F463375

General Info

Members Datasets Scaffolds Average Seq Length
557 276 1114 158

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_1283715|Ga0501084_1283715_34_525
Length 163
Sequence MTEYSFLTTWCLAAHRERVWDAIWESERWPEWWRGMVGSRRLVDGDETGVGQVGRYTWRSRLPYTLDFEMTTTRVDKPHLLEGHAVGELDGTGRWRLFEEGAAAGDGPLTVVVYEWNVRTTKPWMNLLAPIARPAFEWNHDWVMRRGGEGIARLLGCRLLAID

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
136 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
139 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
272 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
273 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
274 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 11.85
Rhizosphere 82.41
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_1283715 3300054114 Unclassified 614
2 JGI24746J21847_1000380 3300001977 Bacteria 6533
3 JGI24748J21848_1000396 3300002074 Bacteria 4941
4 JGI24034J26672_10000160 3300002239 Bacteria 9507
5 JGI24742J22300_10009641 3300002244 Bacteria 1594
6 Ga0070683_100010098 3300005329 Bacteria 8100
7 Ga0070683_100011494 3300005329 Bacteria 7656
8 Ga0070683_100016073 3300005329 Bacteria 6587
9 Ga0070683_100027424 3300005329 Bacteria 5137
10 Ga0070683_100098772 3300005329 Bacteria 2747
11 Ga0070683_100347727 3300005329 Bacteria 1412
12 Ga0070670_100226127 3300005331 Bacteria 1628
13 Ga0070677_10000075 3300005333 Bacteria 31359
14 Ga0070682_100539397 3300005337 Bacteria 911
15 Ga0068868_100003875 3300005338 Bacteria 10443
16 Ga0070689_100305118 3300005340 Bacteria 1326
17 Ga0070661_100000524 3300005344 Bacteria 29415
18 Ga0070692_10117953 3300005345 Bacteria 1476
19 Ga0070668_100042034 3300005347 Bacteria 3503
20 Ga0070668_100305930 3300005347 Bacteria 1334
21 Ga0070668_100455260 3300005347 Bacteria 1101
22 Ga0070675_100000008 3300005354 Bacteria 250004
23 Ga0070671_101256541 3300005355 Unclassified 652
24 Ga0070674_100000047 3300005356 Bacteria 52597
25 Ga0070674_100000105 3300005356 Bacteria 39263
26 Ga0070673_100115152 3300005364 Bacteria 2235
27 Ga0070688_100000151 3300005365 Bacteria 37674
28 Ga0070688_100043464 3300005365 Bacteria 2768
29 Ga0070659_100092521 3300005366 Bacteria 2425
30 Ga0070659_100822131 3300005366 Bacteria 809
31 Ga0070667_100002491 3300005367 Bacteria 16067
32 Ga0070667_100022130 3300005367 Bacteria 5273
33 Ga0070667_100459792 3300005367 Bacteria 1164
34 Ga0070714_100025876 3300005435 Bacteria 4846
35 Ga0070713_100001587 3300005436 Bacteria 14561
36 Ga0070711_100010236 3300005439 Bacteria 5798
37 Ga0070711_100035451 3300005439 Bacteria 3336
38 Ga0070663_100009347 3300005455 Bacteria 6067
39 Ga0070663_100846578 3300005455 Bacteria 787
40 Ga0070678_100013711 3300005456 Bacteria 5092
41 Ga0070678_100198218 3300005456 Bacteria 1655
42 Ga0070681_10064130 3300005458 Bacteria 3645
43 Ga0070685_10000092 3300005466 Bacteria 55484
44 Ga0070685_10002231 3300005466 Bacteria 10002
45 Ga0070679_100000804 3300005530 Bacteria 27213
46 Ga0070679_100020824 3300005530 Bacteria 6397
47 Ga0070684_100062642 3300005535 Bacteria 3258
48 Ga0070684_100146206 3300005535 Bacteria 2140
49 Ga0070684_100476029 3300005535 Bacteria 1155
50 Ga0070684_101453701 3300005535 Unclassified 646
51 Ga0068853_100014352 3300005539 Bacteria 6486
52 Ga0068853_100232363 3300005539 Bacteria 1687
53 Ga0068853_100376159 3300005539 Bacteria 1326
54 Ga0070672_100001255 3300005543 Bacteria 15606
55 Ga0070686_100296421 3300005544 Bacteria 1198
56 Ga0070693_100002159 3300005547 Bacteria 9022
57 Ga0070665_100000128 3300005548 Bacteria 142568
58 Ga0070665_100002491 3300005548 Bacteria 20261
59 Ga0070665_100157060 3300005548 Bacteria 2276
60 Ga0070665_100225941 3300005548 Bacteria 1872
61 Ga0070665_100420946 3300005548 Bacteria 1344
62 Ga0070665_100603457 3300005548 Bacteria 1111
63 Ga0070704_100368844 3300005549 Bacteria 1217
64 Ga0070704_101014756 3300005549 Bacteria 751
65 Ga0068855_100145972 3300005563 Bacteria 2693
66 Ga0068855_100434410 3300005563 Bacteria 1435
67 Ga0070664_100094706 3300005564 Bacteria 2590
68 Ga0070664_100115747 3300005564 Bacteria 2344
69 Ga0068854_100000123 3300005578 Bacteria 53446
70 Ga0068856_100019149 3300005614 Bacteria 6644
71 Ga0068856_100206002 3300005614 Bacteria 1981
72 Ga0068856_100315286 3300005614 Bacteria 1581
73 Ga0068856_100851730 3300005614 Bacteria 931
74 Ga0068856_101621381 3300005614 Bacteria 660
75 Ga0068852_100000050 3300005616 Bacteria 84306
76 Ga0068852_100787226 3300005616 Bacteria 965
77 Ga0068866_10000006 3300005718 Bacteria 176129
78 Ga0068866_10000124 3300005718 Bacteria 33822
79 Ga0068866_10361900 3300005718 Bacteria 925
80 Ga0068851_10001237 3300005834 Bacteria 11090
81 Ga0068863_100000039 3300005841 Bacteria 161450
82 Ga0068863_100003181 3300005841 Bacteria 16230
83 Ga0068858_100000354 3300005842 Bacteria 48397
84 Ga0068858_100001452 3300005842 Bacteria 24367
85 Ga0068858_100233866 3300005842 Bacteria 1742
86 Ga0068858_100452807 3300005842 Bacteria 1237
87 Ga0068858_101140294 3300005842 Bacteria 766
88 Ga0068862_100013835 3300005844 Bacteria 6688
89 Ga0081455_10052747 3300005937 Bacteria 3479
90 Ga0075365_10266720 3300006038 Bacteria 1204
91 Ga0070715_10000003 3300006163 Bacteria 345282
92 Ga0070716_100182683 3300006173 Bacteria 1378
