F463368

General Info

Members Datasets Scaffolds Average Seq Length
557 506 159 401

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_2105_c1|nmdc:mga00v17_2105_c1_1198_2424
Length 397
Sequence MTAASSPAKSIAIIGGGPAGLMAAEHLSAHGHSVTVYEAMPTVARKFLLAGKSGLNITHSEEFSRFAGRYGAANQWLRASLDSFTPDDVRRWAAELGTETFVGTSGRVFPTVMKASPLLRAWVARLRDQGVDILTRHRWAGFDGDKLVIETPDGTKAIKADAVLLALGGASWPKLGSDAAWLPWLRERGVEIADFEPANCGFNAGAPIKSVIASASGNDGIPGEFVISRHGIEGSLVYAHASALRDSLKKTDKAALILDLMPGRSEERLTRDLARQDRKASFSNRLRKGAGIDGVKAALLRELCGPDDLSDPVMLAKHIKSLAIPLVAPRPIGEAISSAGGLKQSAVDENFMLRALPGIFAAGEMLDWEAPTGGYLLTACFATGKAAAKGMEAWLAK

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
10 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
13 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
14 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
15 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
16 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
17 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
18 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
19 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
20 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
21 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
24 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
25 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
26 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
27 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
28 2516143018 Ensifer sp. BR816 Isolate Nodule
29 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
30 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
31 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
32 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
33 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
34 2519899620 Rhizobium sp. Pop5 Isolate Nodule
35 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
36 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
37 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
38 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
39 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
40 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
41 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
42 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
43 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
44 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
45 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
46 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
47 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
48 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
49 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
50 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
51 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
52 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
53 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
54 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
55 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
56 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
57 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
58 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
59 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
60 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
61 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
62 2643221557 Ensifer sp. Root558 Isolate Unclassified
63 2643221568 Rhizobium sp. Root564 Isolate Unclassified
64 2643221591 Devosia sp. Root685 Isolate Unclassified
65 2643221599 Rhizobium sp. Root708 Isolate Unclassified
66 2643221607 Rhizobium sp. Root73 Isolate Unclassified
67 2643221610 Ensifer sp. Root74 Isolate Unclassified
68 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
69 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
70 2643221668 Ensifer sp. Root423 Isolate Unclassified
71 2643221675 Ensifer sp. Root1298 Isolate Unclassified
72 2643221680 Ensifer sp. Root1312 Isolate Unclassified
73 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
74 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
75 2643221719 Rhizobium sp. Root274 Isolate Unclassified
76 2643221726 Ensifer sp. Root954 Isolate Unclassified
77 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
78 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
79 2718217882 Rhizobium sp. N741 Isolate Nodule
80 2718218009 Rhizobium sp. N561 Isolate Nodule
81 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
82 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
83 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
84 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
85 2718218363 Rhizobium sp. N113 Isolate Nodule
86 2718218365 Rhizobium sp. N731 Isolate Nodule
87 2718218366 Rhizobium sp. N621 Isolate Nodule
88 2721755514 Rhizobium sp. N6212 Isolate Nodule
89 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
90 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
91 2721755810 Rhizobium sp. N871 Isolate Nodule
92 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
93 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
94 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
95 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
96 2728369365 Rhizobium sp. N1341 Isolate Nodule
97 2728369397 Rhizobium sp. N1314 Isolate Nodule
98 2738541293 Rhizobium sp. GV031 Isolate Unclassified
99 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
100 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
101 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
102 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
103 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
104 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
105 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
106 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
107 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
108 2791355256 Rhizobium sp. M10 Isolate Nodule
109 2791355260 Rhizobium sp. L9 Isolate Nodule
110 2791355261 Rhizobium sp. J15 Isolate Nodule
111 2791355262 Rhizobium sp. M1 Isolate Nodule
112 2791355263 Rhizobium chutanense C5 Isolate Nodule
113 2791355264 Rhizobium sp. S9 Isolate Nodule
114 2791355265 Rhizobium sp. H4 Isolate Nodule
115 2791355267 Rhizobium sp. L18 Isolate Nodule
116 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
117 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
118 2802429633 Rhizobium anhuiense J3 Isolate Nodule
119 2802429634 Rhizobium anhuiense S10 Isolate Nodule
120 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
121 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
122 2802429637 Rhizobium anhuiense C15 Isolate Nodule
123 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
124 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
125 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
126 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
127 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
128 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
129 2838048938 Rhizobium pisi 27/80 Isolate Nodule
130 2838061910 Rhizobium phaseoli L15 Isolate Nodule
131 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
132 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
133 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
134 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
135 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
136 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
137 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
138 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
139 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
140 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
141 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
142 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
143 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
144 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
145 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
146 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
147 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
148 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
149 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
150 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
151 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
152 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
153 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
154 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
155 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
156 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
157 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
158 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
159 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
160 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
161 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
162 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
163 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
164 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
165 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
