476 Ga0495662_0050277 Ga0495662_0050277_856_1296 142
228 3300046476 Ga0495662_0055886 Ga0495662_0055886_177_614 142
229 3300046499 Ga0495594_0056014 Ga0495594_0056014_225_653 142
230 3300046499 Ga0495594_0140439 Ga0495594_0140439_385_822 142
231 3300046499 Ga0495594_0385046 Ga0495594_0385046_130_558 142
232 3300046511 Ga0495608_0018347 Ga0495608_0018347_372_809 142
233 3300046511 Ga0495608_0049034 Ga0495608_0049034_611_1045 142
234 3300046514 Ga0495618_0269956 Ga0495618_0269956_239_673 142
235 3300046514 Ga0495618_0325663 Ga0495618_0325663_131_568 142
236 3300046516 Ga0495628_0119799 Ga0495628_0119799_914_1348 142
237 3300046516 Ga0495628_0161539 Ga0495628_0161539_1161_1598 142
238 3300046517 Ga0495630_0007910 Ga0495630_0007910_1862_2299 142
239 3300046517 Ga0495630_0010267 Ga0495630_0010267_2646_3080 142
240 3300046517 Ga0495630_0017199 Ga0495630_0017199_304_738 142
241 3300046517 Ga0495630_0068616 Ga0495630_0068616_840_1271 142
242 3300046517 Ga0495630_0507496 Ga0495630_0507496_375_803 142
243 3300046517 Ga0495630_0600958 Ga0495630_0600958_153_590 142
244 3300046526 Ga0495666_0051955 Ga0495666_0051955_21_458 142
245 3300046529 Ga0495652_0075314 Ga0495652_0075314_1466_1903 142
246 3300046529 Ga0495652_0098540 Ga0495652_0098540_1716_2150 142
247 3300046529 Ga0495652_0297615 Ga0495652_0297615_45_482 142
248 3300046531 Ga0495665_0009593 Ga0495665_0009593_3134_3571 142
249 3300046531 Ga0495665_0047287 Ga0495665_0047287_711_1151 142
250 3300046531 Ga0495665_0409597 Ga0495665_0409597_100_534 142
251 3300046533 Ga0495640_0014034 Ga0495640_0014034_2446_2880 142
252 3300046535 Ga0495586_0197869 Ga0495586_0197869_33_467 142
253 3300046536 Ga0495587_0228260 Ga0495587_0228260_370_807 142
254 3300046543 Ga0495645_0082969 Ga0495645_0082969_1638_2072 142
255 3300046543 Ga0495645_0094914 Ga0495645_0094914_1105_1542 142
256 3300046557 Ga0495622_0205275 Ga0495622_0205275_89_520 142
257 3300046559 Ga0495667_0001367 Ga0495667_0001367_1829_2263 142
258 3300046559 Ga0495667_0009905 Ga0495667_0009905_4362_4799 142
259 3300046642 Ga0495634_0021950 Ga0495634_0021950_3264_3695 142
260 3300046642 Ga0495634_0094431 Ga0495634_0094431_1283_1717 142
261 3300046642 Ga0495634_0203013 Ga0495634_0203013_782_1219 142
262 3300046674 Ga0495588_0070640 Ga0495588_0070640_375_806 142
263 3300046674 Ga0495588_0748000 Ga0495588_0748000_29_466 142
264 3300046675 Ga0495657_0082260 Ga0495657_0082260_1386_1820 142
265 3300046675 Ga0495657_0104189 Ga0495657_0104189_767_1204 142
266 3300046678 Ga0495599_0085639 Ga0495599_0085639_863_1297 142
267 3300046680 Ga0495646_0067202 Ga0495646_0067202_1081_1515 142
268 3300046680 Ga0495646_0311172 Ga0495646_0311172_287_724 142
269 3300046681 Ga0495647_0001871 Ga0495647_0001871_3537_3974 142
270 3300046681 Ga0495647_0265156 Ga0495647_0265156_25_465 142
271 3300046681 Ga0495647_0355734 Ga0495647_0355734_192_620 142
272 3300046683 Ga0495658_0000373 Ga0495658_0000373_20655_21092 142
