F463373

General Info

Members Datasets Scaffolds Average Seq Length
557 212 1114 202

Family's Representative Sequence

Representative Sequence 3300053148|Ga0500590_004096|Ga0500590_004096_1779_2498
Length 239
Sequence VEIDMSNGSDAADAARERLSALVDGELEGATVAAACASWREDSASRSTWHAYHLIGDVLRSEDLAASPRRDEAFLISLRARLVIEPVVLAPAVPSSVEIDVRSDVPAEVAIPRRAVAGARGGRWSWMAPSAVAAGFVVVXXXXMVTNAPTPTQRVGAPALAQTAAARMAVLPVVPAASTLKVANTTSSFEPQTLVANGRLIRDPRLDRYLSAHKEFAGSTALGVPSAFLRDAVAEAPGR

Samples

Sample ID Description Type Environment
1 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
201 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
202 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
203 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
204 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
212 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.9
Nodule 0
Rhizoplane 2.87
Rhizosphere 83.48
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500590_004096 3300053148 Bacteria 6830
2 Ga0070658_10224622 3300005327 Bacteria 1589
3 Ga0070658_10239839 3300005327 Bacteria 1536
4 Ga0070676_10004742 3300005328 Bacteria 7194
5 Ga0070676_10031370 3300005328 Bacteria 3036
6 Ga0070676_10046945 3300005328 Bacteria 2520
7 Ga0070676_10160869 3300005328 Bacteria 1445
8 Ga0070676_10168417 3300005328 Unclassified 1415
9 Ga0070683_100187183 3300005329 Bacteria 1965
10 Ga0070670_100009467 3300005331 Bacteria 8317
11 Ga0070670_100123178 3300005331 Bacteria 2237
12 Ga0070670_100677060 3300005331 Bacteria 926
13 Ga0070677_10008151 3300005333 Bacteria 3519
14 Ga0070677_10012720 3300005333 Bacteria 2926
15 Ga0070677_10135989 3300005333 Bacteria 1128
16 Ga0068869_100012102 3300005334 Bacteria 5688
17 Ga0068869_100038473 3300005334 Bacteria 3410
18 Ga0068869_100512717 3300005334 Bacteria 1003
19 Ga0070666_10027964 3300005335 Bacteria 3697
20 Ga0070666_10102799 3300005335 Bacteria 1971
21 Ga0070666_10236858 3300005335 Bacteria 1290
22 Ga0068868_100010482 3300005338 Bacteria 6715
23 Ga0068868_100041976 3300005338 Bacteria 3566
24 Ga0068868_100053764 3300005338 Bacteria 3173
25 Ga0068868_100499972 3300005338 Bacteria 1065
26 Ga0070660_100029875 3300005339 Bacteria 4086
27 Ga0070660_100100889 3300005339 Bacteria 2286
28 Ga0070660_100206982 3300005339 Bacteria 1592
29 Ga0070661_100026590 3300005344 Bacteria 4162
30 Ga0070668_100002286 3300005347 Bacteria 14134
31 Ga0070669_100004329 3300005353 Bacteria 10255
32 Ga0070669_100013287 3300005353 Bacteria 5851
33 Ga0070669_100019885 3300005353 Bacteria 4797
34 Ga0070669_100070138 3300005353 Bacteria 2590
35 Ga0070669_100145833 3300005353 Bacteria 1829
36 Ga0070669_100283732 3300005353 Bacteria 1327
37 Ga0070675_100020639 3300005354 Bacteria 5257
38 Ga0070675_100022460 3300005354 Bacteria 5042
39 Ga0070675_100092027 3300005354 Bacteria 2542
40 Ga0070675_100229133 3300005354 Bacteria 1620
41 Ga0070675_100259284 3300005354 Bacteria 1523
42 Ga0070675_100387206 3300005354 Bacteria 1245
43 Ga0070671_100015423 3300005355 Bacteria 6173
44 Ga0070671_100034947 3300005355 Bacteria 4162
45 Ga0070671_100068272 3300005355 Bacteria 2965
46 Ga0070671_100081140 3300005355 Bacteria 2712
47 Ga0070671_100142100 3300005355 Bacteria 2026
48 Ga0070671_100154196 3300005355 Bacteria 1940
49 Ga0070674_100003956 3300005356 Bacteria 8393
50 Ga0070674_100011106 3300005356 Bacteria 5469
51 Ga0070674_100022271 3300005356 Bacteria 4084
52 Ga0070674_100374335 3300005356 Bacteria 1157
53 Ga0070673_100031212 3300005364 Bacteria 3997
54 Ga0070673_100033949 3300005364 Bacteria 3856
55 Ga0070673_100041159 3300005364 Bacteria 3550
56 Ga0070673_100140601 3300005364 Bacteria 2036
57 Ga0070673_100511454 3300005364 Bacteria 1087
58 Ga0070673_100621258 3300005364 Unclassified 987
59 Ga0070659_100018068 3300005366 Bacteria 5318
60 Ga0070659_100142162 3300005366 Bacteria 1954
61 Ga0070659_100196882 3300005366 Bacteria 1657
62 Ga0070659_100528176 3300005366 Bacteria 1008
63 Ga0070667_100030705 3300005367 Bacteria 4481
64 Ga0070667_100070559 3300005367 Bacteria 2974
65 Ga0070667_100278833 3300005367 Bacteria 1500
66 Ga0070667_100716310 3300005367 Bacteria 926
67 Ga0070700_100049251 3300005441 Bacteria 2615
68 Ga0070708_100119757 3300005445 Bacteria 2427
69 Ga0070663_100141138 3300005455 Bacteria 1839
70 Ga0070678_100035301 3300005456 Bacteria 3489
71 Ga0070678_100094262 3300005456 Bacteria 2304
72 Ga0070678_100205951 3300005456 Bacteria 1627
73 Ga0070678_100275488 3300005456 Bacteria 1421
74 Ga0070678_100343115 3300005456 Bacteria 1282
75 Ga0070678_100377436 3300005456 Bacteria 1226
76 Ga0070678_100450346 3300005456 Bacteria 1127
77 Ga0070678_100558842 3300005456 Unclassified 1017
78 Ga0070678_100598256 3300005456 Bacteria 984
79 Ga0070678_100658261 3300005456 Unclassified 940
80 Ga0070662_100006853 3300005457 Bacteria 7371
81 Ga0070662_100026489 3300005457 Bacteria 4016
82 Ga0070662_100065143 3300005457 Bacteria 2670
83 Ga0070662_100112770 3300005457 Bacteria 2074
84 Ga0070681_10179660 3300005458 Bacteria 2038
85 Ga0068867_100000143 3300005459 Bacteria 45972
86 Ga0068867_100002549 3300005459 Bacteria 12841
87 Ga0068867_100027058 3300005459 Bacteria 4120
