F463399

General Info

Members Datasets Scaffolds Average Seq Length
558 352 1117 148

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100191397|Ga0070670_1001913972
Length 163
Sequence MGPLGRIYNACGQALAFSMKTVHKSVLIWYSAEEMFGLVTDVARYPEFLPWCDHAAVLSQDAQGMNAEIGIAFAGIRQVFRTRNEHVPGREVRMRLVEGPFSQLDGQWKFIPLGDGQRACKVELDLQYGFDNMALGALVGPVFDKIAGSLVDAFVKRAERVFG

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
64 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
139 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
140 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
141 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
142 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
143 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
144 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
145 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
166 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
167 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
168 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
174 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
175 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
176 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
177 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
178 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
183 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
186 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
187 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
188 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
189 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
190 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
265 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
266 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
267 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
271 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
286 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
287 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
288 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
289 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
290 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
291 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
292 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
293 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
294 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
295 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
296 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
297 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
306 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
307 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
308 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
309 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
310 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
311 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
314 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
315 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
316 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
317 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
318 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
319 2643221658 Variovorax sp. Root411 Isolate Unclassified
320 2643221672 Variovorax sp. Root434 Isolate Unclassified
321 2643221683 Variovorax sp. Root473 Isolate Unclassified
322 2738541277 Variovorax sp. GV051 Isolate Unclassified
323 2738541307 Variovorax sp. GV008 Isolate Unclassified
324 2738543013 Variovorax sp. BT01 Isolate Unclassified
325 2738543019 Variovorax sp. GV040 Isolate Unclassified
326 2818991446 Variovorax sp. 1180 Isolate Unclassified
327 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
328 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
329 2842677519 Variovorax sp. R-72495 Isolate Unclassified
330 2842747753 Variovorax sp. R-72060 Isolate Unclassified
331 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
332 2885198086 Variovorax sp. 679 Isolate Unclassified
333 2885211737 Variovorax sp. 553 Isolate Unclassified
334 2899924645 Variovorax sp. 369 Isolate Unclassified
335 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
336 2904456579 Variovorax sp. 2002 Isolate Unclassified
337 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
338 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