166 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
167 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
168 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
169 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
170 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
171 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
172 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
173 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
174 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
175 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
176 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
177 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
178 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
179 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
180 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
181 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
182 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
183 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
184 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
185 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
186 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
187 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
188 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
189 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
190 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
191 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
192 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
193 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
194 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
195 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
196 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
197 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
198 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
199 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
200 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
201 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
202 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
203 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
204 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
205 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
206 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
207 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
208 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
209 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
210 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
211 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
212 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
213 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
214 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
215 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
216 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
217 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
218 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
219 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
220 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
221 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
222 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
223 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
224 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
225 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
226 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
227 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
228 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
229 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
230 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
231 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
232 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
233 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
234 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
235 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
236 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
237 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
238 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
239 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
240 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
241 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
242 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
243 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
244 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
245 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
246 2933599457 Rhizobium phaseoli M3 Isolate Nodule
247 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
248 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
249 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
250 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
251 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
252 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
253 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
254 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
255 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
256 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
257 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
258 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
259 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
260 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
261 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
262 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
263 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
264 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
265 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
266 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
267 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
268 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
269 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
270 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
271 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
272 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
273 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
274 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
275 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
276 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
277 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
278 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
279 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
280 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
281 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
282 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
283 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
284 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
285 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
286 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
287 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
288 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
289 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
290 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
291 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
292 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
293 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
294 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
295 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
296 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
297 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
298 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
299 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
300 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
301 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
302 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
303 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
304 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
305 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
306 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
307 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
308 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
309 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
310 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
311 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
312 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
313 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
314 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
315 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
316 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
317 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
318 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
319 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
320 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
321 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
322 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
323 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