88 Ga0068867_100033964 3300005459 Bacteria 3696
89 Ga0068867_100042310 3300005459 Bacteria 3332
90 Ga0068867_100053785 3300005459 Bacteria 2973
91 Ga0068867_100056950 3300005459 Bacteria 2893
92 Ga0068867_100517060 3300005459 Bacteria 1029
93 Ga0070706_100002337 3300005467 Bacteria 19150
94 Ga0068853_100035247 3300005539 Bacteria 4249
95 Ga0068853_100149149 3300005539 Bacteria 2104
96 Ga0068853_100152819 3300005539 Bacteria 2078
97 Ga0070672_100001628 3300005543 Bacteria 13969
98 Ga0070672_100007698 3300005543 Bacteria 7337
99 Ga0070672_100046689 3300005543 Bacteria 3356
100 Ga0070672_100078492 3300005543 Bacteria 2642
101 Ga0070672_100516371 3300005543 Bacteria 1035
102 Ga0070672_100709297 3300005543 Bacteria 881
103 Ga0070672_100954875 3300005543 Bacteria 759
104 Ga0070693_100006191 3300005547 Bacteria 5799
105 Ga0070665_100022990 3300005548 Bacteria 6277
106 Ga0070665_100239368 3300005548 Bacteria 1816
107 Ga0070665_100838293 3300005548 Bacteria 932
108 Ga0070665_101028819 3300005548 Bacteria 836
109 Ga0068855_100210773 3300005563 Bacteria 2183
110 Ga0068855_100294720 3300005563 Bacteria 1798
111 Ga0068855_100703255 3300005563 Bacteria 1081
112 Ga0070664_100052147 3300005564 Bacteria 3464
113 Ga0070664_100072261 3300005564 Bacteria 2958
114 Ga0070664_100174129 3300005564 Unclassified 1910
115 Ga0070664_100183596 3300005564 Bacteria 1860
116 Ga0070664_100199693 3300005564 Bacteria 1784
117 Ga0070664_101042184 3300005564 Unclassified 769
118 Ga0068857_100082512 3300005577 Bacteria 2871
119 Ga0068857_100315680 3300005577 Bacteria 1442
120 Ga0068854_100026398 3300005578 Bacteria 3992
121 Ga0068854_100094770 3300005578 Bacteria 2227
122 Ga0068854_100133372 3300005578 Bacteria 1899
123 Ga0068854_100562574 3300005578 Unclassified 969
124 Ga0068856_100142890 3300005614 Bacteria 2400
125 Ga0068856_100254529 3300005614 Bacteria 1771
126 Ga0070702_100010254 3300005615 Bacteria 4610
127 Ga0068852_100011067 3300005616 Bacteria 6774
128 Ga0068852_100018115 3300005616 Bacteria 5542
129 Ga0068852_100052327 3300005616 Bacteria 3509
130 Ga0068852_100067748 3300005616 Bacteria 3121
131 Ga0068852_100093994 3300005616 Bacteria 2688
132 Ga0068852_100410062 3300005616 Bacteria 1334
133 Ga0068852_100530281 3300005616 Bacteria 1176
134 Ga0068859_100106203 3300005617 Bacteria 2867
135 Ga0068859_100501602 3300005617 Bacteria 1309
136 Ga0068864_100009307 3300005618 Bacteria 8102
137 Ga0068864_100012670 3300005618 Bacteria 6971
138 Ga0068864_100069275 3300005618 Bacteria 3067
139 Ga0068864_100162208 3300005618 Bacteria 2032
140 Ga0068864_100626523 3300005618 Bacteria 1046
141 Ga0068866_10010719 3300005718 Bacteria 3939
142 Ga0068861_100002727 3300005719 Bacteria 11570
143 Ga0068861_100005959 3300005719 Bacteria 8279
144 Ga0068861_100013625 3300005719 Bacteria 5692
145 Ga0068861_100016292 3300005719 Bacteria 5256
146 Ga0068851_10004027 3300005834 Bacteria 6595
147 Ga0068851_10014133 3300005834 Bacteria 3786
148 Ga0068851_10110145 3300005834 Bacteria 1469
149 Ga0068863_100022612 3300005841 Bacteria 6005
150 Ga0068863_100029193 3300005841 Bacteria 5265
151 Ga0068863_100117680 3300005841 Bacteria 2532
152 Ga0068863_100248553 3300005841 Bacteria 1718
153 Ga0068863_100390369 3300005841 Bacteria 1360
154 Ga0068863_101429889 3300005841 Bacteria 699
155 Ga0068858_100020970 3300005842 Bacteria 6105
156 Ga0068858_100070480 3300005842 Bacteria 3240
157 Ga0068858_100441630 3300005842 Bacteria 1253
158 Ga0068860_100021846 3300005843 Bacteria 6191
159 Ga0068860_100140723 3300005843 Bacteria 2319
160 Ga0068860_100219831 3300005843 Bacteria 1845
161 Ga0068860_100815346 3300005843 Bacteria 947
162 Ga0068862_100033294 3300005844 Bacteria 4356
163 Ga0068862_100063925 3300005844 Bacteria 3166
164 Ga0075365_10479807 3300006038 Bacteria 878
165 Ga0075368_10031057 3300006042 Bacteria 2070
166 Ga0075368_10040213 3300006042 Bacteria 1836
167 Ga0070715_10088587 3300006163 Bacteria 1419
168 Ga0075362_10093609 3300006177 Bacteria 1397
169 Ga0075369_10092982 3300006186 Bacteria 1347
170 Ga0075366_10011697 3300006195 Bacteria 4959
171 Ga0075366_10011871 3300006195 Bacteria 4929
172 Ga0075366_10016157 3300006195 Bacteria 4286
173 Ga0075366_10068017 3300006195 Bacteria 2120
174 Ga0097621_100069033 3300006237 Bacteria 2917
175 Ga0097621_100097174 3300006237 Bacteria 2472
176 Ga0097621_100233312 3300006237 Bacteria 1607
177 Ga0075370_10013458 3300006353 Bacteria 4349
178 Ga0075370_10019860 3300006353 Bacteria 3662
179 Ga0075370_10028094 3300006353 Bacteria 3125
180 Ga0075370_10134128 3300006353 Bacteria 1446
181 Ga0075370_10254759 3300006353 Bacteria 1040
182 Ga0068871_100011880 3300006358 Bacteria 6406
183 Ga0068871_100238784 3300006358 Bacteria 1579
184 Ga0068871_100245495 3300006358 Unclassified 1558
185 Ga0068871_100294597 3300006358 Bacteria 1423
186 Ga0068871_100317089 3300006358 Bacteria 1372
187 Ga0068871_100475065 3300006358 Bacteria 1124
188 Ga0068865_100070613 3300006881 Bacteria 2475
189 Ga0068865_100131526 3300006881 Bacteria 1875
190 Ga0097620_100106198 3300006931 Bacteria 2867
191 Ga0097620_100501623 3300006931 Bacteria 1309
192 Ga0111539_10302472 3300009094 Bacteria 1861
193 Ga0105245_10083263 3300009098 Bacteria 2928