273 3300046683 Ga0495658_0040907 Ga0495658_0040907_532_963 142
274 3300046683 Ga0495658_0103479 Ga0495658_0103479_258_698 142
275 3300046683 Ga0495658_0829514 Ga0495658_0829514_135_563 142
276 3300046689 Ga0495613_0027680 Ga0495613_0027680_1923_2360 142
277 3300046689 Ga0495613_0057824 Ga0495613_0057824_172_603 142
278 3300046689 Ga0495613_0314620 Ga0495613_0314620_282_716 142
279 3300046690 Ga0495624_0007702 Ga0495624_0007702_4412_4849 142
280 3300046809 Ga0495600_0047806 Ga0495600_0047806_777_1214 142
281 3300046809 Ga0495600_0249413 Ga0495600_0249413_586_1020 142
282 3300047315 Ga0495581_0000297 Ga0495581_0000297_14160_14600 142
283 3300047315 Ga0495581_0102076 Ga0495581_0102076_385_822 142
284 3300047315 Ga0495581_0227643 Ga0495581_0227643_474_902 142
285 3300047317 Ga0495604_0045456 Ga0495604_0045456_1911_2345 142
286 3300047317 Ga0495604_0579194 Ga0495604_0579194_156_593 142
287 3300047319 Ga0495674_0005291 Ga0495674_0005291_7622_8056 142
288 3300047321 Ga0495676_0003643 Ga0495676_0003643_2550_2987 142
289 3300047321 Ga0495676_0063592 Ga0495676_0063592_1826_2257 142
290 3300047321 Ga0495676_0074715 Ga0495676_0074715_20_460 142
291 3300047321 Ga0495676_0093442 Ga0495676_0093442_1473_1901 142
292 3300047321 Ga0495676_0327001 Ga0495676_0327001_263_691 142
293 3300047322 Ga0495680_0001468 Ga0495680_0001468_10029_10463 142
294 3300047322 Ga0495680_0004258 Ga0495680_0004258_8923_9360 142
295 3300047322 Ga0495680_0005969 Ga0495680_0005969_10274_10711 142
296 3300047444 Ga0495675_0269352 Ga0495675_0269352_324_758 142
297 3300047471 Ga0495684_0008984 Ga0495684_0008984_2671_3108 142
298 3300047471 Ga0495684_0025878 Ga0495684_0025878_1716_2150 142
299 3300047471 Ga0495684_0062334 Ga0495684_0062334_111_548 142
300 3300047673 Ga0495593_0006569 Ga0495593_0006569_1095_1532 142
301 3300048089 Ga0495614_0079770 Ga0495614_0079770_209_646 142
302 3300048903 Ga0496100_0025861 Ga0496100_0025861_2581_3015 142
303 3300048903 Ga0496100_0065217 Ga0496100_0065217_908_1348 142
304 3300048903 Ga0496100_0269469 Ga0496100_0269469_668_1096 142
305 3300048903 Ga0496100_0562816 Ga0496100_0562816_341_772 142
306 3300048904 Ga0496101_0021871 Ga0496101_0021871_2687_3127 142
307 3300048904 Ga0496101_0061306 Ga0496101_0061306_1122_1556 142
308 3300048904 Ga0496101_0397798 Ga0496101_0397798_461_889 142
309 3300048904 Ga0496101_0440242 Ga0496101_0440242_108_539 142
310 3300048905 Ga0496102_0083722 Ga0496102_0083722_1606_2046 142
311 3300048905 Ga0496102_0465011 Ga0496102_0465011_530_958 142
312 3300048906 Ga0496103_0166775 Ga0496103_0166775_456_884 142
313 3300048907 Ga0496104_0137767 Ga0496104_0137767_1480_1917 142
314 3300048907 Ga0496104_0160854 Ga0496104_0160854_1195_1635 142
315 3300048907 Ga0496104_0161326 Ga0496104_0161326_1021_1452 142
316 3300048907 Ga0496104_0420889 Ga0496104_0420889_660_1091 142
317 3300048908 Ga0496105_0053623 Ga0496105_0053623_2042_2482 142