339 2928037797 Variovorax sp. 1126 Isolate Unclassified
340 2928044640 Variovorax sp. 1128 Isolate Unclassified
341 2928051484 Variovorax sp. 1133 Isolate Unclassified
342 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
343 2928070936 Variovorax gossypii 1167 Isolate Unclassified
344 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
345 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
346 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
347 2929520902 Variovorax beijingensis 502 Isolate Unclassified
348 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
349 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
350 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
351 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
352 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.65
Metatranscriptomes 0.18
Isolates 7.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.24
Nodule 0.54
Rhizoplane 5.02
Rhizosphere 57.71
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100191397 3300005331 Bacteria 1777
2 SwRhRL2b_contig_2570715 2162886007 Bacteria 1321
3 JGI25158J39367_1011650 3300002739 Bacteria 1170
4 JGI25150J39212_1000968 3300002774 Bacteria 9050
5 JGI25150J39212_1009542 3300002774 Bacteria 1839
6 JGI25151J46595_10001150 3300003187 Bacteria 19162
7 JGI25151J46595_10006674 3300003187 Bacteria 5756
8 rootH1_10049748 3300003316 Bacteria 3121
9 rootL2_10008299 3300003322 Bacteria 2047
10 rootL2_10121275 3300003322 Bacteria 1803
11 rootH1_10018555 3300003316 Bacteria 9158
12 rootH1_10018555 3300003323 Bacteria 2990
13 Ga0006562J51391_1088752 3300003578 Bacteria 3398
14 Ga0055532_1008517 3300003758 Bacteria 1277
15 Ga0055535_1000194 3300003761 Bacteria 64563
16 Ga0055535_1000937 3300003761 Bacteria 19471
17 Ga0055542_1000039 3300003762 Bacteria 215126
18 Ga0055537_1000068 3300003773 Bacteria 75642
19 Ga0055534_1000080 3300003784 Bacteria 75642
20 Ga0055534_1001964 3300003784 Bacteria 7528
21 Ga0055534_1006830 3300003784 Bacteria 2814
22 Ga0055528_1004897 3300003790 Bacteria 6323
23 Ga0055528_1021312 3300003790 Bacteria 2061
24 Ga0055530_10011056 3300003791 Bacteria 3274
25 Ga0055540_1004295 3300003792 Bacteria 6505
26 Ga0055540_1013718 3300003792 Bacteria 2458
27 Ga0055531_10016087 3300003794 Bacteria 3251
28 Ga0055531_10036269 3300003794 Bacteria 1525
29 Ga0065165_1077319 3300005262 Bacteria 871
30 Ga0065714_10302700 3300005288 Bacteria 675
31 Ga0065704_10139325 3300005289 Bacteria 1534
32 Ga0065707_10219893 3300005295 Bacteria 1228
33 Ga0070658_10122031 3300005327 Bacteria 2166
34 Ga0070658_10284960 3300005327 Bacteria 1407
35 Ga0068869_100050289 3300005334 Bacteria 3021
36 Ga0070661_100710515 3300005344 Bacteria 819
37 Ga0070674_100528144 3300005356 Bacteria 987
38 Ga0070673_100025732 3300005364 Bacteria 4336
39 Ga0070673_100224869 3300005364 Bacteria 1626
40 Ga0070667_100106599 3300005367 Bacteria 2426
41 Ga0070714_100477531 3300005435 Bacteria 1187
42 Ga0070678_100150523 3300005456 Bacteria 1874
43 Ga0070678_100348413 3300005456 Bacteria 1273
44 Ga0070662_100030106 3300005457 Bacteria 3794
45 Ga0068867_100433483 3300005459 Bacteria 1116
46 Ga0070679_100196496 3300005530 Bacteria 1984
47 Ga0070672_100158553 3300005543 Bacteria 1876
48 Ga0070665_100098307 3300005548 Bacteria 2931
49 Ga0070665_100206360 3300005548 Bacteria 1965
50 Ga0068855_100236851 3300005563 Bacteria 2041
51 Ga0068855_100309909 3300005563 Bacteria 1747
52 Ga0070664_100050494 3300005564 Bacteria 3520
53 Ga0068857_100060422 3300005577 Bacteria 3366
54 Ga0068856_100395696 3300005614 Bacteria 1401
55 Ga0068864_100042962 3300005618 Bacteria 3869
56 Ga0068851_10057813 3300005834 Bacteria 1981
57 Ga0068858_101034455 3300005842 Bacteria 805
58 Ga0075365_10084865 3300006038 Bacteria 2150
59 Ga0075364_10092888 3300006051 Bacteria 2003
60 Ga0075364_10470029 3300006051 Bacteria 859
61 Ga0075432_10037951 3300006058 Bacteria 1677
62 Ga0070716_101470761 3300006173 Unclassified 556
63 Ga0075362_10044445 3300006177 Bacteria 1970
64 Ga0075362_10138978 3300006177 Bacteria 1160
65 Ga0075367_10103359 3300006178 Bacteria 1743
66 Ga0075367_10159162 3300006178 Bacteria 1404
67 Ga0075366_10004920 3300006195 Bacteria 7206
68 Ga0075366_10015121 3300006195 Bacteria 4417
69 Ga0075366_10076309 3300006195 Bacteria 2000
70 Ga0075366_10085278 3300006195 Bacteria 1889
71 Ga0075366_10113841 3300006195 Bacteria 1628