194 Ga0105245_10313180 3300009098 Bacteria 1544
195 Ga0105245_10434748 3300009098 Bacteria 1318
196 Ga0105243_10006182 3300009148 Bacteria 9260
197 Ga0105243_10007512 3300009148 Bacteria 8378
198 Ga0105243_10061862 3300009148 Bacteria 2995
199 Ga0105243_10364676 3300009148 Bacteria 1331
200 Ga0105241_10098490 3300009174 Bacteria 2320
201 Ga0105248_10078444 3300009177 Bacteria 3712
202 Ga0105248_10083693 3300009177 Bacteria 3589
203 Ga0105248_10112479 3300009177 Bacteria 3071
204 Ga0105248_10152296 3300009177 Bacteria 2609
205 Ga0105248_10547898 3300009177 Bacteria 1305
206 Ga0105248_11992704 3300009177 Bacteria 660
207 Ga0105237_10276682 3300009545 Bacteria 1681
208 Ga0105237_10303310 3300009545 Bacteria 1600
209 Ga0105238_10055748 3300009551 Bacteria 3966
210 Ga0105238_10061953 3300009551 Bacteria 3742
211 Ga0105238_10289715 3300009551 Bacteria 1619
212 Ga0105249_10071862 3300009553 Bacteria 3198
213 Ga0105239_10108628 3300010375 Bacteria 3073
214 Ga0157371_10105369 3300013102 Bacteria 2001
215 Ga0157371_10614682 3300013102 Bacteria 809
216 Ga0157374_10053583 3300013296 Bacteria 3761
217 Ga0157374_10137458 3300013296 Bacteria 2370
218 Ga0157374_10401599 3300013296 Unclassified 1367
219 Ga0157378_10038865 3300013297 Bacteria 4219
220 Ga0157378_10133630 3300013297 Bacteria 2299
221 Ga0157378_10494304 3300013297 Bacteria 1221
222 Ga0163162_10009022 3300013306 Bacteria 9694
223 Ga0163162_10015696 3300013306 Bacteria 7400
224 Ga0163162_10117690 3300013306 Bacteria 2759
225 Ga0163162_10182505 3300013306 Bacteria 2225
226 Ga0157372_10157540 3300013307 Bacteria 2623
227 Ga0157375_10002731 3300013308 Bacteria 15254
228 Ga0157375_10012565 3300013308 Bacteria 7515
229 Ga0157375_10017680 3300013308 Bacteria 6443
230 Ga0157375_10054555 3300013308 Bacteria 3936
231 Ga0157375_10321165 3300013308 Bacteria 1713
232 Ga0157375_10399981 3300013308 Bacteria 1540
233 Ga0157375_10455479 3300013308 Bacteria 1445
234 Ga0157380_10006938 3300014326 Bacteria 8015
235 Ga0157380_10091723 3300014326 Bacteria 2509
236 Ga0157380_10114156 3300014326 Bacteria 2276
237 Ga0157380_10360685 3300014326 Bacteria 1363
238 Ga0157377_10001941 3300014745 Bacteria 9047
239 Ga0157377_10004640 3300014745 Bacteria 6356
240 Ga0157379_10013752 3300014968 Bacteria 7094
241 Ga0157379_10018648 3300014968 Bacteria 6116
242 Ga0157379_10344898 3300014968 Bacteria 1363
243 Ga0157379_10557550 3300014968 Bacteria 1066
244 Ga0157376_10015559 3300014969 Bacteria 5751
245 Ga0157376_10131126 3300014969 Bacteria 2237
246 Ga0157376_10556722 3300014969 Bacteria 1135
247 Ga0163161_10011365 3300017792 Bacteria 6173
248 Ga0163161_10014761 3300017792 Bacteria 5441
249 Ga0163161_10017782 3300017792 Bacteria 4982
250 Ga0163161_10093986 3300017792 Bacteria 2222
251 Ga0163161_10243252 3300017792 Bacteria 1400
252 Ga0207697_10020477 3300025315 Bacteria 2708
253 Ga0207656_10005115 3300025321 Bacteria 4612
254 Ga0207656_10039769 3300025321 Unclassified 1991
255 Ga0207656_10065791 3300025321 Bacteria 1601
256 Ga0207682_10012953 3300025893 Bacteria 3252
257 Ga0207682_10016177 3300025893 Bacteria 2907
258 Ga0207682_10071833 3300025893 Bacteria 1467
259 Ga0207682_10076283 3300025893 Bacteria 1428
260 Ga0207688_10213764 3300025901 Bacteria 1159
261 Ga0207680_10027508 3300025903 Bacteria 3168
262 Ga0207680_10034502 3300025903 Bacteria 2896
263 Ga0207680_10165824 3300025903 Bacteria 1484
264 Ga0207685_10289286 3300025905 Bacteria 807
265 Ga0207645_10005795 3300025907 Bacteria 8911
266 Ga0207645_10014206 3300025907 Bacteria 5333
267 Ga0207645_10017939 3300025907 Bacteria 4667
268 Ga0207645_10100351 3300025907 Bacteria 1867
269 Ga0207645_10149722 3300025907 Bacteria 1523
270 Ga0207643_10040473 3300025908 Bacteria 2624
271 Ga0207705_10105644 3300025909 Bacteria 2076
272 Ga0207705_10167269 3300025909 Bacteria 1654
273 Ga0207705_10242367 3300025909 Bacteria 1373
274 Ga0207684_10018587 3300025910 Bacteria 5951
275 Ga0207707_10189567 3300025912 Bacteria 1794
276 Ga0207671_10164753 3300025914 Bacteria 1718
277 Ga0207671_10529875 3300025914 Bacteria 939
278 Ga0207662_10001929 3300025918 Bacteria 10223
279 Ga0207657_10019063 3300025919 Bacteria 6527
280 Ga0207657_10044390 3300025919 Bacteria 3907
281 Ga0207649_10085455 3300025920 Bacteria 2053
282 Ga0207649_10241970 3300025920 Bacteria 1296
283 Ga0207649_10325778 3300025920 Bacteria 1130
284 Ga0207681_10000583 3300025923 Bacteria 24864
285 Ga0207681_10087457 3300025923 Bacteria 2217
286 Ga0207681_10121097 3300025923 Bacteria 1919
287 Ga0207681_10158019 3300025923 Bacteria 1705
288 Ga0207681_10286857 3300025923 Bacteria 1298
289 Ga0207694_10019273 3300025924 Bacteria 5158
290 Ga0207694_10231374 3300025924 Bacteria 1509
291 Ga0207694_10287891 3300025924 Bacteria 1351
292 Ga0207650_10000587 3300025925 Bacteria 29198
293 Ga0207650_10036194 3300025925 Bacteria 3589
294 Ga0207650_10037061 3300025925 Bacteria 3551
295 Ga0207650_10037848 3300025925 Bacteria 3518
296 Ga0207650_10094113 3300025925 Unclassified 2295
297 Ga0207650_10099786 3300025925 Bacteria 2233
298 Ga0207650_10901910 3300025925 Unclassified 751
299 Ga0207659_10001367 3300025926 Bacteria 14558