324 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
325 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
326 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
327 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
328 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
329 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
330 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
331 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
332 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
333 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
334 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
335 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
336 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
337 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
338 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
339 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
340 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
341 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
342 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
343 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
344 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
345 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
346 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
347 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
348 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
349 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
350 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
351 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
352 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
353 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
354 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
355 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
356 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
357 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
358 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
359 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
360 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
361 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
362 2996893221 Rhizobium sp. R635 Isolate Nodule
363 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
364 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
365 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
366 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
367 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
368 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
369 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
370 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
371 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
372 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
373 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
374 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
375 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
377 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
378 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
379 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
380 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
381 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
382 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
383 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
384 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
385 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
386 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
387 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
388 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
389 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
390 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
391 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
392 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
393 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
394 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
395 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
396 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
397 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
398 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
399 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
400 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
401 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
402 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
403 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
404 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
405 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
406 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
407 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
408 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
409 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
412 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
414 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
415 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
416 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
417 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
418 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
419 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
420 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
421 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
422 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
423 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
424 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
425 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
426 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
427 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
428 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
429 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
430 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
431 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
432 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
433 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
434 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
435 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
436 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
437 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
438 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
439 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
440 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
441 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
442 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
443 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
444 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
445 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
446 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
447 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
448 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
449 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
450 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
451 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
452 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
453 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
454 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
460 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
462 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
463 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
464 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
465 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
466 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
467 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
468 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
469 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
470 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
473 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
474 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
475 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
476 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
477 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
478 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
479 8005258706 Rhizobium sp. R693 Isolate Nodule
480 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
481 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
482 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
483 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
484 8005382845 Rhizobium sp. R634 Isolate Nodule
485 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
486 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
487 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
488 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
489 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
490 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
491 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
492 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
493 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