318 3300048908 Ga0496105_0129377 Ga0496105_0129377_488_925 142
319 3300048908 Ga0496105_0185920 Ga0496105_0185920_64_495 142
320 3300048908 Ga0496105_0749748 Ga0496105_0749748_149_577 142
321 3300048909 Ga0496106_0040747 Ga0496106_0040747_1098_1532 142
322 3300048910 Ga0496107_0024447 Ga0496107_0024447_1182_1616 142
323 3300048910 Ga0496107_0037509 Ga0496107_0037509_1686_2114 142
324 3300048910 Ga0496107_0587995 Ga0496107_0587995_165_605 142
325 3300048910 Ga0496107_0841614 Ga0496107_0841614_83_514 142
326 3300048911 Ga0496108_0000473 Ga0496108_0000473_1429_1860 142
327 3300048911 Ga0496108_0234153 Ga0496108_0234153_458_886 142
328 3300048911 Ga0496108_0601621 Ga0496108_0601621_282_713 142
329 3300048912 Ga0496109_0001891 Ga0496109_0001891_1347_1778 142
330 3300048912 Ga0496109_0032682 Ga0496109_0032682_1670_2098 142
331 3300048912 Ga0496109_0076205 Ga0496109_0076205_2016_2444 142
332 3300048913 Ga0496110_0001277 Ga0496110_0001277_7156_7587 142
333 3300048913 Ga0496110_0005568 Ga0496110_0005568_7279_7707 142
334 3300048913 Ga0496110_0219156 Ga0496110_0219156_288_716 142
335 3300048913 Ga0496110_0332564 Ga0496110_0332564_258_695 142
336 3300048913 Ga0496110_0468310 Ga0496110_0468310_443_871 142
337 3300048914 Ga0496111_0005116 Ga0496111_0005116_5497_5928 142
338 3300048914 Ga0496111_0206644 Ga0496111_0206644_407_835 142
339 3300048914 Ga0496111_0249770 Ga0496111_0249770_764_1192 142
340 3300048914 Ga0496111_0518275 Ga0496111_0518275_413_841 142
341 3300048914 Ga0496111_0649037 Ga0496111_0649037_285_713 142
342 3300048915 Ga0496112_0014155 Ga0496112_0014155_5792_6220 142
343 3300048915 Ga0496112_0077189 Ga0496112_0077189_1005_1433 142
344 3300048915 Ga0496112_0141408 Ga0496112_0141408_992_1420 142
345 3300048915 Ga0496112_0150410 Ga0496112_0150410_131_559 142
346 3300048915 Ga0496112_0492476 Ga0496112_0492476_209_637 142
347 3300048915 Ga0496112_0889968 Ga0496112_0889968_149_580 142
348 3300048915 Ga0496112_0945111 Ga0496112_0945111_237_668 142
349 3300048915 Ga0496112_0959035 Ga0496112_0959035_331_759 142
350 3300048916 Ga0496113_0078575 Ga0496113_0078575_110_538 142
351 3300048916 Ga0496113_0275921 Ga0496113_0275921_407_835 142
352 3300048916 Ga0496113_1207796 Ga0496113_1207796_131_568 142
353 3300048917 Ga0496114_0041623 Ga0496114_0041623_567_995 142
354 3300048917 Ga0496114_0222209 Ga0496114_0222209_1044_1484 142
355 3300048917 Ga0496114_0328602 Ga0496114_0328602_261_692 142
356 3300048917 Ga0496114_0527308 Ga0496114_0527308_593_1021 142
357 3300048917 Ga0496114_0664760 Ga0496114_0664760_257_688 142
358 3300048917 Ga0496114_1300977 Ga0496114_1300977_169_603 142
359 3300048918 Ga0496115_0012781 Ga0496115_0012781_4602_5039 142
360 3300048918 Ga0496115_0068442 Ga0496115_0068442_1569_2009 142
361 3300048918 Ga0496115_0127518 Ga0496115_0127518_1462_1896 142
362 3300048918 Ga0496115_0221611 Ga0496115_0221611_824_1252 142
363 3300048918 Ga0496115_0235427 Ga0496115_0235427_616_1044 142