300 Ga0207659_10011724 3300025926 Bacteria 5547
301 Ga0207659_10012462 3300025926 Bacteria 5412
302 Ga0207659_10098374 3300025926 Bacteria 2200
303 Ga0207659_10233280 3300025926 Bacteria 1485
304 Ga0207659_10297780 3300025926 Bacteria 1324
305 Ga0207659_10339080 3300025926 Bacteria 1244
306 Ga0207687_10018744 3300025927 Bacteria 4574
307 Ga0207687_10593722 3300025927 Bacteria 933
308 Ga0207687_10914694 3300025927 Bacteria 751
309 Ga0207644_10002900 3300025931 Bacteria 11052
310 Ga0207644_10056521 3300025931 Bacteria 2832
311 Ga0207644_10059232 3300025931 Bacteria 2770
312 Ga0207644_10068733 3300025931 Bacteria 2585
313 Ga0207644_10385157 3300025931 Bacteria 1144
314 Ga0207644_10442600 3300025931 Bacteria 1067
315 Ga0207690_10039585 3300025932 Bacteria 3076
316 Ga0207690_10215661 3300025932 Bacteria 1466
317 Ga0207706_10006738 3300025933 Bacteria 10621
318 Ga0207706_10036903 3300025933 Bacteria 4341
319 Ga0207706_10048625 3300025933 Bacteria 3751
320 Ga0207706_10123165 3300025933 Bacteria 2281
321 Ga0207706_10302885 3300025933 Unclassified 1392
322 Ga0207709_10003389 3300025935 Bacteria 9521
323 Ga0207669_10004393 3300025937 Bacteria 6203
324 Ga0207669_10043376 3300025937 Bacteria 2634
325 Ga0207704_10016061 3300025938 Bacteria 3836
326 Ga0207704_10036637 3300025938 Bacteria 2824
327 Ga0207691_10000964 3300025940 Bacteria 28552
328 Ga0207691_10015227 3300025940 Bacteria 7316
329 Ga0207691_10018195 3300025940 Bacteria 6656
330 Ga0207691_10039952 3300025940 Bacteria 4338
331 Ga0207691_10047197 3300025940 Bacteria 3954
332 Ga0207691_10068799 3300025940 Bacteria 3199
333 Ga0207691_10153647 3300025940 Bacteria 2023
334 Ga0207691_10652180 3300025940 Bacteria 889
335 Ga0207711_10063890 3300025941 Bacteria 3179
336 Ga0207711_10087257 3300025941 Bacteria 2737
337 Ga0207711_10096234 3300025941 Bacteria 2612
338 Ga0207711_10278381 3300025941 Bacteria 1540
339 Ga0207689_10020128 3300025942 Bacteria 5620
340 Ga0207689_10021544 3300025942 Bacteria 5419
341 Ga0207689_10085868 3300025942 Bacteria 2587
342 Ga0207661_10053259 3300025944 Bacteria 3237
343 Ga0207679_10011260 3300025945 Bacteria 5782
344 Ga0207679_10103438 3300025945 Bacteria 2232
345 Ga0207679_10148618 3300025945 Bacteria 1904
346 Ga0207679_10278614 3300025945 Unclassified 1433
347 Ga0207667_10718305 3300025949 Bacteria 1000
348 Ga0207651_10009927 3300025960 Bacteria 5243
349 Ga0207651_10023330 3300025960 Bacteria 3803
350 Ga0207651_10629669 3300025960 Bacteria 940
351 Ga0207651_10631445 3300025960 Bacteria 939
352 Ga0207668_10070385 3300025972 Bacteria 2494
353 Ga0207668_10107965 3300025972 Bacteria 2082
354 Ga0207668_10668368 3300025972 Bacteria 911
355 Ga0207640_10015613 3300025981 Bacteria 4401
356 Ga0207640_10070115 3300025981 Bacteria 2356
357 Ga0207640_10084056 3300025981 Bacteria 2184
358 Ga0207640_10111945 3300025981 Bacteria 1937
359 Ga0207640_10218854 3300025981 Bacteria 1456
360 Ga0207640_10351022 3300025981 Bacteria 1185
361 Ga0207640_10512248 3300025981 Unclassified 1001
362 Ga0207658_10027281 3300025986 Bacteria 4010
363 Ga0207677_10002663 3300026023 Bacteria 9406
364 Ga0207677_10127502 3300026023 Bacteria 1926
365 Ga0207703_10049768 3300026035 Bacteria 3388
366 Ga0207703_10123545 3300026035 Bacteria 2225
367 Ga0207639_10011871 3300026041 Bacteria 6059
368 Ga0207639_10042561 3300026041 Bacteria 3404
369 Ga0207639_10067205 3300026041 Bacteria 2789
370 Ga0207639_10387702 3300026041 Bacteria 1256
371 Ga0207678_10080502 3300026067 Bacteria 2789
372 Ga0207678_10107449 3300026067 Bacteria 2380
373 Ga0207678_10130842 3300026067 Bacteria 2141
374 Ga0207708_10021458 3300026075 Bacteria 4870
375 Ga0207708_10194747 3300026075 Bacteria 1615
376 Ga0207702_10076114 3300026078 Bacteria 2900
377 Ga0207702_10669900 3300026078 Bacteria 1021
378 Ga0207641_10016653 3300026088 Bacteria 6018
379 Ga0207641_10112058 3300026088 Bacteria 2420
380 Ga0207641_10185132 3300026088 Bacteria 1910
381 Ga0207641_10207482 3300026088 Unclassified 1810
382 Ga0207641_10438476 3300026088 Unclassified 1260
383 Ga0207641_10640306 3300026088 Bacteria 1043
384 Ga0207648_10000019 3300026089 Bacteria 144209
385 Ga0207648_10007408 3300026089 Bacteria 10800
386 Ga0207648_10008093 3300026089 Bacteria 10238
387 Ga0207648_10019916 3300026089 Bacteria 6055
388 Ga0207648_10027054 3300026089 Bacteria 5094
389 Ga0207648_10043090 3300026089 Bacteria 3963
390 Ga0207648_10227927 3300026089 Bacteria 1657
391 Ga0207648_10361441 3300026089 Bacteria 1310
392 Ga0207676_10007609 3300026095 Bacteria 7692
393 Ga0207676_10042158 3300026095 Bacteria 3509
394 Ga0207676_10075299 3300026095 Bacteria 2722
395 Ga0207676_10087715 3300026095 Bacteria 2545
396 Ga0207676_10379265 3300026095 Bacteria 1316
397 Ga0207676_10546760 3300026095 Bacteria 1106
398 Ga0207676_10576365 3300026095 Bacteria 1078
399 Ga0207674_10035255 3300026116 Bacteria 5224
400 Ga0207674_10058546 3300026116 Bacteria 3902
401 Ga0207674_10100727 3300026116 Bacteria 2870
402 Ga0207675_100007218 3300026118 Bacteria 10496
403 Ga0207675_100010715 3300026118 Bacteria 8586
404 Ga0207675_100072339 3300026118 Bacteria 3225
405 Ga0207675_100159631 3300026118 Bacteria 2150