494 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
495 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
496 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
497 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
498 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
499 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
500 8024501048 Rhizobium sp. H4 Isolate Nodule
501 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
502 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
503 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
504 8056382006 Rhizobium croatiense 13T Isolate Nodule
505 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
506 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 28.37
Metatranscriptomes 0.18
Isolates 71.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 12.39
Nodule 59.96
Rhizoplane 1.08
Rhizosphere 11.31
Stem 0
Stem Tuber 0
Unclassified 15.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000003 3300002704 Bacteria 279666
2 JGI25156J39149_1000004 3300002705 Bacteria 273027
3 JGI25162J39368_1000165 3300002737 Bacteria 73081
4 JGI25154J39366_1000013 3300002738 Bacteria 268260
5 JGI25157J39369_1000004 3300002741 Bacteria 273009
6 JGI25151J46595_10007751 3300003187 Bacteria 5226
7 JGI25165J46597_1000068 3300003214 Bacteria 196201
8 JGI25153J46596_10000834 3300003215 Bacteria 18821
9 JGI25153J46596_10001010 3300003215 Bacteria 17125
10 JGI25153J46596_10026883 3300003215 Bacteria 2027
11 JGI25160J50197_1000922 3300003354 Bacteria 15451
12 Ga0032354_1024222 3300003693 Bacteria 2536
13 Ga0055526_1001177 3300003771 Bacteria 18950
14 Ga0055526_1005899 3300003771 Bacteria 6855
15 Ga0055524_1000863 3300003775 Bacteria 19829
16 Ga0055524_1000937 3300003775 Bacteria 18722
17 Ga0055524_1001777 3300003775 Bacteria 11842
18 Ga0055524_1028128 3300003775 Bacteria 1691
19 Ga0055536_1002576 3300003781 Bacteria 10094
20 Ga0055528_1000396 3300003790 Bacteria 35483
21 Ga0055528_1000538 3300003790 Bacteria 28947
22 Ga0055528_1003961 3300003790 Bacteria 7255
23 Ga0055528_1005704 3300003790 Bacteria 5742
24 Ga0055540_1000895 3300003792 Bacteria 19643
25 Ga0055531_10001809 3300003794 Bacteria 15174
26 Ga0055543_1001118 3300004625 Bacteria 11531
27 Ga0070670_100005946 3300005331 Bacteria 10319
28 Ga0070665_100213409 3300005548 Bacteria 1931
29 Ga0075364_10001052 3300006051 Bacteria 14687
30 Ga0075367_10028827 3300006178 Bacteria 3170
31 Ga0075366_10013787 3300006195 Bacteria 4607
32 Ga0075370_10013808 3300006353 Bacteria 4297
33 Ga0079104_1000125 3300006946 Bacteria 110104
34 Ga0079104_1007869 3300006946 Bacteria 3799
35 Ga0214544_1000417 3300021320 Bacteria 76109
36 Ga0214542_1000032 3300021321 Bacteria 171690
37 Ga0214542_1019910 3300021321 Bacteria 5110
38 Ga0214543_1000005 3300021327 Bacteria 454523
39 Ga0214543_1000016 3300021327 Bacteria 295257
40 Ga0209435_100006 3300025206 Bacteria 542459
41 Ga0209437_100067 3300025233 Bacteria 317685
42 Ga0207425_1002251 3300025245 Bacteria 6982
43 Ga0209646_1000015 3300025246 Bacteria 542459
44 Ga0209026_1000039 3300025250 Bacteria 280608
45 Ga0209759_1000005 3300025256 Bacteria 542459
46 Ga0209129_1000105 3300025258 Bacteria 159104
47 Ga0209129_1000978 3300025258 Bacteria 17127
48 Ga0209233_1000088 3300025261 Bacteria 317980
49 Ga0209673_1000015 3300025273 Bacteria 530618
50 Ga0209673_1001128 3300025273 Bacteria 29524
51 Ga0209673_1001602 3300025273 Bacteria 19869
52 Ga0209673_1004897 3300025273 Bacteria 6976
53 Ga0209025_1001406 3300025294 Bacteria 31935
54 Ga0209025_1001681 3300025294 Bacteria 27032
55 Ga0209025_1013577 3300025294 Bacteria 5104
56 Ga0209025_1041958 3300025294 Bacteria 1951
57 Ga0209025_1043359 3300025294 Bacteria 1897
58 Ga0209564_1001203 3300025295 Bacteria 29524
59 Ga0209564_1001863 3300025295 Bacteria 19108
60 Ga0209758_1001163 3300025297 Bacteria 33436
61 Ga0209758_1001508 3300025297 Bacteria 27032
62 Ga0209758_1003633 3300025297 Bacteria 13779
63 Ga0209758_1018708 3300025297 Bacteria 3380
64 Ga0209050_1011914 3300025298 Bacteria 4056
65 Ga0209256_1000064 3300025299 Bacteria 250853
66 Ga0209256_1000447 3300025299 Bacteria 63030
67 Ga0209256_1001204 3300025299 Bacteria 28959
68 Ga0209256_1001765 3300025299 Bacteria 20571
69 Ga0207426_1000863 3300025302 Bacteria 31669
70 Ga0209051_1000778 3300025303 Bacteria 33824
71 Ga0209051_1000848 3300025303 Bacteria 31351
72 Ga0209051_1027828 3300025303 Bacteria 2244
73 Ga0209257_1003322 3300025304 Bacteria 13923
74 Ga0207650_10005217 3300025925 Bacteria 8862
75 Ga0209281_1000185 3300027111 Bacteria 144489
76 Ga0209281_1000242 3300027111 Bacteria 110116
77 Ga0268266_10050487 3300028379 Bacteria 3569
78 Ga0307513_10009932 3300031456 Bacteria 12005
79 Ga0307408_100118885 3300031548 Bacteria 2044
80 Ga0307405_10043312 3300031731 Bacteria 2746
81 Ga0307406_10011536 3300031901 Bacteria 5021
82 Ga0307414_10077401 3300032004 Bacteria 2421
83 Ga0395905_0011514 3300037471 Bacteria 8546
84 Ga0451837_0645113 3300041494 Bacteria 2791
85 Ga0451849_1098025 3300041505 Bacteria 2616
86 Ga0451851_0124884 3300041507 Bacteria 1348
87 Ga0451855_0141111 3300041511 Bacteria 2103
88 Ga0451855_0961775 3300041511 Bacteria 2238
89 Ga0451853_0147227 3300041512 Bacteria 6003
90 Ga0439449_0000282 3300042007 Bacteria 18421
91 Ga0495592_0179127 3300046454 Bacteria 1445
92 Ga0495638_0022725 3300046460 Bacteria 4113
93 Ga0495605_0032374 3300046474 Bacteria 2661
94 Ga0495585_0015818 3300046492 Bacteria 4380
95 Ga0495606_0010208 3300046507 Bacteria 7828
96 Ga0495606_0028817 3300046507 Bacteria 3909
97 Ga0495606_0172582 3300046507 Bacteria 1253
98 Ga0495610_0000970 3300046512 Bacteria 26496
99 Ga0495610_0069703 3300046512 Bacteria 1645
100 Ga0495620_0040291 3300046515 Bacteria 2057
101 Ga0495631_0002438 3300046518 Bacteria 10489
102 Ga0495632_0044306 3300046519 Bacteria 2221
103 Ga0495643_0039506 3300046522 Bacteria 2580
104 Ga0495643_0087794 3300046522 Bacteria 1609
105 Ga0495648_0017276 3300046524 Bacteria 5166
106 Ga0495654_0000236 3300046530 Bacteria 51913
107 Ga0495609_0040225 3300046538 Bacteria 2104
108 Ga0495668_0015795 3300046616 Bacteria 4399
109 Ga0495625_0003325 3300046660 Bacteria 16202
110 Ga0495670_0115778 3300046691 Bacteria 1390
111 Ga0495660_0109734 3300046810 Bacteria 1409
112 Ga0495672_0058532 3300047320 Bacteria 2233
113 Ga0495686_0001854 3300047472 Bacteria 21201
114 Ga0495686_0003405 3300047472 Bacteria 13831
115 Ga0495686_0044138 3300047472 Bacteria 2822
116 Ga0496101_0021155 3300048904 Bacteria 4466
117 Ga0496111_0002642 3300048914 Bacteria 10869
118 Ga0496111_0127028 3300048914 Bacteria 1885
119 Ga0496116_0019935 3300048919 Bacteria 5114
120 Ga0496117_0008027 3300048920 Bacteria 10120
121 Ga0496118_0009587 3300048921 Bacteria 9746
122 Ga0496118_0010971 3300048921 Bacteria 8904
123 Ga0496121_0002141 3300048924 Bacteria 31012
124 Ga0496121_0005162 3300048924 Bacteria 16966
125 Ga0496121_0034893 3300048924 Bacteria 4517
126 Ga0496122_0000018 3300048925 Bacteria 426350
127 Ga0496122_0002985 3300048925 Bacteria 23033
128 Ga0496123_0000015 3300048926 Bacteria 426088
129 Ga0496123_0010736 3300048926 Bacteria 8047
130 Ga0496123_0059097 3300048926 Bacteria 2482
131 Ga0496124_0000091 3300048927 Bacteria 189706
132 Ga0496124_0005166 3300048927 Bacteria 14850
133 Ga0496124_0015262 3300048927 Bacteria 7371
134 Ga0496124_0053506 3300048927 Bacteria 3421
135 Ga0496124_0093011 3300048927 Bacteria 2455
136 Ga0496124_0113434 3300048927 Bacteria 2178
137 Ga0496125_0000250 3300048928 Bacteria 110567
138 Ga0501032_0011350 3300049569 Bacteria 6399
139 Ga0501033_0001248 3300049570 Bacteria 22787
140 Ga0501034_0186205 3300049571 Bacteria 2039
141 Ga0501038_0014869 3300049574 Bacteria 7088
142 Ga0501048_0078482 3300049582 Bacteria 2330
143 Ga0501083_0016474 3300049744 Bacteria 5173
144 Ga0501035_0005830 3300049822 Bacteria 11618
145 Ga0501044_0074536 3300049823 Bacteria 3447
146 nmdc:mga00v17_2105_c1 3300050491 Bacteria 10239
147 nmdc:mga06z11_133422_c1 3300050494 Bacteria 1397
148 nmdc:mga07m45_53687_c1 3300050496 Bacteria 2277
149 Ga0500610_0004338 3300053079 Bacteria 5614
150 Ga0500569_015761 3300053109 Bacteria 1899
151 Ga0500618_000456 3300053125 Bacteria 26628
152 Ga0500618_006273 3300053125 Bacteria 3511
153 Ga0500559_0031682 3300053136 Bacteria 2268
154 Ga0500568_0036943 3300053139 Bacteria 1985
155 Ga0500590_000218 3300053148 Bacteria 17347
156 Ga0500616_0001067 3300053153 Bacteria 28771
157 Ga0500622_0000951 3300053156 Bacteria 24641
158 Ga0500636_0006074 3300053177 Bacteria 6929
159 Ga0500645_007670 3300053730 Bacteria 3738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100213409 Ga0070665_1002134092 371
2 3300028379 Ga0268266_10050487 Ga0268266_100504873 371
3 3300046691 Ga0495670_0115778 Ga0495670_0115778_14_1144 374
4 iso_pu_bacteria 2513237144 2513910250 384
5 iso_pu_bacteria 2643221557 2643804918 384
6 iso_pu_bacteria 2643221610 2644065762 384
7 iso_pu_bacteria 2643221668 2644376869 384
8 iso_pu_bacteria 2643221675 2644417654 384
9 iso_pu_bacteria 2643221680 2644453758 384
10 iso_pu_bacteria 2643221726 2644688393 384
11 3300046515 Ga0495620_0040291 Ga0495620_0040291_14_1174 386
12 3300002737 JGI25162J39368_1000165 JGI25162J39368_100016547 387