364 3300048918 Ga0496115_0514378 Ga0496115_0514378_500_934 142
365 3300049568 Ga0501031_0000073 Ga0501031_0000073_12154_12582 142
366 3300049568 Ga0501031_0009256 Ga0501031_0009256_3526_3954 142
367 3300049568 Ga0501031_0043095 Ga0501031_0043095_1419_1847 142
368 3300049568 Ga0501031_0143023 Ga0501031_0143023_752_1180 142
369 3300049569 Ga0501032_0002296 Ga0501032_0002296_4449_4877 142
370 3300049569 Ga0501032_0006787 Ga0501032_0006787_4095_4523 142
371 3300049570 Ga0501033_0000257 Ga0501033_0000257_5997_6425 142
372 3300049570 Ga0501033_0029843 Ga0501033_0029843_3630_4058 142
373 3300049570 Ga0501033_0071475 Ga0501033_0071475_462_890 142
374 3300049570 Ga0501033_0131088 Ga0501033_0131088_825_1343 142
375 3300049571 Ga0501034_0005355 Ga0501034_0005355_6492_6920 142
376 3300049571 Ga0501034_0047696 Ga0501034_0047696_2111_2542 142
377 3300049571 Ga0501034_0207298 Ga0501034_0207298_1457_1885 142
378 3300049572 Ga0501036_0000089 Ga0501036_0000089_12773_13201 142
379 3300049572 Ga0501036_0003155 Ga0501036_0003155_5460_5888 142
380 3300049572 Ga0501036_0004205 Ga0501036_0004205_3623_4051 142
381 3300049572 Ga0501036_0047738 Ga0501036_0047738_1381_1809 142
382 3300049572 Ga0501036_0148046 Ga0501036_0148046_678_1106 142
383 3300049572 Ga0501036_0425845 Ga0501036_0425845_597_1025 142
384 3300049573 Ga0501037_0000070 Ga0501037_0000070_9079_9507 142
385 3300049573 Ga0501037_0018666 Ga0501037_0018666_524_952 142
386 3300049574 Ga0501038_0000082 Ga0501038_0000082_68492_68920 142
387 3300049574 Ga0501038_0042651 Ga0501038_0042651_738_1166 142
388 3300049574 Ga0501038_0167774 Ga0501038_0167774_1183_1611 142
389 3300049574 Ga0501038_0188238 Ga0501038_0188238_508_936 142
390 3300049574 Ga0501038_0456729 Ga0501038_0456729_379_807 142
391 3300049574 Ga0501038_1317500 Ga0501038_1317500_17_445 142
392 3300049574 Ga0501038_1359779 Ga0501038_1359779_64_492 142
393 3300049575 Ga0501039_0000077 Ga0501039_0000077_41953_42381 142
394 3300049575 Ga0501039_0004657 Ga0501039_0004657_1183_1611 142
395 3300049575 Ga0501039_0043024 Ga0501039_0043024_1473_1901 142
396 3300049575 Ga0501039_0065767 Ga0501039_0065767_1125_1553 142
397 3300049576 Ga0501040_0000048 Ga0501040_0000048_14757_15185 142
398 3300049576 Ga0501040_0000749 Ga0501040_0000749_10287_10715 142
399 3300049576 Ga0501040_0001645 Ga0501040_0001645_11097_11525 142
400 3300049576 Ga0501040_0005765 Ga0501040_0005765_1810_2238 142
401 3300049576 Ga0501040_0062754 Ga0501040_0062754_1399_1827 142
402 3300049576 Ga0501040_0409239 Ga0501040_0409239_162_590 142
403 3300049576 Ga0501040_0559863 Ga0501040_0559863_180_608 142
404 3300049576 Ga0501040_0662315 Ga0501040_0662315_311_739 142
405 3300049577 Ga0501041_0000007 Ga0501041_0000007_4401_4829 142
406 3300049577 Ga0501041_0010709 Ga0501041_0010709_1419_1847 142
407 3300049577 Ga0501041_0019054 Ga0501041_0019054_648_1076 142
408 3300049577 Ga0501041_0038863 Ga0501041_0038863_1453_1881 142