406 Ga0207683_10108132 3300026121 Bacteria 2488
407 Ga0207683_10120231 3300026121 Bacteria 2357
408 Ga0207683_10171909 3300026121 Bacteria 1963
409 Ga0207683_10174449 3300026121 Bacteria 1948
410 Ga0207683_10250032 3300026121 Bacteria 1618
411 Ga0207683_10342922 3300026121 Bacteria 1370
412 Ga0207683_10409575 3300026121 Bacteria 1248
413 Ga0207683_10456450 3300026121 Bacteria 1178
414 Ga0207698_10004559 3300026142 Bacteria 8457
415 Ga0207698_10012475 3300026142 Bacteria 5563
416 Ga0207698_10035049 3300026142 Bacteria 3667
417 Ga0207698_10051144 3300026142 Bacteria 3157
418 Ga0207698_10069305 3300026142 Bacteria 2788
419 Ga0207698_10480103 3300026142 Bacteria 1206
420 Ga0207698_10690982 3300026142 Bacteria 1014
421 Ga0268266_10018663 3300028379 Bacteria 5910
422 Ga0268266_10121307 3300028379 Bacteria 2327
423 Ga0268265_10033811 3300028380 Bacteria 3720
424 Ga0268265_10367567 3300028380 Bacteria 1319
425 Ga0268265_10489810 3300028380 Bacteria 1156
426 Ga0268264_10003212 3300028381 Bacteria 14160
427 Ga0268264_10204379 3300028381 Bacteria 1809
428 Ga0268264_10236823 3300028381 Bacteria 1689
429 Ga0268264_10616003 3300028381 Bacteria 1071
430 Ga0307517_10000174 3300028786 Bacteria 105578
431 Ga0307517_10132152 3300028786 Bacteria 1792
432 Ga0307515_10012282 3300028794 Bacteria 16128
433 Ga0307515_10018182 3300028794 Bacteria 12750
434 Ga0307515_10215796 3300028794 Bacteria 1750
435 Ga0307515_10315798 3300028794 Bacteria 1233
436 Ga0307512_10020173 3300030522 Bacteria 6044
437 Ga0307512_10073967 3300030522 Bacteria 2506
438 Ga0307512_10111813 3300030522 Bacteria 1796
439 Ga0307513_10002929 3300031456 Bacteria 23340
440 Ga0307513_10070101 3300031456 Bacteria 3666
441 Ga0307513_10130219 3300031456 Bacteria 2463
442 Ga0307513_10369023 3300031456 Bacteria 1178
443 Ga0307509_10000225 3300031507 Bacteria 90913
444 Ga0307509_10017007 3300031507 Bacteria 8385
445 Ga0307509_10085561 3300031507 Bacteria 3244
446 Ga0307509_10472568 3300031507 Bacteria 943
447 Ga0307508_10003326 3300031616 Bacteria 16330
448 Ga0307508_10005362 3300031616 Bacteria 12211
449 Ga0307508_10026639 3300031616 Bacteria 5239
450 Ga0307508_10175830 3300031616 Bacteria 1744
451 Ga0307508_10244087 3300031616 Bacteria 1393
452 Ga0307514_10057358 3300031649 Bacteria 2984
453 Ga0307514_10078539 3300031649 Bacteria 2451
454 Ga0307514_10225340 3300031649 Bacteria 1144
455 Ga0307516_10238905 3300031730 Bacteria 1516
456 Ga0307516_10296047 3300031730 Bacteria 1295
457 Ga0307405_10020196 3300031731 Bacteria 3717
458 Ga0307405_10029059 3300031731 Bacteria 3227
459 Ga0307413_10022833 3300031824 Bacteria 3380
460 Ga0307410_10000484 3300031852 Bacteria 16146
461 Ga0307406_10003564 3300031901 Bacteria 8487
462 Ga0307406_10164979 3300031901 Bacteria 1597
463 Ga0307407_10282424 3300031903 Unclassified 1150
464 Ga0307412_10026739 3300031911 Bacteria 3590
465 Ga0307409_100006477 3300031995 Bacteria 6885
466 Ga0307409_100011627 3300031995 Bacteria 5563
467 Ga0307416_100165332 3300032002 Bacteria 2051
468 Ga0307414_10018402 3300032004 Bacteria 4301
469 Ga0307415_100276580 3300032126 Unclassified 1378
470 Ga0307510_10014261 3300033180 Bacteria 9411
471 Ga0307510_10142881 3300033180 Bacteria 2032
472 Ga0307510_10350836 3300033180 Bacteria 926
473 Ga0373938_0012171 3300034957 Bacteria 1610
474 Ga0373938_0018622 3300034957 Bacteria 1380
475 Ga0373949_0022467 3300035090 Bacteria 1455
476 Ga0373932_0011339 3300035112 Bacteria 2176
477 Ga0373931_0002637 3300035691 Bacteria 7981
478 Ga0373931_0007613 3300035691 Bacteria 5104
479 Ga0373935_0064741 3300035692 Bacteria 2345
480 Ga0373947_0010662 3300035725 Bacteria 5275
481 Ga0373925_0181342 3300037068 Bacteria 1667
482 Ga0395905_0043448 3300037471 Bacteria 4216
483 Ga0395905_0241555 3300037471 Bacteria 1688
484 Ga0451853_4096011 3300041512 Unclassified 941
485 Ga0450898_014706 3300042134 Bacteria 1319
486 Ga0453684_0001396 3300044712 Bacteria 69884
487 Ga0495592_0000598 3300046454 Bacteria 25428
488 Ga0495632_0019341 3300046519 Bacteria 3713
489 Ga0495666_0091366 3300046526 Bacteria 1436
490 Ga0495587_0230929 3300046536 Bacteria 1043
491 Ga0495597_0079098 3300046542 Bacteria 1408
492 Ga0495622_0030267 3300046557 Bacteria 2530
493 Ga0495625_0135229 3300046660 Bacteria 1667
494 Ga0495647_0144958 3300046681 Bacteria 1015
495 Ga0495658_0010003 3300046683 Bacteria 4735
496 Ga0495658_0043440 3300046683 Bacteria 2514
497 Ga0495658_0074685 3300046683 Bacteria 1976
498 Ga0495671_0099599 3300046692 Bacteria 1421
499 Ga0495581_0157421 3300047315 Bacteria 1328
500 Ga0495687_000327 3300047443 Bacteria 61677
501 Ga0495687_002550 3300047443 Bacteria 14412
502 Ga0495593_0231221 3300047673 Bacteria 927
503 Ga0496100_0641503 3300048903 Bacteria 826
504 Ga0496101_0006091 3300048904 Bacteria 7746
505 Ga0496102_0020228 3300048905 Bacteria 5880
506 Ga0496104_0018696 3300048907 Bacteria 6326
507 Ga0496106_0024169 3300048909 Bacteria 4516
508 Ga0496106_0032571 3300048909 Bacteria 3887
509 Ga0496107_0006693 3300048910 Bacteria 7935
510 Ga0496108_0014485 3300048911 Bacteria 6438
511 Ga0496108_0157721 3300048911 Bacteria 1960
512 Ga0496108_0210316 3300048911 Bacteria 1689
513 Ga0496110_0133269 3300048913 Bacteria 2244