13 3300003214 JGI25165J46597_1000068 JGI25165J46597_1000068122 387
14 3300046507 Ga0495606_0172582 Ga0495606_0172582_31_1197 388
15 iso_pu_bacteria 2916068649 2916071563 389
16 3300006051 Ga0075364_10001052 Ga0075364_100010524 390
17 3300046512 Ga0495610_0069703 Ga0495610_0069703_202_1410 390
18 3300050491 nmdc:mga00v17_2105_c1 nmdc:mga00v17_2105_c1_1198_2424 390
19 3300053125 Ga0500618_000456 Ga0500618_000456_4657_5865 390
20 3300037471 Ga0395905_0011514 Ga0395905_0011514_435_1658 391
21 3300048927 Ga0496124_0000091 Ga0496124_0000091_115084_116331 391
22 3300053136 Ga0500559_0031682 Ga0500559_0031682_76_1293 391
23 iso_pu_bacteria 2516143018 2516208098 392
24 iso_pu_bacteria 2791355267 2793371142 393
25 iso_pu_bacteria 2751185821 2753459657 395
26 iso_pu_bacteria 8055431914 8055432919 395
27 iso_pu_bacteria 2523231067 2523469880 396
28 iso_pu_bacteria 2643221591 2643965116 396
29 iso_pu_bacteria 2738543031 2739350402 396
30 3300003792 Ga0055540_1000895 Ga0055540_10008953 397
31 3300025298 Ga0209050_1011914 Ga0209050_10119143 397
32 3300025303 Ga0209051_1000848 Ga0209051_100084813 397
33 3300050496 nmdc:mga07m45_53687_c1 nmdc:mga07m45_53687_c1_229_1422 397
34 iso_pu_bacteria 2513237159 2513998996 397
35 iso_pu_bacteria 2643221599 2644006649 397
36 iso_pu_bacteria 2842521101 2842524737 397
37 iso_pu_bacteria 3005452660 3005457997 397
38 iso_pu_bacteria 2510461076 2510896408 398
39 iso_pu_bacteria 2510917026 2511170744 398
40 iso_pu_bacteria 2513237093 2513636452 398
41 iso_pu_bacteria 2513237162 2514024573 398
42 iso_pu_bacteria 2515075009 2515114070 398
43 iso_pu_bacteria 2515154114 2515646111 398
44 iso_pu_bacteria 2515154116 2515661732 398
45 iso_pu_bacteria 2515154134 2515744288 398
46 iso_pu_bacteria 2516653077 2517037707 398
47 iso_pu_bacteria 2516653085 2517077995 398
48 iso_pu_bacteria 2517093000 2517096789 398
49 iso_pu_bacteria 2517287029 2517410496 398
50 iso_pu_bacteria 2519899620 2520378070 398
51 iso_pu_bacteria 2582581294 2585200812 398
52 iso_pu_bacteria 2582581304 2585255251 398
53 iso_pu_bacteria 2585427526 2585530045 398
54 iso_pu_bacteria 2585427594 2585842709 398
55 iso_pu_bacteria 2585427634 2586002830 398
56 iso_pu_bacteria 2599185236 2599718526 398
57 iso_pu_bacteria 2599185352 2600197278 398
58 iso_pu_bacteria 2615840624 2616298287 398
59 iso_pu_bacteria 2643221568 2643854205 398
60 iso_pu_bacteria 2718217882 2719182733 398
61 iso_pu_bacteria 2718218009 2719733450 398
62 iso_pu_bacteria 2718218199 2720493478 398
63 iso_pu_bacteria 2718218233 2720621706 398
64 iso_pu_bacteria 2718218235 2720633034 398
65 iso_pu_bacteria 2718218269 2720776758 398
66 iso_pu_bacteria 2718218363 2721148845 398
67 iso_pu_bacteria 2718218365 2721160229 398
68 iso_pu_bacteria 2718218366 2721165658 398
69 iso_pu_bacteria 2721755514 2722841828 398
70 iso_pu_bacteria 2721755684 2723561976 398
71 iso_pu_bacteria 2721755685 2723568606 398
72 iso_pu_bacteria 2721755810 2724046206 398
73 iso_pu_bacteria 2721755819 2724091365 398
74 iso_pu_bacteria 2721755822 2724105871 398
75 iso_pu_bacteria 2721755823 2724111699 398
76 iso_pu_bacteria 2724679232 2725952185 398
77 iso_pu_bacteria 2728369365 2730165968 398
78 iso_pu_bacteria 2728369397 2730299861 398
79 iso_pu_bacteria 2765235942 2766065174 398
80 iso_pu_bacteria 2791355256 2793299728 398
81 iso_pu_bacteria 2791355260 2793325381 398
82 iso_pu_bacteria 2791355261 2793331596 398
83 iso_pu_bacteria 2791355262 2793338185 398
84 iso_pu_bacteria 2791355263 2793344355 398
85 iso_pu_bacteria 2791355264 2793351173 398
86 iso_pu_bacteria 2791355265 2793356437 398
87 iso_pu_bacteria 2802429605 2805931945 398
88 iso_pu_bacteria 2802429606 2805938191 398
89 iso_pu_bacteria 2821123053 2821123079 398
90 iso_pu_bacteria 2838016132 2838022434 398
91 iso_pu_bacteria 2838022645 2838024165 398
92 iso_pu_bacteria 2838048938 2838054550 398
93 iso_pu_bacteria 2838061910 2838068300 398
94 iso_pu_bacteria 2838068647 2838074662 398
95 iso_pu_bacteria 2838668709 2838675140 398
96 iso_pu_bacteria 2838680041 2838686464 398
97 iso_pu_bacteria 2838686498 2838693766 398
98 iso_pu_bacteria 2838694306 2838700987 398
99 iso_pu_bacteria 2838701080 2838707477 398
100 iso_pu_bacteria 2838707686 2838714175 398
101 iso_pu_bacteria 2838729681 2838736442 398
102 iso_pu_bacteria 2838736955 2838739897 398
103 iso_pu_bacteria 2838742623 2838749236 398
104 iso_pu_bacteria 2841840854 2841843979 398
105 iso_pu_bacteria 2841851746 2841858987 398
106 iso_pu_bacteria 2841864319 2841868015 398
107 iso_pu_bacteria 2842077413 2842083769 398
108 iso_pu_bacteria 2842110456 2842117785 398
109 iso_pu_bacteria 2842118031 2842124805 398
110 iso_pu_bacteria 2842140634 2842143700 398
111 iso_pu_bacteria 2842146304 2842152049 398
112 iso_pu_bacteria 2842156927 2842163375 398
113 iso_pu_bacteria 2842163707 2842170288 398
114 iso_pu_bacteria 2842180545 2842187003 398
115 iso_pu_bacteria 2842192696 2842198755 398
116 iso_pu_bacteria 2842198810 2842205294 398
117 iso_pu_bacteria 2842205361 2842211443 398
118 iso_pu_bacteria 2842229732 2842236437 398
119 iso_pu_bacteria 2842237096 2842243587 398
120 iso_pu_bacteria 2842243621 2842250135 398
121 iso_pu_bacteria 2842250916 2842257283 398
122 iso_pu_bacteria 2842257432 2842264145 398
123 iso_pu_bacteria 2842264693 2842269962 398
124 iso_pu_bacteria 2842271015 2842278278 398
125 iso_pu_bacteria 2842278818 2842284891 398
126 iso_pu_bacteria 2842285085 2842290956 398
127 iso_pu_bacteria 2842291075 2842297917 398
128 iso_pu_bacteria 2842304105 2842310406 398
129 iso_pu_bacteria 2842311132 2842317369 398
130 iso_pu_bacteria 2842317721 2842324265 398
131 iso_pu_bacteria 2842341865 2842348599 398
132 iso_pu_bacteria 2842363717 2842370350 398
133 iso_pu_bacteria 2842370503 2842377295 398
134 iso_pu_bacteria 2842377471 2842384389 398
135 iso_pu_bacteria 2842384541 2842391408 398
136 iso_pu_bacteria 2842395702 2842402031 398
137 iso_pu_bacteria 2842402390 2842408865 398
138 iso_pu_bacteria 2842409023 2842415546 398
139 iso_pu_bacteria 2842415677 2842422112 398
140 iso_pu_bacteria 2842422224 2842428268 398
141 iso_pu_bacteria 2842428310 2842433793 398
142 iso_pu_bacteria 2842434925 2842440175 398
143 iso_pu_bacteria 2842441272 2842446814 398
144 iso_pu_bacteria 2842447887 2842453589 398
145 iso_pu_bacteria 2842462802 2842468258 398
146 iso_pu_bacteria 2842469257 2842474784 398
147 iso_pu_bacteria 2842489311 2842495725 398
148 iso_pu_bacteria 2842495871 2842502491 398
149 iso_pu_bacteria 2844454524 2844457342 398
150 iso_pu_bacteria 2854896431 2854901006 398
151 iso_pu_bacteria 2854916844 2854918092 398
152 iso_pu_bacteria 2857516855 2857524404 398
153 iso_pu_bacteria 2857531043 2857533968 398
154 iso_pu_bacteria 2896384573 2896392034 398
155 iso_pu_bacteria 2899803654 2899807935 398
156 iso_pu_bacteria 2913295892 2913296354 398
157 iso_pu_bacteria 2919166419 2919168592 398
158 iso_pu_bacteria 2919171160 2919172663 398
159 iso_pu_bacteria 2920760137 2920764704 398
160 iso_pu_bacteria 2933570622 2933576846 398
161 iso_pu_bacteria 2933586486 2933593829 398
162 iso_pu_bacteria 2933599457 2933605117 398
163 iso_pu_bacteria 2935894831 2935901304 398
164 iso_pu_bacteria 2935901341 2935908012 398
165 iso_pu_bacteria 2936375103 2936379967 398
166 iso_pu_bacteria 2978969890 2978971279 398
167 iso_pu_bacteria 2984587000 2984588424 398
168 iso_pu_bacteria 2996893221 2996897156 398
169 iso_pu_bacteria 3003930520 3003935467 398
170 iso_pu_bacteria 8005282627 8005286990 398
171 iso_pu_bacteria 8005289223 8005293102 398
172 iso_pu_bacteria 8005301065 8005303809 398
173 iso_pu_bacteria 8005307578 8005311384 398
174 iso_pu_bacteria 8005382845 8005386405 398
175 iso_pu_bacteria 8005430974 8005435437 398
176 iso_pu_bacteria 8005460587 8005464759 398
177 iso_pu_bacteria 8005556819 8005560814 398
178 iso_pu_bacteria 8005563573 8005566943 398
179 iso_pu_bacteria 8005619151 8005623153 398
180 iso_pu_bacteria 8005626139 8005628984 398
181 iso_pu_bacteria 8005688590 8005691506 398
182 iso_pu_bacteria 8005695170 8005699118 398
183 iso_pu_bacteria 8018127388 8018131684 398
184 iso_pu_bacteria 8018163183 8018169485 398
185 iso_pu_bacteria 8023680758 8023683700 398
186 iso_pu_bacteria 8024479707 8024482567 398
187 iso_pu_bacteria 8024486573 8024488300 398
188 iso_pu_bacteria 8024501048 8024504901 398
189 iso_pu_bacteria 8056375014 8056379715 398
190 iso_pu_bacteria 8056382006 8056385731 398
191 iso_pu_bacteria 8057874678 8057880427 398
192 3300047472 Ga0495686_0001854 Ga0495686_0001854_3431_4630 399
193 3300047472 Ga0495686_0044138 Ga0495686_0044138_1269_2468 399
194 iso_pu_bacteria 2510461069 2510842174 399
195 iso_pu_bacteria 2513237088 2513595942 399
196 iso_pu_bacteria 2513237138 2513869650 399
197 iso_pu_bacteria 2551306086 2551696825 399
198 iso_pu_bacteria 2585427590 2585820070 399
199 iso_pu_bacteria 2643221636 2644205867 399
200 iso_pu_bacteria 2667528174 2671114215 399
201 iso_pu_bacteria 2690316117 2692319549 399
202 iso_pu_bacteria 2791355091 2792623359 399
203 iso_pu_bacteria 2791355092 2792629327 399
204 iso_pu_bacteria 2847417321 2847421948 399
205 iso_pu_bacteria 2848992105 2848996700 399
206 iso_pu_bacteria 2855872281 2855874942 399
207 iso_pu_bacteria 3005409236 3005411126 399