409 3300049577 Ga0501041_0086057 Ga0501041_0086057_1367_1795 142
410 3300049577 Ga0501041_0130626 Ga0501041_0130626_984_1412 142
411 3300049577 Ga0501041_0143116 Ga0501041_0143116_267_695 142
412 3300049577 Ga0501041_0710536 Ga0501041_0710536_150_584 142
413 3300049578 Ga0501042_0000329 Ga0501042_0000329_12946_13374 142
414 3300049578 Ga0501042_0016667 Ga0501042_0016667_4337_4765 142
415 3300049578 Ga0501042_0033344 Ga0501042_0033344_3182_3610 142
416 3300049578 Ga0501042_0040388 Ga0501042_0040388_1548_1976 142
417 3300049578 Ga0501042_0445964 Ga0501042_0445964_413_841 142
418 3300049579 Ga0501043_0000208 Ga0501043_0000208_32945_33373 142
419 3300049579 Ga0501043_0017096 Ga0501043_0017096_1099_1527 142
420 3300049579 Ga0501043_0049296 Ga0501043_0049296_1264_1692 142
421 3300049579 Ga0501043_0429283 Ga0501043_0429283_62_490 142
422 3300049580 Ga0501046_0000089 Ga0501046_0000089_68432_68860 142
423 3300049580 Ga0501046_0001637 Ga0501046_0001637_7557_7985 142
424 3300049580 Ga0501046_0015160 Ga0501046_0015160_1535_1963 142
425 3300049580 Ga0501046_0075839 Ga0501046_0075839_126_554 142
426 3300049580 Ga0501046_0137608 Ga0501046_0137608_419_847 142
427 3300049581 Ga0501047_0000237 Ga0501047_0000237_19972_20400 142
428 3300049581 Ga0501047_0014137 Ga0501047_0014137_4095_4523 142
429 3300049581 Ga0501047_0284744 Ga0501047_0284744_167_598 142
430 3300049582 Ga0501048_0001295 Ga0501048_0001295_4906_5334 142
431 3300049582 Ga0501048_0001477 Ga0501048_0001477_5008_5436 142
432 3300049582 Ga0501048_0003497 Ga0501048_0003497_1807_2235 142
433 3300049582 Ga0501048_0007671 Ga0501048_0007671_5034_5462 142
434 3300049583 Ga0501067_0055792 Ga0501067_0055792_775_1206 142
435 3300049583 Ga0501067_0124833 Ga0501067_0124833_710_1141 142
436 3300049584 Ga0501068_0000736 Ga0501068_0000736_10734_11162 142
437 3300049584 Ga0501068_0017251 Ga0501068_0017251_41_469 142
438 3300049584 Ga0501068_0070229 Ga0501068_0070229_452_880 142
439 3300049584 Ga0501068_0420036 Ga0501068_0420036_188_616 142
440 3300049585 Ga0501069_0000139 Ga0501069_0000139_2247_2675 142
441 3300049585 Ga0501069_0050748 Ga0501069_0050748_299_727 142
442 3300049586 Ga0501070_0005427 Ga0501070_0005427_5630_6058 142
443 3300049586 Ga0501070_0005438 Ga0501070_0005438_9659_10090 142
444 3300049586 Ga0501070_0007027 Ga0501070_0007027_5282_5713 142
445 3300049586 Ga0501070_0439902 Ga0501070_0439902_241_669 142
446 3300049586 Ga0501070_0523065 Ga0501070_0523065_41_469 142
447 3300049587 Ga0501071_0000004 Ga0501071_0000004_12790_13218 142
448 3300049587 Ga0501071_0016545 Ga0501071_0016545_1812_2240 142
449 3300049587 Ga0501071_0034713 Ga0501071_0034713_279_707 142
450 3300049588 Ga0501072_0000805 Ga0501072_0000805_12673_13101 142
451 3300049588 Ga0501072_0001596 Ga0501072_0001596_9325_9753 142
452 3300049588 Ga0501072_0002135 Ga0501072_0002135_4933_5361 142
453 3300049588 Ga0501072_0003604 Ga0501072_0003604_2982_3410 142