93 Ga0070712_100019703 3300006175 Bacteria 4405
94 Ga0070712_100544160 3300006175 Bacteria 978
95 Ga0097621_101284342 3300006237 Bacteria 691
96 Ga0075431_100011442 3300006847 Bacteria 8942
97 Ga0075433_10000875 3300006852 Bacteria 21136
98 Ga0075434_100024738 3300006871 Bacteria 5873
99 Ga0075436_100560786 3300006914 Bacteria 839
100 Ga0075436_100655048 3300006914 Bacteria 776
101 Ga0075435_100202618 3300007076 Bacteria 1682
102 Ga0105240_10339563 3300009093 Bacteria 1707
103 Ga0105240_10852643 3300009093 Bacteria 983
104 Ga0111539_10067976 3300009094 Bacteria 4207
105 Ga0105245_10000012 3300009098 Bacteria 267151
106 Ga0105245_10000067 3300009098 Bacteria 107929
107 Ga0105245_10000246 3300009098 Bacteria 51410
108 Ga0105245_10009989 3300009098 Bacteria 8264
109 Ga0105245_11798275 3300009098 Bacteria 665
110 Ga0105247_10197438 3300009101 Bacteria 1350
111 Ga0114129_10059127 3300009147 Bacteria 5359
112 Ga0105243_10009568 3300009148 Bacteria 7379
113 Ga0105243_10091763 3300009148 Bacteria 2502
114 Ga0105241_10248208 3300009174 Bacteria 1508
115 Ga0105241_10256321 3300009174 Bacteria 1485
116 Ga0105242_10000010 3300009176 Bacteria 151649
117 Ga0105242_10149891 3300009176 Bacteria 2033
118 Ga0105248_10000307 3300009177 Bacteria 58221
119 Ga0105248_10260295 3300009177 Bacteria 1953
120 Ga0105248_12421266 3300009177 Unclassified 598
121 Ga0105237_10169985 3300009545 Bacteria 2179
122 Ga0105238_10000014 3300009551 Bacteria 241954
123 Ga0105238_11487729 3300009551 Unclassified 706
124 Ga0105249_10000159 3300009553 Bacteria 82172
125 Ga0105249_10070387 3300009553 Bacteria 3229
126 Ga0099796_10357347 3300010159 Bacteria 631
127 Ga0105239_10232460 3300010375 Bacteria 2068
128 Ga0157371_10002341 3300013102 Bacteria 18157
129 Ga0157370_10040358 3300013104 Bacteria 4506
130 Ga0157370_10316975 3300013104 Bacteria 1439
131 Ga0157369_10000222 3300013105 Bacteria 78413
132 Ga0157374_10000281 3300013296 Bacteria 46977
133 Ga0157374_11406981 3300013296 Bacteria 720
134 Ga0157378_10009857 3300013297 Bacteria 8326
135 Ga0163162_10139140 3300013306 Bacteria 2540
136 Ga0163162_10641534 3300013306 Bacteria 1186
137 Ga0157372_10006714 3300013307 Bacteria 12237
138 Ga0157375_10000095 3300013308 Bacteria 88952
139 Ga0157375_10035586 3300013308 Bacteria 4754
140 Ga0157375_10071355 3300013308 Bacteria 3486
141 Ga0157375_11835863 3300013308 Bacteria 719
142 Ga0157375_11902153 3300013308 Bacteria 706
143 Ga0163163_10758016 3300014325 Bacteria 1034
144 Ga0163163_11356208 3300014325 Unclassified 773
145 Ga0163163_11456178 3300014325 Bacteria 746
146 Ga0157380_10000594 3300014326 Bacteria 22281
147 Ga0157380_12078593 3300014326 Unclassified 631
148 Ga0157377_10334854 3300014745 Bacteria 1010
149 Ga0157379_10013677 3300014968 Bacteria 7111
150 Ga0157379_10165185 3300014968 Bacteria 1998
151 Ga0157376_10202790 3300014969 Bacteria 1826
152 Ga0157376_10259601 3300014969 Bacteria 1627
153 Ga0157376_10544287 3300014969 Bacteria 1148
154 Ga0163161_10000140 3300017792 Bacteria 66684
155 Ga0163161_10072390 3300017792 Bacteria 2523
156 Ga0206356_11783605 3300020070 Bacteria 1631
157 Ga0206353_10708015 3300020082 Bacteria 1610
158 Ga0207682_10000217 3300025893 Bacteria 25947
159 Ga0207642_10000001 3300025899 Bacteria 714030
160 Ga0207642_10000003 3300025899 Bacteria 650651
161 Ga0207642_10000004 3300025899 Bacteria 407822
162 Ga0207642_10000152 3300025899 Bacteria 19609
163 Ga0207642_10262102 3300025899 Bacteria 986
164 Ga0207642_10407673 3300025899 Bacteria 815
165 Ga0207710_10181282 3300025900 Bacteria 1033
166 Ga0207680_10055188 3300025903 Bacteria 2393
167 Ga0207685_10000003 3300025905 Bacteria 344527
168 Ga0207705_10102922 3300025909 Bacteria 2103
169 Ga0207654_10106448 3300025911 Bacteria 1737
170 Ga0207707_10098235 3300025912 Bacteria 2559
171 Ga0207693_10023691 3300025915 Bacteria 4871
172 Ga0207693_10772702 3300025915 Bacteria 741
173 Ga0207663_10005102 3300025916 Bacteria 6597
174 Ga0207663_10149444 3300025916 Bacteria 1637
175 Ga0207657_10875486 3300025919 Bacteria 692
176 Ga0207649_10000610 3300025920 Bacteria 24162
177 Ga0207652_10000119 3300025921 Bacteria 86757
178 Ga0207652_10000332 3300025921 Bacteria 49012
179 Ga0207694_10000008 3300025924 Bacteria 484902
180 Ga0207650_10448111 3300025925 Bacteria 1074
181 Ga0207659_10000049 3300025926 Bacteria 82923
182 Ga0207687_10000011 3300025927 Bacteria 388349
183 Ga0207687_10000012 3300025927 Bacteria 370729
184 Ga0207687_10000503 3300025927 Bacteria 26341
185 Ga0207687_10004483 3300025927 Bacteria 9293
186 Ga0207700_10000016 3300025928 Bacteria 202434
187 Ga0207664_10012655 3300025929 Bacteria 6036
188 Ga0207690_10002643 3300025932 Bacteria 10792
189 Ga0207690_10062808 3300025932 Bacteria 2530
190 Ga0207690_10561362 3300025932 Bacteria 929
191 Ga0207686_10000227 3300025934 Bacteria 42647
192 Ga0207686_10043634 3300025934 Bacteria 2749
193 Ga0207709_10030724 3300025935 Bacteria 3128
194 Ga0207709_10078365 3300025935 Bacteria 2121
195 Ga0207670_10490313 3300025936 Bacteria 996
196 Ga0207670_10969441 3300025936 Bacteria 714
197 Ga0207669_10000002 3300025937 Bacteria 377651
198 Ga0207669_10000765 3300025937 Bacteria 13768
199 Ga0207665_10116043 3300025939 Bacteria 1887