208 iso_pu_bacteria 643692032 643824165 399
209 iso_pu_bacteria 8005258706 8005259172 399
210 iso_pu_bacteria 8054558443 8054561825 399
211 3300046507 Ga0495606_0010208 Ga0495606_0010208_3378_4580 400
212 3300048924 Ga0496121_0034893 Ga0496121_0034893_2064_3266 400
213 iso_pu_bacteria 2513237103 2513714069 400
214 iso_pu_bacteria 2515154113 2515638732 400
215 iso_pu_bacteria 2524023207 2524449305 400
216 iso_pu_bacteria 2582581866 2585397626 400
217 iso_pu_bacteria 2643221607 2644047715 400
218 iso_pu_bacteria 2643221653 2644299411 400
219 iso_pu_bacteria 2643221686 2644481877 400
220 iso_pu_bacteria 2643221689 2644497521 400
221 iso_pu_bacteria 2643221719 2644657639 400
222 iso_pu_bacteria 2818991272 2819243984 400
223 iso_pu_bacteria 2842217011 2842223670 400
224 iso_pu_bacteria 2989771324 2989773970 400
225 iso_pu_bacteria 2989776772 2989780523 400
226 iso_pu_bacteria 639633055 639650143 400
227 3300025294 Ga0209025_1043359 Ga0209025_10433592 401
228 iso_pu_bacteria 2510065057 2510303061 401
229 iso_pu_bacteria 2511231052 2511497059 401
230 iso_pu_bacteria 2512047086 2512529534 401
231 iso_pu_bacteria 2513237086 2513582771 401
232 iso_pu_bacteria 2513237091 2513614824 401
233 iso_pu_bacteria 2513237140 2513882334 401
234 iso_pu_bacteria 2513237143 2513901723 401
235 iso_pu_bacteria 2516653046 2516895711 401
236 iso_pu_bacteria 2551306084 2551678821 401
237 iso_pu_bacteria 2551306084 2551682059 401
238 iso_pu_bacteria 2551306085 2551683370 401
239 iso_pu_bacteria 2551306087 2551698858 401
240 iso_pu_bacteria 2551306089 2551714313 401
241 iso_pu_bacteria 2551306090 2551716637 401
242 iso_pu_bacteria 2775507049 2776914784 401
243 iso_pu_bacteria 2838042994 2838048505 401
244 iso_pu_bacteria 2855825444 2855829473 401
245 iso_pu_bacteria 2855839649 2855844572 401
246 iso_pu_bacteria 2858800743 2858805967 401
247 iso_pu_bacteria 2915986958 2915992012 401
248 iso_pu_bacteria 2915993759 2915993948 401
249 iso_pu_bacteria 2916000859 2916003363 401
250 iso_pu_bacteria 2916007675 2916007812 401
251 iso_pu_bacteria 2916014648 2916015029 401
252 iso_pu_bacteria 2916021584 2916021782 401
253 iso_pu_bacteria 2916028427 2916032000 401
254 iso_pu_bacteria 2916035215 2916037411 401
255 iso_pu_bacteria 2916041962 2916042132 401
256 iso_pu_bacteria 2916048683 2916048905 401
257 iso_pu_bacteria 2916055098 2916059587 401
258 iso_pu_bacteria 2916076590 2916081221 401
259 iso_pu_bacteria 2921201388 2921203225 401
260 iso_pu_bacteria 2921208531 2921212726 401
261 iso_pu_bacteria 2921237296 2921242196 401
262 iso_pu_bacteria 2921244191 2921250017 401
263 iso_pu_bacteria 2921257292 2921259340 401
264 iso_pu_bacteria 2921263974 2921269728 401
265 iso_pu_bacteria 2921282425 2921282919 401
266 iso_pu_bacteria 2921289301 2921293662 401
267 iso_pu_bacteria 2921296804 2921299115 401
268 iso_pu_bacteria 2924144063 2924148028 401
269 iso_pu_bacteria 2924150972 2924155712 401
270 iso_pu_bacteria 2924158325 2924161822 401
271 iso_pu_bacteria 2924165586 2924165658 401
272 iso_pu_bacteria 2924172951 2924176249 401
273 iso_pu_bacteria 2924179722 2924184321 401
274 iso_pu_bacteria 2924186466 2924188242 401
275 iso_pu_bacteria 2924193448 2924196934 401
276 iso_pu_bacteria 2924200457 2924200651 401
277 iso_pu_bacteria 2924207177 2924207274 401
278 iso_pu_bacteria 2924214083 2924219120 401
279 iso_pu_bacteria 2924221636 2924224196 401
280 iso_pu_bacteria 2924228884 2924228991 401
281 iso_pu_bacteria 2937002841 2937003115 401
282 iso_pu_bacteria 2937009748 2937009963 401
283 iso_pu_bacteria 2937016420 2937020400 401
284 iso_pu_bacteria 2937023124 2937025282 401
285 iso_pu_bacteria 2937042894 2937047215 401
286 iso_pu_bacteria 2937049772 2937050638 401
287 iso_pu_bacteria 2937056579 2937060420 401
288 iso_pu_bacteria 2937063883 2937064041 401
289 iso_pu_bacteria 2937071275 2937071775 401
290 iso_pu_bacteria 2937091812 2937094301 401
291 iso_pu_bacteria 2937098957 2937101559 401
292 iso_pu_bacteria 2937106411 2937110094 401
293 iso_pu_bacteria 2937113482 2937115544 401
294 iso_pu_bacteria 2937119839 2937119975 401
295 iso_pu_bacteria 2937126314 2937132425 401
296 iso_pu_bacteria 2957382221 2957382390 401
297 iso_pu_bacteria 2957388812 2957395403 401
298 iso_pu_bacteria 2957395598 2957400061 401
299 iso_pu_bacteria 2957402308 2957404164 401
300 iso_pu_bacteria 2957408893 2957414903 401
301 iso_pu_bacteria 2957415311 2957419446 401
302 iso_pu_bacteria 2957430029 2957432148 401
303 iso_pu_bacteria 2957443900 2957445891 401
304 iso_pu_bacteria 2957450854 2957450993 401
305 iso_pu_bacteria 2957457609 2957461633 401
306 iso_pu_bacteria 2957464669 2957468021 401
307 iso_pu_bacteria 2957471148 2957474896 401
308 iso_pu_bacteria 2957478035 2957478761 401
309 iso_pu_bacteria 2957484790 2957487282 401
310 iso_pu_bacteria 2957498199 2957504856 401
311 iso_pu_bacteria 2957505466 2957505655 401
312 iso_pu_bacteria 2960584000 2960584166 401
313 iso_pu_bacteria 2960597568 2960602977 401
314 iso_pu_bacteria 2960603979 2960604044 401
315 iso_pu_bacteria 2960610863 2960611063 401
316 iso_pu_bacteria 2960617483 2960622424 401
317 iso_pu_bacteria 2960624210 2960625311 401
318 iso_pu_bacteria 2960637947 2960640433 401
319 iso_pu_bacteria 2960645483 2960649184 401
320 iso_pu_bacteria 2960652885 2960657737 401
321 iso_pu_bacteria 2960660292 2960663809 401
322 iso_pu_bacteria 2960667422 2960667622 401
323 iso_pu_bacteria 2960674078 2960679271 401
324 iso_pu_bacteria 2960687367 2960691928 401
325 iso_pu_bacteria 2964607997 2964614978 401
326 iso_pu_bacteria 2964615318 2964620699 401
327 iso_pu_bacteria 2964621998 2964626057 401
328 iso_pu_bacteria 2964628898 2964629076 401
329 iso_pu_bacteria 2964636051 2964636185 401
330 iso_pu_bacteria 2964643177 2964643313 401
331 iso_pu_bacteria 2964649959 2964653855 401
332 iso_pu_bacteria 2964656573 2964656787 401
333 iso_pu_bacteria 2964663802 2964663939 401
334 iso_pu_bacteria 2964670856 2964673526 401
335 iso_pu_bacteria 2964678106 2964678154 401
336 iso_pu_bacteria 2964685014 2964691300 401
337 iso_pu_bacteria 2964691889 2964694132 401
338 iso_pu_bacteria 2964698721 2964698975 401
339 iso_pu_bacteria 2964705432 2964710784 401
340 iso_pu_bacteria 2964712639 2964716696 401
341 iso_pu_bacteria 2964719344 2964723407 401
342 iso_pu_bacteria 2967664464 2967664627 401
343 iso_pu_bacteria 2967671571 2967671708 401
344 iso_pu_bacteria 2967678726 2967681373 401
345 iso_pu_bacteria 2967693043 2967698455 401
346 iso_pu_bacteria 2967699805 2967699866 401
347 iso_pu_bacteria 2967706974 2967714043 401
348 iso_pu_bacteria 2967714385 2967718527 401
349 iso_pu_bacteria 2967721400 2967721472 401
350 iso_pu_bacteria 2967735183 2967737344 401
351 iso_pu_bacteria 2967742019 2967744369 401
352 iso_pu_bacteria 2967748971 2967749109 401
353 iso_pu_bacteria 2967755722 2967755860 401
354 iso_pu_bacteria 2967762386 2967762420 401
355 iso_pu_bacteria 2967769361 2967769515 401
356 iso_pu_bacteria 2967775926 2967776028 401
357 iso_pu_bacteria 2970019648 2970019811 401
358 iso_pu_bacteria 2970033650 2970033787 401
359 iso_pu_bacteria 2970040964 2970043972 401
360 iso_pu_bacteria 2970047711 2970052487 401
361 iso_pu_bacteria 2970054988 2970055675 401
362 iso_pu_bacteria 2970061556 2970063789 401
363 iso_pu_bacteria 2970068827 2970068963 401
364 iso_pu_bacteria 2970076120 2970078078 401
365 iso_pu_bacteria 2970082768 2970084396 401
366 iso_pu_bacteria 2970088815 2970091968 401
367 iso_pu_bacteria 2970095765 2970095903 401
368 iso_pu_bacteria 2970102677 2970102815 401
369 iso_pu_bacteria 2970109326 2970111276 401
370 iso_pu_bacteria 2970116247 2970119120 401
371 iso_pu_bacteria 2970129317 2970135266 401
372 iso_pu_bacteria 2970136068 2970136121 401
373 iso_pu_bacteria 2970149975 2970152062 401
374 iso_pu_bacteria 2970156795 2970162515 401
375 iso_pu_bacteria 2970164137 2970165548 401
376 iso_pu_bacteria 2970170962 2970171099 401
377 iso_pu_bacteria 2970177841 2970180086 401
378 iso_pu_bacteria 2970184632 2970188144 401
379 iso_pu_bacteria 2970191845 2970191922 401
380 iso_pu_bacteria 2977516862 2977520598 401
381 iso_pu_bacteria 2977523885 2977525936 401
382 iso_pu_bacteria 2977537788 2977539768 401
383 iso_pu_bacteria 2977551784 2977556088 401
384 iso_pu_bacteria 2977558990 2977559002 401
385 iso_pu_bacteria 2977565890 2977566148 401
386 iso_pu_bacteria 2977572785 2977573612 401
387 iso_pu_bacteria 2977579622 2977585093 401
388 iso_pu_bacteria 648276728 648735583 401
389 iso_pu_bacteria 8003992118 8003997097 401
390 3300003215 JGI25153J46596_10000834 JGI25153J46596_1000083415 402
391 3300003215 JGI25153J46596_10026883 JGI25153J46596_100268832 402
392 3300003693 Ga0032354_1024222 Ga0032354_10242222 402
393 3300003775 Ga0055524_1028128 Ga0055524_10281282 402
394 3300003781 Ga0055536_1002576 Ga0055536_10025769 402
395 3300003790 Ga0055528_1003961 Ga0055528_10039618 402
396 3300003794 Ga0055531_10001809 Ga0055531_100018095 402
397 3300005331 Ga0070670_100005946 Ga0070670_1000059463 402
398 3300006946 Ga0079104_1000125 Ga0079104_100012556 402
399 3300021320 Ga0214544_1000417 Ga0214544_10004179 402
400 3300021321 Ga0214542_1000032 Ga0214542_1000032137 402
401 3300021327 Ga0214543_1000016 Ga0214543_1000016142 402