454 3300049588 Ga0501072_0007897 Ga0501072_0007897_3883_4314 142
455 3300049588 Ga0501072_0037377 Ga0501072_0037377_762_1190 142
456 3300049588 Ga0501072_0829250 Ga0501072_0829250_241_669 142
457 3300049589 Ga0501073_0001338 Ga0501073_0001338_1716_2144 142
458 3300049589 Ga0501073_0125766 Ga0501073_0125766_571_1002 142
459 3300049589 Ga0501073_0235833 Ga0501073_0235833_312_740 142
460 3300049589 Ga0501073_0292035 Ga0501073_0292035_376_804 142
461 3300049590 Ga0501074_0000002 Ga0501074_0000002_42834_43262 142
462 3300049590 Ga0501074_0001932 Ga0501074_0001932_396_824 142
463 3300049590 Ga0501074_0014194 Ga0501074_0014194_3618_4049 142
464 3300049590 Ga0501074_0022361 Ga0501074_0022361_2474_2905 142
465 3300049590 Ga0501074_0052455 Ga0501074_0052455_1125_1553 142
466 3300049590 Ga0501074_0061819 Ga0501074_0061819_1429_1857 142
467 3300049590 Ga0501074_0133228 Ga0501074_0133228_541_969 142
468 3300049590 Ga0501074_0215168 Ga0501074_0215168_688_1116 142
469 3300049591 Ga0501075_0001346 Ga0501075_0001346_5172_5600 142
470 3300049591 Ga0501075_0001710 Ga0501075_0001710_10336_10764 142
471 3300049591 Ga0501075_0002681 Ga0501075_0002681_10050_10478 142
472 3300049591 Ga0501075_0032129 Ga0501075_0032129_1738_2166 142
473 3300049591 Ga0501075_0236965 Ga0501075_0236965_890_1318 142
474 3300049591 Ga0501075_0634602 Ga0501075_0634602_341_769 142
475 3300049592 Ga0501076_0000246 Ga0501076_0000246_22009_22437 142
476 3300049592 Ga0501076_0000835 Ga0501076_0000835_5458_5886 142
477 3300049592 Ga0501076_0000918 Ga0501076_0000918_8438_8866 142
478 3300049592 Ga0501076_0002323 Ga0501076_0002323_2539_2967 142
479 3300049592 Ga0501076_0130900 Ga0501076_0130900_36_464 142
480 3300049592 Ga0501076_0192489 Ga0501076_0192489_488_916 142
481 3300049592 Ga0501076_0762372 Ga0501076_0762372_108_536 142
482 3300049593 Ga0501077_0000090 Ga0501077_0000090_4326_4754 142
483 3300049593 Ga0501077_0000235 Ga0501077_0000235_20611_21039 142
484 3300049593 Ga0501077_0018165 Ga0501077_0018165_396_824 142
485 3300049593 Ga0501077_0089337 Ga0501077_0089337_73_501 142
486 3300049593 Ga0501077_0135273 Ga0501077_0135273_430_858 142
487 3300049593 Ga0501077_0299451 Ga0501077_0299451_412_840 142
488 3300049741 Ga0501079_0000679 Ga0501079_0000679_12141_12569 142
489 3300049741 Ga0501079_0006539 Ga0501079_0006539_5524_5952 142
490 3300049741 Ga0501079_0012020 Ga0501079_0012020_5932_6360 142
491 3300049741 Ga0501079_0018169 Ga0501079_0018169_1099_1527 142
492 3300049741 Ga0501079_0043700 Ga0501079_0043700_2999_3430 142
493 3300049741 Ga0501079_0087911 Ga0501079_0087911_1042_1473 142
494 3300049741 Ga0501079_0196071 Ga0501079_0196071_346_774 142
495 3300049741 Ga0501079_0232272 Ga0501079_0232272_267_695 142
496 3300049742 Ga0501080_0014379 Ga0501080_0014379_4231_4659 142
497 3300049742 Ga0501080_0159085 Ga0501080_0159085_1554_1985 142
498 3300049742 Ga0501080_0504797 Ga0501080_0504797_256_684 142