200 Ga0207691_10001495 3300025940 Bacteria 23287
201 Ga0207711_10000024 3300025941 Bacteria 293596
202 Ga0207661_10001860 3300025944 Bacteria 14445
203 Ga0207661_10009394 3300025944 Bacteria 7012
204 Ga0207661_10037300 3300025944 Bacteria 3800
205 Ga0207661_10082420 3300025944 Bacteria 2659
206 Ga0207661_10230695 3300025944 Bacteria 1639
207 Ga0207661_10772679 3300025944 Bacteria 884
208 Ga0207679_10078469 3300025945 Bacteria 2515
209 Ga0207679_10134505 3300025945 Bacteria 1989
210 Ga0207712_10000003 3300025961 Bacteria 615314
211 Ga0207712_10003211 3300025961 Bacteria 10389
212 Ga0207712_10402858 3300025961 Bacteria 1150
213 Ga0207668_10007500 3300025972 Bacteria 6489
214 Ga0207668_10143184 3300025972 Bacteria 1841
215 Ga0207668_10278908 3300025972 Bacteria 1370
216 Ga0207668_10503023 3300025972 Bacteria 1043
217 Ga0207640_10000040 3300025981 Bacteria 106134
218 Ga0207640_10045984 3300025981 Bacteria 2806
219 Ga0207658_10000871 3300025986 Bacteria 25155
220 Ga0207658_10014542 3300025986 Bacteria 5389
221 Ga0207658_10724983 3300025986 Bacteria 899
222 Ga0207677_10000787 3300026023 Bacteria 18192
223 Ga0207677_10002766 3300026023 Bacteria 9266
224 Ga0207703_10000028 3300026035 Bacteria 208682
225 Ga0207703_10000185 3300026035 Bacteria 72988
226 Ga0207703_10438661 3300026035 Bacteria 1218
227 Ga0207639_10009852 3300026041 Bacteria 6599
228 Ga0207639_10265008 3300026041 Bacteria 1505
229 Ga0207639_10351258 3300026041 Bacteria 1317
230 Ga0207639_10361023 3300026041 Bacteria 1300
231 Ga0207678_10000953 3300026067 Bacteria 26430
232 Ga0207678_10848147 3300026067 Bacteria 807
233 Ga0207708_10765206 3300026075 Bacteria 829
234 Ga0207708_10960104 3300026075 Bacteria 742
235 Ga0207702_10001168 3300026078 Bacteria 26815
236 Ga0207702_10008030 3300026078 Bacteria 8929
237 Ga0207702_10040826 3300026078 Bacteria 3890
238 Ga0207702_10722281 3300026078 Bacteria 982
239 Ga0207702_11632617 3300026078 Bacteria 638
240 Ga0207641_10000072 3300026088 Bacteria 151067
241 Ga0207674_10162179 3300026116 Bacteria 2190
242 Ga0207683_10155832 3300026121 Bacteria 2063
243 Ga0207683_10348842 3300026121 Bacteria 1358
244 Ga0207683_10370228 3300026121 Bacteria 1316
245 Ga0207698_10000009 3300026142 Bacteria 281300
246 Ga0207698_10608688 3300026142 Bacteria 1078
247 Ga0207428_10062230 3300027907 Bacteria 2952
248 Ga0268266_10000023 3300028379 Bacteria 501899
249 Ga0268266_10001616 3300028379 Bacteria 26283
250 Ga0268266_10001763 3300028379 Bacteria 24641
251 Ga0268266_10225668 3300028379 Bacteria 1723
252 Ga0268266_10439078 3300028379 Bacteria 1239
253 Ga0268265_10008225 3300028380 Bacteria 7046
254 Ga0268264_10264461 3300028381 Bacteria 1604
255 Ga0265337_1000041 3300028556 Bacteria 56264
256 Ga0265326_10000015 3300028558 Bacteria 159279
257 Ga0265319_1063361 3300028563 Bacteria 1196
258 Ga0265323_10079655 3300028653 Bacteria 1108
259 Ga0265322_10000003 3300028654 Bacteria 468671
260 Ga0265336_10005910 3300028666 Bacteria 4465
261 Ga0265324_10000907 3300029957 Bacteria 18733
262 Ga0265332_10126602 3300031238 Bacteria 1072
263 Ga0265328_10001369 3300031239 Bacteria 11243
264 Ga0265320_10000001 3300031240 Bacteria 847191
265 Ga0265339_10017679 3300031249 Bacteria 4218
266 Ga0265331_10009641 3300031250 Bacteria 5405
267 Ga0265327_10000003 3300031251 Bacteria 852750
268 Ga0265316_10024452 3300031344 Bacteria 5062
269 Ga0265314_10020220 3300031711 Bacteria 5141
270 Ga0307415_100093025 3300032126 Bacteria 2188
271 Ga0373937_0023647 3300036401 Bacteria 5537
272 Ga0373937_0070670 3300036401 Bacteria 3220
273 Ga0395901_0848828 3300038443 Bacteria 899
274 Ga0395901_1919451 3300038443 Unclassified 539
275 Ga0451802_0438050 3300041460 Bacteria 984
276 Ga0451807_1796160 3300041486 Bacteria 596
277 Ga0451807_2307049 3300041486 Unclassified 1140
278 Ga0451833_0634948 3300041491 Bacteria 1724
279 Ga0451839_0844376 3300041496 Bacteria 957
280 Ga0451853_3731523 3300041512 Bacteria 4069
281 Ga0466963_0000002 3300044694 Bacteria 108477
282 Ga0466957_0016522 3300044842 Bacteria 4316
283 Ga0466957_0155944 3300044842 Bacteria 1480
284 Ga0466958_0021909 3300045836 Bacteria 3737
285 Ga0466967_0000020 3300045976 Bacteria 78851
286 Ga0495592_0000999 3300046454 Bacteria 19653
287 Ga0495592_0387725 3300046454 Bacteria 888
288 Ga0495603_0000057 3300046455 Bacteria 48728
289 Ga0495603_0002491 3300046455 Bacteria 10836
290 Ga0495603_0003192 3300046455 Bacteria 9755
291 Ga0495629_0000028 3300046459 Bacteria 127409
292 Ga0495629_0004331 3300046459 Bacteria 10642
293 Ga0495629_0389110 3300046459 Bacteria 948
294 Ga0495629_0463522 3300046459 Bacteria 857
295 Ga0495641_0001934 3300046461 Bacteria 16875
296 Ga0495641_0067435 3300046461 Bacteria 1609
297 Ga0495651_0146464 3300046462 Bacteria 1707
298 Ga0495653_0096141 3300046463 Bacteria 2154
299 Ga0495653_0186428 3300046463 Bacteria 1419
300 Ga0495653_0223183 3300046463 Bacteria 1266
301 Ga0495582_0000048 3300046473 Bacteria 60887
302 Ga0495662_0000659 3300046476 Bacteria 16224
303 Ga0495662_0018027 3300046476 Bacteria 3415
304 Ga0495662_0053835 3300046476 Bacteria 1943
305 Ga0495664_0343379 3300046477 Bacteria 899
306 Ga0495606_0000294 3300046507 Bacteria 85998
307 Ga0495608_0000001 3300046511 Bacteria 411278
308 Ga0495608_0004024 3300046511 Bacteria 10551