514 Ga0496112_0411490 3300048915 Unclassified 1291
515 Ga0496113_0074071 3300048916 Bacteria 2595
516 Ga0496114_0032050 3300048917 Bacteria 4324
517 Ga0496114_0055412 3300048917 Bacteria 3307
518 Ga0496114_0117792 3300048917 Bacteria 2281
519 Ga0501032_0114883 3300049569 Bacteria 1780
520 Ga0501043_0000020 3300049579 Bacteria 155270
521 Ga0501046_0000039 3300049580 Bacteria 155237
522 Ga0501047_0000028 3300049581 Bacteria 220279
523 Ga0501048_0000484 3300049582 Bacteria 27870
524 Ga0501044_0259843 3300049823 Bacteria 1675
525 nmdc:mga00v17_16627_c1 3300050491 Bacteria 4148
526 nmdc:mga0k408_1196_c1 3300050493 Bacteria 14189
527 nmdc:mga0k408_124620_c1 3300050493 Bacteria 1528
528 nmdc:mga0k408_134796_c1 3300050493 Bacteria 1467
529 nmdc:mga0k408_14471_c1 3300050493 Bacteria 4349
530 nmdc:mga0k408_202234_c1 3300050493 Bacteria 1186
531 nmdc:mga0k408_212186_c1 3300050493 Bacteria 1156
532 nmdc:mga0k408_6184_c1 3300050493 Bacteria 6385
533 nmdc:mga06z11_145293_c1 3300050494 Bacteria 1344
534 nmdc:mga06z11_206210_c1 3300050494 Bacteria 1144
535 nmdc:mga04h51_8858_c1 3300050495 Bacteria 2706
536 nmdc:mga07m45_11268_c1 3300050496 Bacteria 4695
537 nmdc:mga07m45_147124_c1 3300050496 Bacteria 1366
538 nmdc:mga07m45_16300_c1 3300050496 Bacteria 3978
539 nmdc:mga07m45_6311_c1 3300050496 Bacteria 5988
540 nmdc:mga07m45_6440_c1 3300050496 Bacteria 5934
541 nmdc:mga08y16_519792_c1 3300050511 Bacteria 1207
542 nmdc:mga0rr50_274133_c1 3300050513 Bacteria 1406
543 Ga0495601_0031341 3300053077 Bacteria 3304
544 Ga0500651_0014705 3300053093 Bacteria 4792
545 Ga0500562_010630 3300053108 Bacteria 2334
546 Ga0500594_0000863 3300053118 Bacteria 6484
547 Ga0500614_004800 3300053123 Bacteria 2843
548 Ga0500621_018073 3300053126 Bacteria 2647
549 Ga0500658_0009261 3300053134 Bacteria 3632
550 Ga0500559_0000128 3300053136 Bacteria 58877
551 Ga0500564_091734 3300053138 Bacteria 1351
552 Ga0500568_0007996 3300053139 Bacteria 5135
553 Ga0500622_0000347 3300053156 Bacteria 45247
554 Ga0500636_0023269 3300053177 Bacteria 3663
555 Ga0500645_013242 3300053730 Bacteria 2652
556 Ga0500661_016511 3300055283 Bacteria 1320
557 2644302882 2643221654 Bacteria 5273570
558 Ga0500590_004096
559 Ga0070658_10224622
560 Ga0070658_10239839
561 Ga0070676_10004742
562 Ga0070676_10031370
563 Ga0070676_10046945
564 Ga0070676_10160869
565 Ga0070676_10168417
566 Ga0070683_100187183
567 Ga0070670_100009467
568 Ga0070670_100123178
569 Ga0070670_100677060
570 Ga0070677_10008151
571 Ga0070677_10012720
572 Ga0070677_10135989
573 Ga0068869_100012102
574 Ga0068869_100038473
575 Ga0068869_100512717
576 Ga0070666_10027964
577 Ga0070666_10102799
578 Ga0070666_10236858
579 Ga0068868_100010482
580 Ga0068868_100041976
581 Ga0068868_100053764
582 Ga0068868_100499972
583 Ga0070660_100029875
584 Ga0070660_100100889
585 Ga0070660_100206982
586 Ga0070661_100026590
587 Ga0070668_100002286
588 Ga0070669_100004329
589 Ga0070669_100013287
590 Ga0070669_100019885
591 Ga0070669_100070138
592 Ga0070669_100145833
593 Ga0070669_100283732
594 Ga0070675_100020639
595 Ga0070675_100022460
596 Ga0070675_100092027
597 Ga0070675_100229133
598 Ga0070675_100259284
599 Ga0070675_100387206
600 Ga0070671_100015423
601 Ga0070671_100034947
602 Ga0070671_100068272
603 Ga0070671_100081140
604 Ga0070671_100142100
605 Ga0070671_100154196
606 Ga0070674_100003956
607 Ga0070674_100011106
608 Ga0070674_100022271
609 Ga0070674_100374335
610 Ga0070673_100031212
611 Ga0070673_100033949
612 Ga0070673_100041159
613 Ga0070673_100140601
614 Ga0070673_100511454
615 Ga0070673_100621258
616 Ga0070659_100018068
617 Ga0070659_100142162
618 Ga0070659_100196882
619 Ga0070659_100528176
620 Ga0070667_100030705
621 Ga0070667_100070559
622 Ga0070667_100278833
623 Ga0070667_100716310
624 Ga0070700_100049251
625 Ga0070708_100119757
626 Ga0070663_100141138
627 Ga0070678_100035301
628 Ga0070678_100094262
629 Ga0070678_100205951
630 Ga0070678_100275488
631 Ga0070678_100343115
632 Ga0070678_100377436
633 Ga0070678_100450346
634 Ga0070678_100558842
635 Ga0070678_100598256
636 Ga0070678_100658261
637 Ga0070662_100006853
638 Ga0070662_100026489
639 Ga0070662_100065143
640 Ga0070662_100112770
641 Ga0070681_10179660
642 Ga0068867_100000143
643 Ga0068867_100002549
644 Ga0068867_100027058
645 Ga0068867_100033964
646 Ga0068867_100042310
647 Ga0068867_100053785
648 Ga0068867_100056950
649 Ga0068867_100517060
650 Ga0070706_100002337
651 Ga0068853_100035247
652 Ga0068853_100149149
653 Ga0068853_100152819
654 Ga0070672_100001628
655 Ga0070672_100007698
656 Ga0070672_100046689
657 Ga0070672_100078492
658 Ga0070672_100516371
659 Ga0070672_100709297
660 Ga0070672_100954875
661 Ga0070693_100006191
662 Ga0070665_100022990
663 Ga0070665_100239368
664 Ga0070665_100838293
665 Ga0070665_101028819
666 Ga0068855_100210773
667 Ga0068855_100294720
668 Ga0068855_100703255
669 Ga0070664_100052147
670 Ga0070664_100072261
671 Ga0070664_100174129
672 Ga0070664_100183596
673 Ga0070664_100199693
674 Ga0070664_101042184
675 Ga0068857_100082512
676 Ga0068857_100315680
677 Ga0068854_100026398
678 Ga0068854_100094770
679 Ga0068854_100133372
680 Ga0068854_100562574
681 Ga0068856_100142890