499 3300049743 Ga0501081_0000112 Ga0501081_0000112_14606_15034 142
500 3300049743 Ga0501081_0000598 Ga0501081_0000598_4401_4829 142
501 3300049743 Ga0501081_0002712 Ga0501081_0002712_10527_10955 142
502 3300049743 Ga0501081_0013081 Ga0501081_0013081_1458_1886 142
503 3300049743 Ga0501081_0193213 Ga0501081_0193213_290_718 142
504 3300049743 Ga0501081_0385265 Ga0501081_0385265_428_856 142
505 3300049744 Ga0501083_0000183 Ga0501083_0000183_27154_27582 142
506 3300049744 Ga0501083_0002925 Ga0501083_0002925_2638_3066 142
507 3300049744 Ga0501083_0005190 Ga0501083_0005190_4173_4604 142
508 3300049744 Ga0501083_0056217 Ga0501083_0056217_1146_1574 142
509 3300049744 Ga0501083_0686236 Ga0501083_0686236_146_577 142
510 3300049822 Ga0501035_0001595 Ga0501035_0001595_9850_10278 142
511 3300049822 Ga0501035_0014801 Ga0501035_0014801_3063_3491 142
512 3300049822 Ga0501035_0105383 Ga0501035_0105383_307_735 142
513 3300049822 Ga0501035_0203391 Ga0501035_0203391_1120_1548 142
514 3300049822 Ga0501035_0244617 Ga0501035_0244617_539_967 142
515 3300049822 Ga0501035_0586669 Ga0501035_0586669_278_706 142
516 3300049823 Ga0501044_0003997 Ga0501044_0003997_14778_15206 142
517 3300049823 Ga0501044_0008307 Ga0501044_0008307_8528_8956 142
518 3300049824 Ga0501045_0000014 Ga0501045_0000014_60271_60699 142
519 3300049824 Ga0501045_0023236 Ga0501045_0023236_3318_3746 142
520 3300049824 Ga0501045_0024794 Ga0501045_0024794_3703_4131 142
521 3300049824 Ga0501045_0143490 Ga0501045_0143490_310_762 142
522 3300049824 Ga0501045_0150156 Ga0501045_0150156_596_1024 142
523 3300050507 nmdc:mga05p37_486243_c1 nmdc:mga05p37_486243_c1_206_634 142
524 3300050508 nmdc:mga09592_685651_c1 nmdc:mga09592_685651_c1_106_537 142
525 3300050510 nmdc:mga06r32_284897_c1 nmdc:mga06r32_284897_c1_128_568 142
526 3300050512 nmdc:mga0n895_93719_c1 nmdc:mga0n895_93719_c1_1500_1928 142
527 3300050513 nmdc:mga0rr50_1807275_c1 nmdc:mga0rr50_1807275_c1_61_489 142
528 3300050515 nmdc:mga0a205_171672_c1 nmdc:mga0a205_171672_c1_1410_1838 142
529 3300050515 nmdc:mga0a205_684230_c1 nmdc:mga0a205_684230_c1_38_466 142
530 3300053077 Ga0495601_0057513 Ga0495601_0057513_1324_1761 142
531 3300053077 Ga0495601_0464306 Ga0495601_0464306_53_490 142
532 3300053084 Ga0495595_0031455 Ga0495595_0031455_1195_1632 142
533 3300053084 Ga0495595_0038490 Ga0495595_0038490_1609_2043 142
534 3300053085 Ga0495619_0001234 Ga0495619_0001234_11853_12290 142
535 3300053085 Ga0495619_0021199 Ga0495619_0021199_1705_2142 142
536 3300054114 Ga0501084_0000332 Ga0501084_0000332_10050_10478 142
537 3300054114 Ga0501084_0002377 Ga0501084_0002377_10306_10734 142
538 3300054114 Ga0501084_0002602 Ga0501084_0002602_2380_2808 142
539 3300054114 Ga0501084_0048316 Ga0501084_0048316_1252_1680 142
540 3300054114 Ga0501084_0061493 Ga0501084_0061493_1246_1674 142
541 3300054114 Ga0501084_0197932 Ga0501084_0197932_483_911 142
542 3300054114 Ga0501084_1353440 Ga0501084_1353440_78_506 142