309 Ga0495608_0119306 3300046511 Bacteria 1692
310 Ga0495628_0001728 3300046516 Bacteria 19872
311 Ga0495628_0011273 3300046516 Bacteria 7562
312 Ga0495628_0011510 3300046516 Bacteria 7479
313 Ga0495628_0232549 3300046516 Bacteria 1381
314 Ga0495628_0673367 3300046516 Unclassified 733
315 Ga0495630_0000165 3300046517 Bacteria 51355
316 Ga0495630_0037128 3300046517 Bacteria 3642
317 Ga0495630_0485403 3300046517 Bacteria 947
318 Ga0495637_0262121 3300046520 Unclassified 620
319 Ga0495644_0001304 3300046523 Bacteria 10235
320 Ga0495652_0047825 3300046529 Bacteria 3668
321 Ga0495652_0131103 3300046529 Bacteria 1984
322 Ga0495640_0040475 3300046533 Bacteria 3264
323 Ga0495640_0050074 3300046533 Bacteria 2879
324 Ga0495586_0032837 3300046535 Bacteria 2783
325 Ga0495587_0003143 3300046536 Bacteria 11040
326 Ga0495645_0001401 3300046543 Bacteria 16267
327 Ga0495645_0017457 3300046543 Bacteria 5141
328 Ga0495667_0000057 3300046559 Bacteria 100656
329 Ga0495667_0289804 3300046559 Bacteria 1038
330 Ga0495668_0277651 3300046616 Bacteria 918
331 Ga0495634_0000555 3300046642 Bacteria 36577
332 Ga0495634_0013405 3300046642 Bacteria 5922
333 Ga0495634_0055729 3300046642 Bacteria 2643
334 Ga0495588_0000195 3300046674 Bacteria 64337
335 Ga0495657_0000002 3300046675 Bacteria 411958
336 Ga0495657_0079405 3300046675 Bacteria 2125
337 Ga0495657_0096415 3300046675 Bacteria 1890
338 Ga0495599_0008656 3300046678 Bacteria 6192
339 Ga0495623_0208494 3300046679 Bacteria 1120
340 Ga0495623_0528165 3300046679 Unclassified 620
341 Ga0495623_0570039 3300046679 Unclassified 591
342 Ga0495647_0000020 3300046681 Bacteria 77355
343 Ga0495647_0002424 3300046681 Bacteria 5870
344 Ga0495647_0003249 3300046681 Bacteria 5202
345 Ga0495658_0000031 3300046683 Bacteria 71165
346 Ga0495669_0000064 3300046684 Bacteria 70549
347 Ga0495669_0186990 3300046684 Bacteria 988
348 Ga0495669_0210253 3300046684 Bacteria 931
349 Ga0495613_0000003 3300046689 Bacteria 248826
350 Ga0495613_0000500 3300046689 Bacteria 33170
351 Ga0495613_0185425 3300046689 Bacteria 1472
352 Ga0495624_0000087 3300046690 Bacteria 61504
353 Ga0495624_0000652 3300046690 Bacteria 27147
354 Ga0495671_0251249 3300046692 Bacteria 853
355 Ga0495649_0008654 3300046694 Bacteria 6111
356 Ga0495600_0020410 3300046809 Bacteria 4238
357 Ga0495600_0036363 3300046809 Bacteria 3200
358 Ga0495600_0067052 3300046809 Bacteria 2346
359 Ga0495600_0150174 3300046809 Bacteria 1509
360 Ga0495604_0001970 3300047317 Bacteria 16586
361 Ga0495604_0002487 3300047317 Bacteria 14713
362 Ga0495604_0148075 3300047317 Bacteria 1671
363 Ga0495674_0000007 3300047319 Bacteria 336257
364 Ga0495672_0024890 3300047320 Bacteria 3846
365 Ga0495676_0000263 3300047321 Bacteria 42431
366 Ga0495676_0005813 3300047321 Bacteria 11317
367 Ga0495676_0067438 3300047321 Bacteria 2768
368 Ga0495676_0121108 3300047321 Bacteria 1903
369 Ga0495676_0240941 3300047321 Bacteria 1238
370 Ga0495680_0005894 3300047322 Bacteria 11462
371 Ga0495680_0017444 3300047322 Bacteria 6131
372 Ga0495680_0017984 3300047322 Bacteria 6014
373 Ga0495680_0363471 3300047322 Bacteria 1005
374 Ga0495675_0000696 3300047444 Bacteria 21058
375 Ga0495686_0059362 3300047472 Bacteria 2381
376 Ga0495593_0374673 3300047673 Unclassified 711
377 Ga0495602_0002467 3300048088 Bacteria 18845
378 Ga0495602_0007803 3300048088 Bacteria 11187
379 Ga0495602_0057467 3300048088 Bacteria 3412
380 Ga0495602_0166800 3300048088 Bacteria 1713
381 Ga0495602_0541469 3300048088 Bacteria 808
382 Ga0495602_0878383 3300048088 Unclassified 598
383 Ga0496100_0000004 3300048903 Bacteria 321778
384 Ga0496100_0000032 3300048903 Bacteria 99877
385 Ga0496101_0000007 3300048904 Bacteria 321778
386 Ga0496101_0000012 3300048904 Bacteria 268127
387 Ga0496101_0851716 3300048904 Bacteria 718
388 Ga0496102_0000021 3300048905 Bacteria 246920
389 Ga0496102_0182497 3300048905 Bacteria 1977
390 Ga0496103_0000001 3300048906 Bacteria 643471
391 Ga0496103_0276652 3300048906 Bacteria 1080
392 Ga0496103_0422725 3300048906 Archaea 855
393 Ga0496104_0000002 3300048907 Bacteria 686017
394 Ga0496104_0000003 3300048907 Bacteria 669219
395 Ga0496104_0002073 3300048907 Bacteria 17411
396 Ga0496104_0038835 3300048907 Bacteria 4456
397 Ga0496104_0092123 3300048907 Bacteria 2898
398 Ga0496105_0000001 3300048908 Bacteria 1328178
399 Ga0496105_0000003 3300048908 Bacteria 713251
400 Ga0496105_0009688 3300048908 Bacteria 7541
401 Ga0496105_0066404 3300048908 Bacteria 2978
402 Ga0496105_0098035 3300048908 Bacteria 2421
403 Ga0496106_0000004 3300048909 Bacteria 279896
404 Ga0496106_0000096 3300048909 Bacteria 67122
405 Ga0496106_0000470 3300048909 Bacteria 28737
406 Ga0496107_0000001 3300048910 Bacteria 321778
407 Ga0496107_0000031 3300048910 Bacteria 100522
408 Ga0496107_0854378 3300048910 Unclassified 665
409 Ga0496108_0000002 3300048911 Bacteria 700890
410 Ga0496108_0000012 3300048911 Bacteria 258433
411 Ga0496108_0004840 3300048911 Bacteria 10866
412 Ga0496108_0014174 3300048911 Bacteria 6504
413 Ga0496108_0353449 3300048911 Bacteria 1282
414 Ga0496109_0000001 3300048912 Bacteria 700852
415 Ga0496109_0000106 3300048912 Bacteria 86550
416 Ga0496109_0003327 3300048912 Bacteria 13446