402 3300025273 Ga0209673_1004897 Ga0209673_10048976 402
403 3300025297 Ga0209758_1001163 Ga0209758_100116312 402
404 3300025297 Ga0209758_1003633 Ga0209758_10036332 402
405 3300025303 Ga0209051_1000778 Ga0209051_100077822 402
406 3300025303 Ga0209051_1027828 Ga0209051_10278282 402
407 3300025304 Ga0209257_1003322 Ga0209257_100332211 402
408 3300025925 Ga0207650_10005217 Ga0207650_100052173 402
409 3300027111 Ga0209281_1000242 Ga0209281_100024254 402
410 3300031456 Ga0307513_10009932 Ga0307513_100099327 402
411 3300031901 Ga0307406_10011536 Ga0307406_100115361 402
412 3300032004 Ga0307414_10077401 Ga0307414_100774012 402
413 3300041494 Ga0451837_0645113 Ga0451837_0645113_964_2172 402
414 3300041507 Ga0451851_0124884 Ga0451851_0124884_105_1319 402
415 3300041511 Ga0451855_0961775 Ga0451855_0961775_620_1828 402
416 3300041512 Ga0451853_0147227 Ga0451853_0147227_2856_4070 402
417 3300046454 Ga0495592_0179127 Ga0495592_0179127_201_1409 402
418 3300046460 Ga0495638_0022725 Ga0495638_0022725_2589_3797 402
419 3300046507 Ga0495606_0028817 Ga0495606_0028817_1211_2419 402
420 3300046512 Ga0495610_0000970 Ga0495610_0000970_16890_18098 402
421 3300046522 Ga0495643_0039506 Ga0495643_0039506_1341_2552 402
422 3300046522 Ga0495643_0087794 Ga0495643_0087794_84_1292 402
423 3300046524 Ga0495648_0017276 Ga0495648_0017276_382_1596 402
424 3300047472 Ga0495686_0003405 Ga0495686_0003405_934_2142 402
425 3300048904 Ga0496101_0021155 Ga0496101_0021155_411_1619 402
426 3300048914 Ga0496111_0002642 Ga0496111_0002642_4722_5942 402
427 3300048914 Ga0496111_0127028 Ga0496111_0127028_283_1530 402
428 3300048919 Ga0496116_0019935 Ga0496116_0019935_927_2135 402
429 3300048920 Ga0496117_0008027 Ga0496117_0008027_1379_2587 402
430 3300048921 Ga0496118_0009587 Ga0496118_0009587_5015_6223 402
431 3300048921 Ga0496118_0010971 Ga0496118_0010971_46_1254 402
432 3300048924 Ga0496121_0005162 Ga0496121_0005162_4796_6004 402
433 3300048925 Ga0496122_0000018 Ga0496122_0000018_389161_390372 402
434 3300048925 Ga0496122_0002985 Ga0496122_0002985_20779_21987 402
435 3300048926 Ga0496123_0000015 Ga0496123_0000015_389161_390372 402
436 3300048926 Ga0496123_0010736 Ga0496123_0010736_6004_7212 402
437 3300048926 Ga0496123_0059097 Ga0496123_0059097_749_1960 402
438 3300048927 Ga0496124_0005166 Ga0496124_0005166_926_2134 402
439 3300048927 Ga0496124_0053506 Ga0496124_0053506_999_2219 402
440 3300048927 Ga0496124_0093011 Ga0496124_0093011_1068_2279 402
441 3300048927 Ga0496124_0113434 Ga0496124_0113434_906_2117 402
442 3300048928 Ga0496125_0000250 Ga0496125_0000250_55458_56705 402
443 3300053125 Ga0500618_006273 Ga0500618_006273_1403_2647 402
444 3300053139 Ga0500568_0036943 Ga0500568_0036943_236_1447 402
445 3300053148 Ga0500590_000218 Ga0500590_000218_2955_4163 402
446 3300053156 Ga0500622_0000951 Ga0500622_0000951_14416_15627 402
447 iso_pu_bacteria 2508501122 2509110321 402
448 iso_pu_bacteria 2509276019 2509377287 402
449 iso_pu_bacteria 2513237146 2513929760 402
450 iso_pu_bacteria 2534681796 2535520392 402
451 iso_pu_bacteria 2551306093 2551741625 402
452 iso_pu_bacteria 2558860100 2558862188 402
453 iso_pu_bacteria 2582581283 2585167052 402
454 iso_pu_bacteria 2582581306 2585269909 402
455 iso_pu_bacteria 2582581865 2585390693 402
456 iso_pu_bacteria 2585427528 2585543793 402
457 iso_pu_bacteria 2585427593 2585842165 402
458 iso_pu_bacteria 2599185170 2599419291 402
459 iso_pu_bacteria 2738541293 2738799793 402
460 iso_pu_bacteria 2738541333 2739038994 402
461 iso_pu_bacteria 2802429633 2806049470 402
462 iso_pu_bacteria 2802429634 2806056530 402
463 iso_pu_bacteria 2802429635 2806063619 402
464 iso_pu_bacteria 2802429636 2806071118 402
465 iso_pu_bacteria 2802429637 2806077922 402
466 iso_pu_bacteria 2838035591 2838037024 402
467 iso_pu_bacteria 2838074704 2838076078 402
468 iso_pu_bacteria 2838661181 2838663799 402
469 iso_pu_bacteria 2850079185 2850085425 402
470 iso_pu_bacteria 2894652903 2894654097 402
471 iso_pu_bacteria 8005542996 8005548140 402
472 iso_pu_bacteria 8005570704 8005571018 402
473 iso_pu_bacteria 8056875544 8056878541 402
474 3300025233 Ga0209437_100067 Ga0209437_100067194 403
475 3300025261 Ga0209233_1000088 Ga0209233_1000088194 403
476 3300025294 Ga0209025_1013577 Ga0209025_10135776 403
477 3300025297 Ga0209758_1018708 Ga0209758_10187085 403
478 3300046530 Ga0495654_0000236 Ga0495654_0000236_4518_5729 403
479 3300049569 Ga0501032_0011350 Ga0501032_0011350_1335_2546 403
480 3300049571 Ga0501034_0186205 Ga0501034_0186205_678_1889 403
481 3300049574 Ga0501038_0014869 Ga0501038_0014869_1767_2978 403
482 3300049582 Ga0501048_0078482 Ga0501048_0078482_1053_2264 403
483 3300049744 Ga0501083_0016474 Ga0501083_0016474_775_1986 403
484 3300049823 Ga0501044_0074536 Ga0501044_0074536_339_1550 403
485 iso_pu_bacteria 2791355094 2792642232 403
486 3300003187 JGI25151J46595_10007751 JGI25151J46595_100077515 404
487 3300003775 Ga0055524_1000863 Ga0055524_10008638 404
488 3300003775 Ga0055524_1001777 Ga0055524_10017775 404
489 3300003790 Ga0055528_1000396 Ga0055528_100039649 404
490 3300025258 Ga0209129_1000105 Ga0209129_1000105142 404
491 3300025273 Ga0209673_1000015 Ga0209673_1000015466 404
492 3300025294 Ga0209025_1001406 Ga0209025_100140613 404
493 3300025294 Ga0209025_1041958 Ga0209025_10419583 404
494 3300025299 Ga0209256_1000064 Ga0209256_100006476 404
495 3300025299 Ga0209256_1000447 Ga0209256_10004479 404
496 3300046474 Ga0495605_0032374 Ga0495605_0032374_25_1239 404
497 3300046492 Ga0495585_0015818 Ga0495585_0015818_858_2072 404
498 3300046518 Ga0495631_0002438 Ga0495631_0002438_2906_4120 404
499 3300046519 Ga0495632_0044306 Ga0495632_0044306_888_2102 404
500 3300046538 Ga0495609_0040225 Ga0495609_0040225_486_1700 404
501 3300046616 Ga0495668_0015795 Ga0495668_0015795_380_1594 404
502 3300046660 Ga0495625_0003325 Ga0495625_0003325_3251_4465 404
503 3300046810 Ga0495660_0109734 Ga0495660_0109734_74_1288 404
504 3300047320 Ga0495672_0058532 Ga0495672_0058532_161_1375 404
505 3300053079 Ga0500610_0004338 Ga0500610_0004338_4042_5256 404
506 3300053109 Ga0500569_015761 Ga0500569_015761_341_1555 404
507 3300053153 Ga0500616_0001067 Ga0500616_0001067_19878_21092 404
508 3300053177 Ga0500636_0006074 Ga0500636_0006074_3213_4427 404
509 3300053730 Ga0500645_007670 Ga0500645_007670_754_1968 404
510 3300003771 Ga0055526_1005899 Ga0055526_10058993 405
511 3300003790 Ga0055528_1000538 Ga0055528_100053815 405
512 3300006946 Ga0079104_1007869 Ga0079104_10078693 405
513 3300025273 Ga0209673_1001128 Ga0209673_100112815 405
514 3300025295 Ga0209564_1001203 Ga0209564_100120315 405
515 3300025299 Ga0209256_1001204 Ga0209256_100120415 405
516 3300027111 Ga0209281_1000185 Ga0209281_100018514 405
517 3300031548 Ga0307408_100118885 Ga0307408_1001188852 405
518 3300031731 Ga0307405_10043312 Ga0307405_100433122 405
519 3300042007 Ga0439449_0000282 Ga0439449_0000282_2085_3302 405
520 iso_pu_bacteria 2515154107 2515611648 405
521 iso_pu_bacteria 2936996657 2936997199 405
522 3300002704 JGI25155J39150_1000003 JGI25155J39150_1000003175 406
523 3300002705 JGI25156J39149_1000004 JGI25156J39149_1000004169 406
524 3300002738 JGI25154J39366_1000013 JGI25154J39366_1000013252 406
525 3300002741 JGI25157J39369_1000004 JGI25157J39369_1000004109 406
526 3300003215 JGI25153J46596_10001010 JGI25153J46596_1000101013 406
527 3300003354 JGI25160J50197_1000922 JGI25160J50197_10009227 406
528 3300003771 Ga0055526_1001177 Ga0055526_10011777 406
529 3300003775 Ga0055524_1000937 Ga0055524_100093717 406
530 3300003790 Ga0055528_1005704 Ga0055528_10057046 406
531 3300004625 Ga0055543_1001118 Ga0055543_10011187 406
532 3300006178 Ga0075367_10028827 Ga0075367_100288272 406
533 3300006195 Ga0075366_10013787 Ga0075366_100137873 406
534 3300006353 Ga0075370_10013808 Ga0075370_100138083 406
535 3300021321 Ga0214542_1019910 Ga0214542_10199103 406
536 3300021327 Ga0214543_1000005 Ga0214543_1000005194 406
537 3300025206 Ga0209435_100006 Ga0209435_100006108 406
538 3300025245 Ga0207425_1002251 Ga0207425_10022512 406
539 3300025246 Ga0209646_1000015 Ga0209646_1000015427 406
540 3300025250 Ga0209026_1000039 Ga0209026_1000039108 406
541 3300025256 Ga0209759_1000005 Ga0209759_1000005108 406
542 3300025258 Ga0209129_1000978 Ga0209129_100097813 406
543 3300025273 Ga0209673_1001602 Ga0209673_10016028 406
544 3300025294 Ga0209025_1001681 Ga0209025_100168114 406
545 3300025295 Ga0209564_1001863 Ga0209564_10018637 406
546 3300025297 Ga0209758_1001508 Ga0209758_100150813 406
547 3300025299 Ga0209256_1001765 Ga0209256_100176516 406
548 3300025302 Ga0207426_1000863 Ga0207426_100086314 406
549 3300041505 Ga0451849_1098025 Ga0451849_1098025_109_1344 406
550 3300041511 Ga0451855_0141111 Ga0451855_0141111_809_2044 406
551 3300048924 Ga0496121_0002141 Ga0496121_0002141_23697_24941 406
552 3300048927 Ga0496124_0015262 Ga0496124_0015262_4999_6225 406
553 3300049570 Ga0501033_0001248 Ga0501033_0001248_17766_19043 406
554 3300049822 Ga0501035_0005830 Ga0501035_0005830_8548_9825 406
555 3300050494 nmdc:mga06z11_133422_c1 nmdc:mga06z11_133422_c1_104_1339 406
556 iso_pu_bacteria 2511231027 2511390432 406
557 iso_pu_bacteria 2791355253 2793282638 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03486