682 Ga0068856_100254529
683 Ga0070702_100010254
684 Ga0068852_100011067
685 Ga0068852_100018115
686 Ga0068852_100052327
687 Ga0068852_100067748
688 Ga0068852_100093994
689 Ga0068852_100410062
690 Ga0068852_100530281
691 Ga0068859_100106203
692 Ga0068859_100501602
693 Ga0068864_100009307
694 Ga0068864_100012670
695 Ga0068864_100069275
696 Ga0068864_100162208
697 Ga0068864_100626523
698 Ga0068866_10010719
699 Ga0068861_100002727
700 Ga0068861_100005959
701 Ga0068861_100013625
702 Ga0068861_100016292
703 Ga0068851_10004027
704 Ga0068851_10014133
705 Ga0068851_10110145
706 Ga0068863_100022612
707 Ga0068863_100029193
708 Ga0068863_100117680
709 Ga0068863_100248553
710 Ga0068863_100390369
711 Ga0068863_101429889
712 Ga0068858_100020970
713 Ga0068858_100070480
714 Ga0068858_100441630
715 Ga0068860_100021846
716 Ga0068860_100140723
717 Ga0068860_100219831
718 Ga0068860_100815346
719 Ga0068862_100033294
720 Ga0068862_100063925
721 Ga0075365_10479807
722 Ga0075368_10031057
723 Ga0075368_10040213
724 Ga0070715_10088587
725 Ga0075362_10093609
726 Ga0075369_10092982
727 Ga0075366_10011697
728 Ga0075366_10011871
729 Ga0075366_10016157
730 Ga0075366_10068017
731 Ga0097621_100069033
732 Ga0097621_100097174
733 Ga0097621_100233312
734 Ga0075370_10013458
735 Ga0075370_10019860
736 Ga0075370_10028094
737 Ga0075370_10134128
738 Ga0075370_10254759
739 Ga0068871_100011880
740 Ga0068871_100238784
741 Ga0068871_100245495
742 Ga0068871_100294597
743 Ga0068871_100317089
744 Ga0068871_100475065
745 Ga0068865_100070613
746 Ga0068865_100131526
747 Ga0097620_100106198
748 Ga0097620_100501623
749 Ga0111539_10302472
750 Ga0105245_10083263
751 Ga0105245_10313180
752 Ga0105245_10434748
753 Ga0105243_10006182
754 Ga0105243_10007512
755 Ga0105243_10061862
756 Ga0105243_10364676
757 Ga0105241_10098490
758 Ga0105248_10078444
759 Ga0105248_10083693
760 Ga0105248_10112479
761 Ga0105248_10152296
762 Ga0105248_10547898
763 Ga0105248_11992704
764 Ga0105237_10276682
765 Ga0105237_10303310
766 Ga0105238_10055748
767 Ga0105238_10061953
768 Ga0105238_10289715
769 Ga0105249_10071862
770 Ga0105239_10108628
771 Ga0157371_10105369
772 Ga0157371_10614682
773 Ga0157374_10053583
774 Ga0157374_10137458
775 Ga0157374_10401599
776 Ga0157378_10038865
777 Ga0157378_10133630
778 Ga0157378_10494304
779 Ga0163162_10009022
780 Ga0163162_10015696
781 Ga0163162_10117690
782 Ga0163162_10182505
783 Ga0157372_10157540
784 Ga0157375_10002731
785 Ga0157375_10012565
786 Ga0157375_10017680
787 Ga0157375_10054555
788 Ga0157375_10321165
789 Ga0157375_10399981
790 Ga0157375_10455479
791 Ga0157380_10006938
792 Ga0157380_10091723
793 Ga0157380_10114156
794 Ga0157380_10360685
795 Ga0157377_10001941
796 Ga0157377_10004640
797 Ga0157379_10013752
798 Ga0157379_10018648
799 Ga0157379_10344898
800 Ga0157379_10557550
801 Ga0157376_10015559
802 Ga0157376_10131126
803 Ga0157376_10556722
804 Ga0163161_10011365
805 Ga0163161_10014761
806 Ga0163161_10017782
807 Ga0163161_10093986
808 Ga0163161_10243252
809 Ga0207697_10020477
810 Ga0207656_10005115
811 Ga0207656_10039769
812 Ga0207656_10065791
813 Ga0207682_10012953
814 Ga0207682_10016177
815 Ga0207682_10071833
816 Ga0207682_10076283
817 Ga0207688_10213764
818 Ga0207680_10027508
819 Ga0207680_10034502
820 Ga0207680_10165824
821 Ga0207685_10289286
822 Ga0207645_10005795
823 Ga0207645_10014206
824 Ga0207645_10017939
825 Ga0207645_10100351
826 Ga0207645_10149722
827 Ga0207643_10040473
828 Ga0207705_10105644
829 Ga0207705_10167269
830 Ga0207705_10242367
831 Ga0207684_10018587
832 Ga0207707_10189567
833 Ga0207671_10164753
834 Ga0207671_10529875
835 Ga0207662_10001929
836 Ga0207657_10019063
837 Ga0207657_10044390
838 Ga0207649_10085455
839 Ga0207649_10241970
840 Ga0207649_10325778
841 Ga0207681_10000583
842 Ga0207681_10087457
843 Ga0207681_10121097
844 Ga0207681_10158019
845 Ga0207681_10286857
846 Ga0207694_10019273
847 Ga0207694_10231374
848 Ga0207694_10287891
849 Ga0207650_10000587
850 Ga0207650_10036194
851 Ga0207650_10037061
852 Ga0207650_10037848
853 Ga0207650_10094113
854 Ga0207650_10099786
855 Ga0207650_10901910
856 Ga0207659_10001367
857 Ga0207659_10011724
858 Ga0207659_10012462
859 Ga0207659_10098374
860 Ga0207659_10233280
861 Ga0207659_10297780
862 Ga0207659_10339080
863 Ga0207687_10018744
864 Ga0207687_10593722
865 Ga0207687_10914694
866 Ga0207644_10002900
867 Ga0207644_10056521
868 Ga0207644_10059232
869 Ga0207644_10068733
870 Ga0207644_10385157
871 Ga0207644_10442600
872 Ga0207690_10039585
873 Ga0207690_10215661
874 Ga0207706_10006738
875 Ga0207706_10036903
876 Ga0207706_10048625
877 Ga0207706_10123165
878 Ga0207706_10302885
879 Ga0207709_10003389
880 Ga0207669_10004393
881 Ga0207669_10043376
882 Ga0207704_10016061
883 Ga0207704_10036637
884 Ga0207691_10000964
885 Ga0207691_10015227
886 Ga0207691_10018195
887 Ga0207691_10039952
888 Ga0207691_10047197
889 Ga0207691_10068799
890 Ga0207691_10153647
891 Ga0207691_10652180
892 Ga0207711_10063890
893 Ga0207711_10087257
894 Ga0207711_10096234
895 Ga0207711_10278381
896 Ga0207689_10020128
897 Ga0207689_10021544
898 Ga0207689_10085868
899 Ga0207661_10053259
900 Ga0207679_10011260
901 Ga0207679_10103438
902 Ga0207679_10148618