417 Ga0496109_0321988 3300048912 Bacteria 1459
418 Ga0496109_0359242 3300048912 Bacteria 1376
419 Ga0496109_0804154 3300048912 Bacteria 878
420 Ga0496109_1010087 3300048912 Bacteria 769
421 Ga0496110_0014901 3300048913 Bacteria 6461
422 Ga0496110_0029771 3300048913 Bacteria 4703
423 Ga0496110_0103834 3300048913 Bacteria 2549
424 Ga0496110_0112254 3300048913 Bacteria 2450
425 Ga0496110_1434511 3300048913 Bacteria 600
426 Ga0496111_0000001 3300048914 Bacteria 194837
427 Ga0496111_0036458 3300048914 Bacteria 3516
428 Ga0496111_0683239 3300048914 Bacteria 747
429 Ga0496112_0000002 3300048915 Bacteria 782039
430 Ga0496112_0000762 3300048915 Bacteria 22616
431 Ga0496112_0157492 3300048915 Bacteria 2238
432 Ga0496112_1316127 3300048915 Bacteria 638
433 Ga0496113_0000317 3300048916 Bacteria 22880
434 Ga0496113_0032061 3300048916 Bacteria 3817
435 Ga0496113_0170718 3300048916 Bacteria 1722
436 Ga0496113_0430122 3300048916 Bacteria 1060
437 Ga0496113_0727332 3300048916 Bacteria 791
438 Ga0496114_0000080 3300048917 Bacteria 68701
439 Ga0496114_0074984 3300048917 Bacteria 2849
440 Ga0496114_0267643 3300048917 Bacteria 1505
441 Ga0496114_0593221 3300048917 Bacteria 977
442 Ga0496115_0000004 3300048918 Bacteria 319734
443 Ga0496115_0000104 3300048918 Bacteria 79824
444 Ga0496115_0108391 3300048918 Bacteria 2280
445 Ga0496115_0491423 3300048918 Bacteria 987
446 Ga0496116_0000500 3300048919 Bacteria 53809
447 Ga0496117_0058517 3300048920 Bacteria 2668
448 Ga0496117_0454479 3300048920 Unclassified 632
449 Ga0496118_0018764 3300048921 Bacteria 6215
450 Ga0496118_0125217 3300048921 Bacteria 1665
451 Ga0496118_0371483 3300048921 Unclassified 754
452 Ga0496119_0002689 3300048922 Bacteria 19205
453 Ga0496119_0036838 3300048922 Bacteria 3186
454 Ga0496119_0040316 3300048922 Bacteria 2988
455 Ga0496120_0008224 3300048923 Bacteria 7634
456 Ga0496121_0021758 3300048924 Bacteria 6265
457 Ga0496121_0145946 3300048924 Bacteria 1748
458 Ga0496121_0259346 3300048924 Unclassified 1201
459 Ga0496121_0405538 3300048924 Unclassified 891
460 Ga0496124_0019847 3300048927 Bacteria 6236
461 Ga0496125_0038506 3300048928 Bacteria 4137
462 Ga0496125_0100923 3300048928 Bacteria 2126
463 Ga0496125_0122629 3300048928 Bacteria 1850
464 Ga0496125_0150150 3300048928 Bacteria 1602
465 Ga0496126_0045261 3300048929 Bacteria 4046
466 Ga0496126_0329647 3300048929 Bacteria 1253
467 Ga0496126_0380782 3300048929 Bacteria 1148
468 Ga0496126_0486175 3300048929 Bacteria 988
469 Ga0501031_0001419 3300049568 Bacteria 14839
470 Ga0501031_0628606 3300049568 Bacteria 690
471 Ga0501032_0007104 3300049569 Bacteria 8198
472 Ga0501032_0286475 3300049569 Bacteria 1066
473 Ga0501033_0001230 3300049570 Bacteria 22966
474 Ga0501034_0142713 3300049571 Bacteria 2373
475 Ga0501034_1002042 3300049571 Bacteria 719
476 Ga0501036_0002324 3300049572 Bacteria 14869
477 Ga0501037_0009222 3300049573 Bacteria 7233
478 Ga0501038_0003498 3300049574 Bacteria 14625
479 Ga0501039_0117898 3300049575 Bacteria 2079
480 Ga0501039_0225757 3300049575 Bacteria 1472
481 Ga0501040_0088651 3300049576 Bacteria 2149
482 Ga0501040_0282803 3300049576 Bacteria 1185
483 Ga0501041_0464774 3300049577 Bacteria 804
484 Ga0501042_0085688 3300049578 Bacteria 2259
485 Ga0501043_0008013 3300049579 Bacteria 8338
486 Ga0501046_0013436 3300049580 Bacteria 6931
487 Ga0501047_0003396 3300049581 Bacteria 15073
488 Ga0501047_0050207 3300049581 Bacteria 4028
489 Ga0501047_0087996 3300049581 Bacteria 2983
490 Ga0501047_0104712 3300049581 Bacteria 2709
491 Ga0501048_0006756 3300049582 Bacteria 8716
492 Ga0501048_0096970 3300049582 Bacteria 2080
493 Ga0501067_0128593 3300049583 Bacteria 1409
494 Ga0501068_0188838 3300049584 Bacteria 1304
495 Ga0501069_0226497 3300049585 Bacteria 1087
496 Ga0501069_0299059 3300049585 Bacteria 943
497 Ga0501069_0372968 3300049585 Bacteria 842
498 Ga0501070_0008745 3300049586 Bacteria 8563
499 Ga0501070_0034838 3300049586 Bacteria 4207
500 Ga0501070_0369112 3300049586 Bacteria 1163
501 Ga0501070_0407342 3300049586 Bacteria 1099
502 Ga0501070_1444887 3300049586 Unclassified 521
503 Ga0501071_0139456 3300049587 Bacteria 1805
504 Ga0501071_0387094 3300049587 Bacteria 1067
505 Ga0501072_0070995 3300049588 Bacteria 2751
506 Ga0501072_0091493 3300049588 Bacteria 2415
507 Ga0501073_0036554 3300049589 Bacteria 3489
508 Ga0501074_0024156 3300049590 Bacteria 4417
509 Ga0501074_0072580 3300049590 Bacteria 2472
510 Ga0501074_0219286 3300049590 Bacteria 1354
511 Ga0501075_0004075 3300049591 Bacteria 9867
512 Ga0501079_0091109 3300049741 Bacteria 2362
513 Ga0501079_0208730 3300049741 Bacteria 1525
514 Ga0501080_0102745 3300049742 Bacteria 2651
515 Ga0501080_0265644 3300049742 Bacteria 1562
516 Ga0501083_0009230 3300049744 Bacteria 6964
517 Ga0501083_0147141 3300049744 Bacteria 1542
518 Ga0501035_0001056 3300049822 Bacteria 28872
519 Ga0501044_0004552 3300049823 Bacteria 15505
520 Ga0501044_0049531 3300049823 Bacteria 4336
521 Ga0501044_0319919 3300049823 Bacteria 1476
522 nmdc:mga05p37_55968_c1 3300050507 Bacteria 4855
523 nmdc:mga06r32_8550_c1 3300050510 Bacteria 9228
524 nmdc:mga08y16_21284_c2 3300050511 Bacteria 2951
525 nmdc:mga0n895_11734_c1 3300050512 Bacteria 7831
526 nmdc:mga0rr50_87665_c1 3300050513 Bacteria 2416