543 3300060353 Ga0501082_0000241 Ga0501082_0000241_31685_32113 142
544 3300060353 Ga0501082_0003201 Ga0501082_0003201_12002_12430 142
545 3300060353 Ga0501082_0037270 Ga0501082_0037270_3707_4135 142
546 3300060353 Ga0501082_0050830 Ga0501082_0050830_2941_3369 142
547 3300060353 Ga0501082_0064711 Ga0501082_0064711_1207_1635 142
548 3300060353 Ga0501082_0066595 Ga0501082_0066595_306_734 142
549 3300060353 Ga0501082_0362403 Ga0501082_0362403_193_624 142
550 3300060353 Ga0501082_0399517 Ga0501082_0399517_710_1138 142
551 3300061734 Ga0530510_0000299 Ga0530510_0000299_17697_18125 142
552 3300061734 Ga0530510_0003188 Ga0530510_0003188_7263_7691 142
553 3300061734 Ga0530510_0003553 Ga0530510_0003553_5301_5729 142
554 3300061734 Ga0530510_0025538 Ga0530510_0025538_1606_2034 142
555 3300061734 Ga0530510_0173725 Ga0530510_0173725_847_1275 142
556 3300061734 Ga0530510_0180658 Ga0530510_0180658_537_968 142
557 3300061734 Ga0530510_0418326 Ga0530510_0418326_167_595 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

2

139

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n8n-assembly1.cif.gz_L crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 6 0.9791 1 140
3n8k-assembly2.cif.gz_Q type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid 0.9775 1 140
4kiu-assembly2.cif.gz_X design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49d [5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid] 0.9775 2 140
2y71-assembly1.cif.gz_A structure of mycobacterium tuberculosis type ii dehydroquinase complexed with (1r,4s,5r)-1,4,5-trihydroxy-3-((5-methylbenzo(b) thiophen-2-yl)methoxy)cyclohex-2-enecarboxylate 0.9771 1 140
3n59-assembly2.cif.gz_P type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate 0.9766 1 140
ID Description Score Start End Superfamily
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.976 1 140 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9731 1 140 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9659 1 140 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9619 1 140 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9597 1 140 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A7W0P7A9-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9943 1 139 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A7W1LEV3-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9922 22 141 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A0U4Y127-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9805 2 141 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0016020
GO:0019631
AF-A0A3C2DXA6-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9805 25 141 GO:0003855
GO:0009423
GO:0019631
AF-B6BSR7-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9801 2 141 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631

Feature Viewer

pLDDT pTM Quality
94.26 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map