HI0933_like

HI0933-like protein Rossmann domain

9

390

0.98

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

10

48

0.93

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

13

47

0.93

PF22780

HI0933_like_1st

HI0933-like protein barrel and H2TH domain

192

337

0.92

PF01494

FAD_binding_3

FAD binding domain

8

59

0.89

PF13454

NAD_binding_9

FAD-NAD(P)-binding

12

170

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lk7-assembly1.cif.gz_A the crystal structure of udp-n-acetylmuramoylalanine-d-glutamate (murd) ligase from streptococcus agalactiae to 1.5a 0.8848 3 36
5a9r-assembly1.cif.gz_A apo form of imine reductase from amycolatopsis orientalis 0.8829 6 38
2i0z-assembly1.cif.gz_A crystal structure of a fad binding protein from bacillus cereus, a putative nad(fad)-utilizing dehydrogenases 0.877 2 396
5fwn-assembly1.cif.gz_A imine reductase from amycolatopsis orientalis. closed form in in complex with (r)- methyltetrahydroisoquinoline 0.8752 6 38
1kj9-assembly1.cif.gz_B crystal structure of purt-encoded glycinamide ribonucleotide transformylase complexed with mg-atp 0.875 4 38
ID Description Score Start End Superfamily
af_A0A1D8PH67_164_295_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9345 3 36 3.40.50.720
af_Q2G2C7_5_335_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9161 3 32 3.90.180.10
af_A0A1D6QTI4_68_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9085 3 35 3.40.50.720
af_P39400_150_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8971 3 36 3.40.50.720
af_P9WFZ3_1_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8961 6 36 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q5RQG2-F1-model_v4 NAD(FAD)-utilizing dehydrogenase 0.9906 6 160
AF-A0A533J2Q3-F1-model_v4 deleted 0.9881 4 155
AF-A0A136L2S4-F1-model_v4 Putative thiazole biosynthetic enzyme (EC 5.3.1.29) 0.9855 2 138 GO:0043917
AF-A0A3D5ZT21-F1-model_v4 deleted 0.9834 2 120
AF-A0A829E9X3-F1-model_v4 deleted 0.9833 18 121

Feature Viewer

pLDDT pTM Quality
92.97 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map