527 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
528 nmdc:mga0a205_43692_c1 3300050515 Bacteria 4319
529 Ga0495601_0000041 3300053077 Bacteria 79353
530 Ga0495601_0000246 3300053077 Bacteria 28887
531 Ga0495601_0011564 3300053077 Bacteria 5287
532 Ga0495601_0102767 3300053077 Bacteria 1847
533 Ga0495601_0387691 3300053077 Bacteria 906
534 Ga0495612_0000149 3300053078 Bacteria 29381
535 Ga0495612_0004092 3300053078 Bacteria 6043
536 Ga0495612_0028033 3300053078 Bacteria 2266
537 Ga0495612_0200826 3300053078 Bacteria 880
538 Ga0495655_0000012 3300053083 Bacteria 92485
539 Ga0495655_0041556 3300053083 Bacteria 1176
540 Ga0495595_0000001 3300053084 Bacteria 495226
541 Ga0495595_0000652 3300053084 Bacteria 13194
542 Ga0495595_0015879 3300053084 Bacteria 3215
543 Ga0495595_0329613 3300053084 Bacteria 769
544 Ga0495619_0000018 3300053085 Bacteria 209943
545 Ga0495619_0000041 3300053085 Bacteria 112824
546 Ga0495619_0000143 3300053085 Bacteria 53216
547 Ga0495619_0009926 3300053085 Bacteria 5996
548 Ga0495619_0331783 3300053085 Bacteria 1053
549 Ga0500583_0147121 3300053092 Bacteria 1172
550 Ga0500595_087041 3300053119 Bacteria 908
551 Ga0500614_000125 3300053123 Bacteria 18595
552 Ga0500628_000014 3300053129 Bacteria 102838
553 Ga0500658_0147680 3300053134 Bacteria 1058
554 Ga0501084_0612395 3300054114 Bacteria 920
555 Ga0501082_0015708 3300060353 Bacteria 6513
556 Ga0501082_0581555 3300060353 Bacteria 980
557 Ga0501082_0881069 3300060353 Bacteria 783
558 Ga0501084_1283715
559 JGI24746J21847_1000380
560 JGI24748J21848_1000396
561 JGI24034J26672_10000160
562 JGI24742J22300_10009641
563 Ga0070683_100010098
564 Ga0070683_100011494
565 Ga0070683_100016073
566 Ga0070683_100027424
567 Ga0070683_100098772
568 Ga0070683_100347727
569 Ga0070670_100226127
570 Ga0070677_10000075
571 Ga0070682_100539397
572 Ga0068868_100003875
573 Ga0070689_100305118
574 Ga0070661_100000524
575 Ga0070692_10117953
576 Ga0070668_100042034
577 Ga0070668_100305930
578 Ga0070668_100455260
579 Ga0070675_100000008
580 Ga0070671_101256541
581 Ga0070674_100000047
582 Ga0070674_100000105
583 Ga0070673_100115152
584 Ga0070688_100000151
585 Ga0070688_100043464
586 Ga0070659_100092521
587 Ga0070659_100822131
588 Ga0070667_100002491
589 Ga0070667_100022130
590 Ga0070667_100459792
591 Ga0070714_100025876
592 Ga0070713_100001587
593 Ga0070711_100010236
594 Ga0070711_100035451
595 Ga0070663_100009347
596 Ga0070663_100846578
597 Ga0070678_100013711
598 Ga0070678_100198218
599 Ga0070681_10064130
600 Ga0070685_10000092
601 Ga0070685_10002231
602 Ga0070679_100000804
603 Ga0070679_100020824
604 Ga0070684_100062642
605 Ga0070684_100146206
606 Ga0070684_100476029
607 Ga0070684_101453701
608 Ga0068853_100014352
609 Ga0068853_100232363
610 Ga0068853_100376159
611 Ga0070672_100001255
612 Ga0070686_100296421
613 Ga0070693_100002159
614 Ga0070665_100000128
615 Ga0070665_100002491
616 Ga0070665_100157060
617 Ga0070665_100225941
618 Ga0070665_100420946
619 Ga0070665_100603457
620 Ga0070704_100368844
621 Ga0070704_101014756
622 Ga0068855_100145972
623 Ga0068855_100434410
624 Ga0070664_100094706
625 Ga0070664_100115747
626 Ga0068854_100000123
627 Ga0068856_100019149
628 Ga0068856_100206002
629 Ga0068856_100315286
630 Ga0068856_100851730
631 Ga0068856_101621381
632 Ga0068852_100000050
633 Ga0068852_100787226
634 Ga0068866_10000006
635 Ga0068866_10000124
636 Ga0068866_10361900
637 Ga0068851_10001237
638 Ga0068863_100000039
639 Ga0068863_100003181
640 Ga0068858_100000354
641 Ga0068858_100001452
642 Ga0068858_100233866
643 Ga0068858_100452807
644 Ga0068858_101140294
645 Ga0068862_100013835
646 Ga0081455_10052747
647 Ga0075365_10266720
648 Ga0070715_10000003
649 Ga0070716_100182683
650 Ga0070712_100019703
651 Ga0070712_100544160
652 Ga0097621_101284342
653 Ga0075431_100011442
654 Ga0075433_10000875
655 Ga0075434_100024738
656 Ga0075436_100560786
657 Ga0075436_100655048
658 Ga0075435_100202618
659 Ga0105240_10339563
660 Ga0105240_10852643
661 Ga0111539_10067976
662 Ga0105245_10000012
663 Ga0105245_10000067
664 Ga0105245_10000246
665 Ga0105245_10009989
666 Ga0105245_11798275
667 Ga0105247_10197438
668 Ga0114129_10059127
669 Ga0105243_10009568
670 Ga0105243_10091763
671 Ga0105241_10248208
672 Ga0105241_10256321
673 Ga0105242_10000010
674 Ga0105242_10149891
675 Ga0105248_10000307
676 Ga0105248_10260295
677 Ga0105248_12421266
678 Ga0105237_10169985
679 Ga0105238_10000014
680 Ga0105238_11487729
681 Ga0105249_10000159
682 Ga0105249_10070387
683 Ga0099796_10357347
684 Ga0105239_10232460
685 Ga0157371_10002341
686 Ga0157370_10040358
687 Ga0157370_10316975
688 Ga0157369_10000222
689 Ga0157374_10000281
690 Ga0157374_11406981
691 Ga0157378_10009857
692 Ga0163162_10139140
693 Ga0163162_10641534
694 Ga0157372_10006714
695 Ga0157375_10000095
696 Ga0157375_10035586
697 Ga0157375_10071355
698 Ga0157375_11835863
699 Ga0157375_11902153
700 Ga0163163_10758016
701 Ga0163163_11356208
702 Ga0163163_11456178
703 Ga0157380_10000594
704 Ga0157380_12078593
705 Ga0157377_10334854
706 Ga0157379_10013677
707 Ga0157379_10165185
708 Ga0157376_10202790
709 Ga0157376_10259601
710 Ga0157376_10544287
711 Ga0163161_10000140
712 Ga0163161_10072390
713 Ga0206356_11783605
714 Ga0206353_10708015
715 Ga0207682_10000217