903 Ga0207679_10278614
904 Ga0207667_10718305
905 Ga0207651_10009927
906 Ga0207651_10023330
907 Ga0207651_10629669
908 Ga0207651_10631445
909 Ga0207668_10070385
910 Ga0207668_10107965
911 Ga0207668_10668368
912 Ga0207640_10015613
913 Ga0207640_10070115
914 Ga0207640_10084056
915 Ga0207640_10111945
916 Ga0207640_10218854
917 Ga0207640_10351022
918 Ga0207640_10512248
919 Ga0207658_10027281
920 Ga0207677_10002663
921 Ga0207677_10127502
922 Ga0207703_10049768
923 Ga0207703_10123545
924 Ga0207639_10011871
925 Ga0207639_10042561
926 Ga0207639_10067205
927 Ga0207639_10387702
928 Ga0207678_10080502
929 Ga0207678_10107449
930 Ga0207678_10130842
931 Ga0207708_10021458
932 Ga0207708_10194747
933 Ga0207702_10076114
934 Ga0207702_10669900
935 Ga0207641_10016653
936 Ga0207641_10112058
937 Ga0207641_10185132
938 Ga0207641_10207482
939 Ga0207641_10438476
940 Ga0207641_10640306
941 Ga0207648_10000019
942 Ga0207648_10007408
943 Ga0207648_10008093
944 Ga0207648_10019916
945 Ga0207648_10027054
946 Ga0207648_10043090
947 Ga0207648_10227927
948 Ga0207648_10361441
949 Ga0207676_10007609
950 Ga0207676_10042158
951 Ga0207676_10075299
952 Ga0207676_10087715
953 Ga0207676_10379265
954 Ga0207676_10546760
955 Ga0207676_10576365
956 Ga0207674_10035255
957 Ga0207674_10058546
958 Ga0207674_10100727
959 Ga0207675_100007218
960 Ga0207675_100010715
961 Ga0207675_100072339
962 Ga0207675_100159631
963 Ga0207683_10108132
964 Ga0207683_10120231
965 Ga0207683_10171909
966 Ga0207683_10174449
967 Ga0207683_10250032
968 Ga0207683_10342922
969 Ga0207683_10409575
970 Ga0207683_10456450
971 Ga0207698_10004559
972 Ga0207698_10012475
973 Ga0207698_10035049
974 Ga0207698_10051144
975 Ga0207698_10069305
976 Ga0207698_10480103
977 Ga0207698_10690982
978 Ga0268266_10018663
979 Ga0268266_10121307
980 Ga0268265_10033811
981 Ga0268265_10367567
982 Ga0268265_10489810
983 Ga0268264_10003212
984 Ga0268264_10204379
985 Ga0268264_10236823
986 Ga0268264_10616003
987 Ga0307517_10000174
988 Ga0307517_10132152
989 Ga0307515_10012282
990 Ga0307515_10018182
991 Ga0307515_10215796
992 Ga0307515_10315798
993 Ga0307512_10020173
994 Ga0307512_10073967
995 Ga0307512_10111813
996 Ga0307513_10002929
997 Ga0307513_10070101
998 Ga0307513_10130219
999 Ga0307513_10369023
1000 Ga0307509_10000225
1001 Ga0307509_10017007
1002 Ga0307509_10085561
1003 Ga0307509_10472568
1004 Ga0307508_10003326
1005 Ga0307508_10005362
1006 Ga0307508_10026639
1007 Ga0307508_10175830
1008 Ga0307508_10244087
1009 Ga0307514_10057358
1010 Ga0307514_10078539
1011 Ga0307514_10225340
1012 Ga0307516_10238905
1013 Ga0307516_10296047
1014 Ga0307405_10020196
1015 Ga0307405_10029059
1016 Ga0307413_10022833
1017 Ga0307410_10000484
1018 Ga0307406_10003564
1019 Ga0307406_10164979
1020 Ga0307407_10282424
1021 Ga0307412_10026739
1022 Ga0307409_100006477
1023 Ga0307409_100011627
1024 Ga0307416_100165332
1025 Ga0307414_10018402
1026 Ga0307415_100276580
1027 Ga0307510_10014261
1028 Ga0307510_10142881
1029 Ga0307510_10350836
1030 Ga0373938_0012171
1031 Ga0373938_0018622
1032 Ga0373949_0022467
1033 Ga0373932_0011339
1034 Ga0373931_0002637
1035 Ga0373931_0007613
1036 Ga0373935_0064741
1037 Ga0373947_0010662
1038 Ga0373925_0181342
1039 Ga0395905_0043448
1040 Ga0395905_0241555
1041 Ga0451853_4096011
1042 Ga0450898_014706
1043 Ga0453684_0001396
1044 Ga0495592_0000598
1045 Ga0495632_0019341
1046 Ga0495666_0091366
1047 Ga0495587_0230929
1048 Ga0495597_0079098
1049 Ga0495622_0030267
1050 Ga0495625_0135229
1051 Ga0495647_0144958
1052 Ga0495658_0010003
1053 Ga0495658_0043440
1054 Ga0495658_0074685
1055 Ga0495671_0099599
1056 Ga0495581_0157421
1057 Ga0495687_000327
1058 Ga0495687_002550
1059 Ga0495593_0231221
1060 Ga0496100_0641503
1061 Ga0496101_0006091
1062 Ga0496102_0020228
1063 Ga0496104_0018696
1064 Ga0496106_0024169
1065 Ga0496106_0032571
1066 Ga0496107_0006693
1067 Ga0496108_0014485
1068 Ga0496108_0157721
1069 Ga0496108_0210316
1070 Ga0496110_0133269
1071 Ga0496112_0411490
1072 Ga0496113_0074071
1073 Ga0496114_0032050
1074 Ga0496114_0055412
1075 Ga0496114_0117792
1076 Ga0501032_0114883
1077 Ga0501043_0000020
1078 Ga0501046_0000039
1079 Ga0501047_0000028
1080 Ga0501048_0000484
1081 Ga0501044_0259843
1082 nmdc:mga00v17_16627_c1
1083 nmdc:mga0k408_1196_c1
1084 nmdc:mga0k408_124620_c1
1085 nmdc:mga0k408_134796_c1
1086 nmdc:mga0k408_14471_c1
1087 nmdc:mga0k408_202234_c1
1088 nmdc:mga0k408_212186_c1
1089 nmdc:mga0k408_6184_c1
1090 nmdc:mga06z11_145293_c1
1091 nmdc:mga06z11_206210_c1
1092 nmdc:mga04h51_8858_c1
1093 nmdc:mga07m45_11268_c1
1094 nmdc:mga07m45_147124_c1
1095 nmdc:mga07m45_16300_c1
1096 nmdc:mga07m45_6311_c1
1097 nmdc:mga07m45_6440_c1
1098 nmdc:mga08y16_519792_c1
1099 nmdc:mga0rr50_274133_c1
1100 Ga0495601_0031341
1101 Ga0500651_0014705
1102 Ga0500562_010630
1103 Ga0500594_0000863
1104 Ga0500614_004800
1105 Ga0500621_018073
1106 Ga0500658_0009261
1107 Ga0500559_0000128
1108 Ga0500564_091734
1109 Ga0500568_0007996
1110 Ga0500622_0000347
1111 Ga0500636_0023269
1112 Ga0500645_013242
1113 Ga0500661_016511
1114 2644302882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03872

RseA_N

Anti sigma-E protein RseA, N-terminal domain

14

110

0.9

Map