716 Ga0207642_10000001
717 Ga0207642_10000003
718 Ga0207642_10000004
719 Ga0207642_10000152
720 Ga0207642_10262102
721 Ga0207642_10407673
722 Ga0207710_10181282
723 Ga0207680_10055188
724 Ga0207685_10000003
725 Ga0207705_10102922
726 Ga0207654_10106448
727 Ga0207707_10098235
728 Ga0207693_10023691
729 Ga0207693_10772702
730 Ga0207663_10005102
731 Ga0207663_10149444
732 Ga0207657_10875486
733 Ga0207649_10000610
734 Ga0207652_10000119
735 Ga0207652_10000332
736 Ga0207694_10000008
737 Ga0207650_10448111
738 Ga0207659_10000049
739 Ga0207687_10000011
740 Ga0207687_10000012
741 Ga0207687_10000503
742 Ga0207687_10004483
743 Ga0207700_10000016
744 Ga0207664_10012655
745 Ga0207690_10002643
746 Ga0207690_10062808
747 Ga0207690_10561362
748 Ga0207686_10000227
749 Ga0207686_10043634
750 Ga0207709_10030724
751 Ga0207709_10078365
752 Ga0207670_10490313
753 Ga0207670_10969441
754 Ga0207669_10000002
755 Ga0207669_10000765
756 Ga0207665_10116043
757 Ga0207691_10001495
758 Ga0207711_10000024
759 Ga0207661_10001860
760 Ga0207661_10009394
761 Ga0207661_10037300
762 Ga0207661_10082420
763 Ga0207661_10230695
764 Ga0207661_10772679
765 Ga0207679_10078469
766 Ga0207679_10134505
767 Ga0207712_10000003
768 Ga0207712_10003211
769 Ga0207712_10402858
770 Ga0207668_10007500
771 Ga0207668_10143184
772 Ga0207668_10278908
773 Ga0207668_10503023
774 Ga0207640_10000040
775 Ga0207640_10045984
776 Ga0207658_10000871
777 Ga0207658_10014542
778 Ga0207658_10724983
779 Ga0207677_10000787
780 Ga0207677_10002766
781 Ga0207703_10000028
782 Ga0207703_10000185
783 Ga0207703_10438661
784 Ga0207639_10009852
785 Ga0207639_10265008
786 Ga0207639_10351258
787 Ga0207639_10361023
788 Ga0207678_10000953
789 Ga0207678_10848147
790 Ga0207708_10765206
791 Ga0207708_10960104
792 Ga0207702_10001168
793 Ga0207702_10008030
794 Ga0207702_10040826
795 Ga0207702_10722281
796 Ga0207702_11632617
797 Ga0207641_10000072
798 Ga0207674_10162179
799 Ga0207683_10155832
800 Ga0207683_10348842
801 Ga0207683_10370228
802 Ga0207698_10000009
803 Ga0207698_10608688
804 Ga0207428_10062230
805 Ga0268266_10000023
806 Ga0268266_10001616
807 Ga0268266_10001763
808 Ga0268266_10225668
809 Ga0268266_10439078
810 Ga0268265_10008225
811 Ga0268264_10264461
812 Ga0265337_1000041
813 Ga0265326_10000015
814 Ga0265319_1063361
815 Ga0265323_10079655
816 Ga0265322_10000003
817 Ga0265336_10005910
818 Ga0265324_10000907
819 Ga0265332_10126602
820 Ga0265328_10001369
821 Ga0265320_10000001
822 Ga0265339_10017679
823 Ga0265331_10009641
824 Ga0265327_10000003
825 Ga0265316_10024452
826 Ga0265314_10020220
827 Ga0307415_100093025
828 Ga0373937_0023647
829 Ga0373937_0070670
830 Ga0395901_0848828
831 Ga0395901_1919451
832 Ga0451802_0438050
833 Ga0451807_1796160
834 Ga0451807_2307049
835 Ga0451833_0634948
836 Ga0451839_0844376
837 Ga0451853_3731523
838 Ga0466963_0000002
839 Ga0466957_0016522
840 Ga0466957_0155944
841 Ga0466958_0021909
842 Ga0466967_0000020
843 Ga0495592_0000999
844 Ga0495592_0387725
845 Ga0495603_0000057
846 Ga0495603_0002491
847 Ga0495603_0003192
848 Ga0495629_0000028
849 Ga0495629_0004331
850 Ga0495629_0389110
851 Ga0495629_0463522
852 Ga0495641_0001934
853 Ga0495641_0067435
854 Ga0495651_0146464
855 Ga0495653_0096141
856 Ga0495653_0186428
857 Ga0495653_0223183
858 Ga0495582_0000048
859 Ga0495662_0000659
860 Ga0495662_0018027
861 Ga0495662_0053835
862 Ga0495664_0343379
863 Ga0495606_0000294
864 Ga0495608_0000001
865 Ga0495608_0004024
866 Ga0495608_0119306
867 Ga0495628_0001728
868 Ga0495628_0011273
869 Ga0495628_0011510
870 Ga0495628_0232549
871 Ga0495628_0673367
872 Ga0495630_0000165
873 Ga0495630_0037128
874 Ga0495630_0485403
875 Ga0495637_0262121
876 Ga0495644_0001304
877 Ga0495652_0047825
878 Ga0495652_0131103
879 Ga0495640_0040475
880 Ga0495640_0050074
881 Ga0495586_0032837
882 Ga0495587_0003143
883 Ga0495645_0001401
884 Ga0495645_0017457
885 Ga0495667_0000057
886 Ga0495667_0289804
887 Ga0495668_0277651
888 Ga0495634_0000555
889 Ga0495634_0013405
890 Ga0495634_0055729
891 Ga0495588_0000195
892 Ga0495657_0000002
893 Ga0495657_0079405
894 Ga0495657_0096415
895 Ga0495599_0008656
896 Ga0495623_0208494
897 Ga0495623_0528165
898 Ga0495623_0570039
899 Ga0495647_0000020
900 Ga0495647_0002424
901 Ga0495647_0003249
902 Ga0495658_0000031
903 Ga0495669_0000064
904 Ga0495669_0186990
905 Ga0495669_0210253
906 Ga0495613_0000003
907 Ga0495613_0000500
908 Ga0495613_0185425
909 Ga0495624_0000087
910 Ga0495624_0000652
911 Ga0495671_0251249
912 Ga0495649_0008654
913 Ga0495600_0020410
914 Ga0495600_0036363
915 Ga0495600_0067052
916 Ga0495600_0150174
917 Ga0495604_0001970
918 Ga0495604_0002487
919 Ga0495604_0148075
920 Ga0495674_0000007
921 Ga0495672_0024890
922 Ga0495676_0000263
923 Ga0495676_0005813
924 Ga0495676_0067438
925 Ga0495676_0121108
926 Ga0495676_0240941
927 Ga0495680_0005894
928 Ga0495680_0017444
929 Ga0495680_0017984
930 Ga0495680_0363471
931 Ga0495675_0000696
932 Ga0495686_0059362
933 Ga0495593_0374673
934 Ga0495602_0002467
935 Ga0495602_0007803
936 Ga0495602_0057467
937 Ga0495602_0166800
938 Ga0495602_0541469
939 Ga0495602_0878383
940 Ga0496100_0000004
941 Ga0496100_0000032
942 Ga0496101_0000007
943 Ga0496101_0000012
944 Ga0496101_0851716
945 Ga0496102_0000021
946 Ga0496102_0182497
947 Ga0496103_0000001
948 Ga0496103_0276652
949 Ga0496103_0422725
950 Ga0496104_0000002
951 Ga0496104_0000003
952 Ga0496104_0002073
953 Ga0496104_0038835
954 Ga0496104_0092123
955 Ga0496105_0000001
956 Ga0496105_0000003
957 Ga0496105_0009688
958 Ga0496105_0066404
959 Ga0496105_0098035
960 Ga0496106_0000004
961 Ga0496106_0000096
962 Ga0496106_0000470
963 Ga0496107_0000001
964 Ga0496107_0000031
965 Ga0496107_0854378
966 Ga0496108_0000002
967 Ga0496108_0000012
968 Ga0496108_0004840
969 Ga0496108_0014174
970 Ga0496108_0353449
971 Ga0496109_0000001
972 Ga0496109_0000106
973 Ga0496109_0003327
974 Ga0496109_0321988
975 Ga0496109_0359242
976 Ga0496109_0804154
977 Ga0496109_1010087
978 Ga0496110_0014901
979 Ga0496110_0029771
980 Ga0496110_0103834
981 Ga0496110_0112254
982 Ga0496110_1434511
983 Ga0496111_0000001
984 Ga0496111_0036458
985 Ga0496111_0683239
986 Ga0496112_0000002
987 Ga0496112_0000762
988 Ga0496112_0157492
989 Ga0496112_1316127
990 Ga0496113_0000317
991 Ga0496113_0032061
992 Ga0496113_0170718
993 Ga0496113_0430122
994 Ga0496113_0727332
995 Ga0496114_0000080
996 Ga0496114_0074984
997 Ga0496114_0267643
998 Ga0496114_0593221
999 Ga0496115_0000004
1000 Ga0496115_0000104
1001 Ga0496115_0108391
1002 Ga0496115_0491423
1003 Ga0496116_0000500
1004 Ga0496117_0058517
1005 Ga0496117_0454479
1006 Ga0496118_0018764
1007 Ga0496118_0125217
1008 Ga0496118_0371483
1009 Ga0496119_0002689
1010 Ga0496119_0036838
1011 Ga0496119_0040316
1012 Ga0496120_0008224
1013 Ga0496121_0021758
1014 Ga0496121_0145946
1015 Ga0496121_0259346
1016 Ga0496121_0405538
1017 Ga0496124_0019847
1018 Ga0496125_0038506
1019 Ga0496125_0100923
1020 Ga0496125_0122629
1021 Ga0496125_0150150
1022 Ga0496126_0045261
1023 Ga0496126_0329647
1024 Ga0496126_0380782
1025 Ga0496126_0486175
1026 Ga0501031_0001419
1027 Ga0501031_0628606
1028 Ga0501032_0007104
1029 Ga0501032_0286475
1030 Ga0501033_0001230
1031 Ga0501034_0142713
1032 Ga0501034_1002042
1033 Ga0501036_0002324
1034 Ga0501037_0009222
1035 Ga0501038_0003498
1036 Ga0501039_0117898
1037 Ga0501039_0225757
1038 Ga0501040_0088651
1039 Ga0501040_0282803
1040 Ga0501041_0464774
1041 Ga0501042_0085688
1042 Ga0501043_0008013
1043 Ga0501046_0013436
1044 Ga0501047_0003396
1045 Ga0501047_0050207
1046 Ga0501047_0087996
1047 Ga0501047_0104712
1048 Ga0501048_0006756
1049 Ga0501048_0096970
1050 Ga0501067_0128593
1051 Ga0501068_0188838
1052 Ga0501069_0226497
1053 Ga0501069_0299059
1054 Ga0501069_0372968
1055 Ga0501070_0008745
1056 Ga0501070_0034838
1057 Ga0501070_0369112
1058 Ga0501070_0407342
1059 Ga0501070_1444887
1060 Ga0501071_0139456
1061 Ga0501071_0387094
1062 Ga0501072_0070995
1063 Ga0501072_0091493
1064 Ga0501073_0036554
1065 Ga0501074_0024156
1066 Ga0501074_0072580
1067 Ga0501074_0219286
1068 Ga0501075_0004075
1069 Ga0501079_0091109
1070 Ga0501079_0208730
1071 Ga0501080_0102745
1072 Ga0501080_0265644
1073 Ga0501083_0009230
1074 Ga0501083_0147141
1075 Ga0501035_0001056
1076 Ga0501044_0004552
1077 Ga0501044_0049531
1078 Ga0501044_0319919
1079 nmdc:mga05p37_55968_c1
1080 nmdc:mga06r32_8550_c1
1081 nmdc:mga08y16_21284_c2
1082 nmdc:mga0n895_11734_c1
1083 nmdc:mga0rr50_87665_c1
1084 nmdc:mga0a205_1_c2
1085 nmdc:mga0a205_43692_c1
1086 Ga0495601_0000041
1087 Ga0495601_0000246
1088 Ga0495601_0011564
1089 Ga0495601_0102767
1090 Ga0495601_0387691
1091 Ga0495612_0000149
1092 Ga0495612_0004092
1093 Ga0495612_0028033
1094 Ga0495612_0200826
1095 Ga0495655_0000012
1096 Ga0495655_0041556
1097 Ga0495595_0000001
1098 Ga0495595_0000652
1099 Ga0495595_0015879
1100 Ga0495595_0329613
1101 Ga0495619_0000018
1102 Ga0495619_0000041
1103 Ga0495619_0000143
1104 Ga0495619_0009926
1105 Ga0495619_0331783
1106 Ga0500583_0147121
1107 Ga0500595_087041
1108 Ga0500614_000125
1109 Ga0500628_000014
1110 Ga0500658_0147680
1111 Ga0501084_0612395
1112 Ga0501082_0015708
1113 Ga0501082_0581555
1114 Ga0501082_0881069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z8o-assembly1.cif.gz_A structural of start superfamily protein msmeg_0129 from mycobacterium smegmatis 0.8209 5 148
3tfz-assembly1.cif.gz_B crystal structure of zhui aromatase/cyclase from streptomcyes sp. r1128 0.8128 2 145
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.802 4 148
5z8o-assembly1.cif.gz_A structural of start superfamily protein msmeg_0129 from mycobacterium smegmatis 0.8007 5 148
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.7872 4 148
ID Description Score Start End Superfamily
af_L7N657_19_160_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8585 6 147 3.30.530.20
af_L7N657_19_160_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8147 6 147 3.30.530.20
af_I6X9Y7_1_146_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8112 2 150 3.30.530.20
af_Q54GT2_2_271_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8071 35 69 3.50.50.60
2d4rA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8057 4 148 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7W1BDU2-F1-model_v4 SRPBCC family protein 0.9944 1 157
AF-A0A4R5KE91-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9944 1 157
AF-A0A1Q7VI15-F1-model_v4 Polyketide cyclase 0.9941 1 157
AF-A0A7U6H0Y6-F1-model_v4 deleted 0.9932 2 148
AF-A0A7W0WDM0-F1-model_v4 SRPBCC family protein 0.9925 1 157

Map