72 Ga0075370_10000091 3300006353 Bacteria 27943
73 Ga0075370_10000474 3300006353 Bacteria 15087
74 Ga0075370_10059335 3300006353 Bacteria 2177
75 Ga0075370_10133653 3300006353 Bacteria 1448
76 Ga0068871_100091870 3300006358 Bacteria 2530
77 Ga0099826_10000121 3300006948 Bacteria 35285
78 Ga0105244_10022711 3300009036 Bacteria 3449
79 Ga0105240_10119365 3300009093 Bacteria 3176
80 Ga0105240_11490735 3300009093 Bacteria 709
81 Ga0111539_11514388 3300009094 Bacteria 778
82 Ga0105245_10144980 3300009098 Bacteria 2240
83 Ga0105243_10016877 3300009148 Bacteria 5520
84 Ga0105243_10059780 3300009148 Bacteria 3043
85 Ga0105237_10615589 3300009545 Bacteria 1093
86 Ga0105237_11468712 3300009545 Bacteria 688
87 Ga0105238_10151854 3300009551 Bacteria 2291
88 Ga0105249_11801186 3300009553 Bacteria 685
89 Ga0105239_10878134 3300010375 Bacteria 1029
90 Ga0105239_10926778 3300010375 Bacteria 1000
91 Ga0105239_11718049 3300010375 Bacteria 727
92 Ga0105246_10079849 3300011119 Bacteria 2327
93 Ga0105246_10180526 3300011119 Bacteria 1625
94 Ga0157347_1036869 3300012502 Bacteria 633
95 Ga0157327_1004049 3300012512 Bacteria 1115
96 Ga0157373_10016087 3300013100 Bacteria 5461
97 Ga0157371_10536711 3300013102 Bacteria 866
98 Ga0157370_10016574 3300013104 Bacteria 7454
99 Ga0157370_10477046 3300013104 Bacteria 1146
100 Ga0157369_10022998 3300013105 Bacteria 6948
101 Ga0157369_10458604 3300013105 Bacteria 1320
102 Ga0157374_12441414 3300013296 Bacteria 550
103 Ga0157378_10573472 3300013297 Bacteria 1137
104 Ga0163162_11123792 3300013306 Bacteria 891
105 Ga0163162_11974017 3300013306 Bacteria 668
106 Ga0157372_10315160 3300013307 Bacteria 1821
107 Ga0157375_10675741 3300013308 Bacteria 1187
108 Ga0157375_13145916 3300013308 Bacteria 551
109 Ga0157380_10543392 3300014326 Bacteria 1138
110 Ga0157380_11697062 3300014326 Bacteria 689
111 Ga0182008_10004652 3300014497 Bacteria 7983
112 Ga0182008_10005023 3300014497 Bacteria 7607
113 Ga0182008_10005485 3300014497 Bacteria 7221
114 Ga0182008_10018008 3300014497 Bacteria 3659
115 Ga0182008_10097416 3300014497 Bacteria 1452
116 Ga0182008_10287258 3300014497 Bacteria 857
117 Ga0157379_11142182 3300014968 Bacteria 747
118 Ga0157376_10301566 3300014969 Bacteria 1517
119 Ga0157376_10516757 3300014969 Bacteria 1176
120 Ga0157376_12205516 3300014969 Bacteria 590
121 Ga0182006_1003622 3300015261 Bacteria 7846
122 Ga0182006_1015189 3300015261 Bacteria 3303
123 Ga0182007_10004599 3300015262 Bacteria 6234
124 Ga0182007_10005832 3300015262 Bacteria 5353
125 Ga0182005_1193110 3300015265 Bacteria 609
126 Ga0183362_10001 3300015683 Bacteria 2046624
127 Ga0163161_10005661 3300017792 Bacteria 8664
128 Ga0163161_10036358 3300017792 Bacteria 3527
129 Ga0163161_10080821 3300017792 Bacteria 2393
130 Ga0163161_10089727 3300017792 Bacteria 2274
131 Ga0163161_10093372 3300017792 Bacteria 2229
132 Ga0209436_115229 3300025208 Bacteria 1196
133 Ga0209672_100687 3300025228 Bacteria 16993
134 Ga0209147_101482 3300025229 Bacteria 8356
135 Ga0209258_100099 3300025242 Bacteria 214924
136 Ga0207425_1002406 3300025245 Bacteria 6594
137 Ga0207425_1003931 3300025245 Bacteria 4600
138 Ga0209148_1000103 3300025254 Bacteria 215356
139 Ga0209129_1000007 3300025258 Bacteria 771325
140 Ga0209129_1003184 3300025258 Bacteria 7344
141 Ga0209129_1036987 3300025258 Bacteria 788
142 Ga0209565_1000038 3300025263 Bacteria 286433
143 Ga0209565_1000073 3300025263 Bacteria 164695
144 Ga0209673_1000127 3300025273 Bacteria 164695
145 Ga0209673_1000128 3300025273 Bacteria 164482
146 Ga0209673_1002300 3300025273 Bacteria 13604
147 Ga0209673_1006250 3300025273 Bacteria 5804
148 Ga0209130_1000076 3300025284 Bacteria 170259
149 Ga0209130_1000590 3300025284 Bacteria 35406
150 Ga0209675_1000029 3300025291 Bacteria 281053
151 Ga0209675_1000194 3300025291 Bacteria 66431
152 Ga0209675_1000734 3300025291 Bacteria 22237
153 Ga0209675_1044115 3300025291 Bacteria 955
154 Ga0209676_1000205 3300025292 Bacteria 132469
155 Ga0209676_1000383 3300025292 Bacteria 81259
156 Ga0209676_1001009 3300025292 Bacteria 32956
157 Ga0209676_1002941 3300025292 Bacteria 11122
158 Ga0209025_1000056 3300025294 Bacteria 316188
159 Ga0209025_1000088 3300025294 Bacteria 255087
160 Ga0209025_1001878 3300025294 Bacteria 24555
161 Ga0209025_1007177 3300025294 Bacteria 8410
162 Ga0209025_1010860 3300025294 Bacteria 6103
163 Ga0209025_1012639 3300025294 Bacteria 5391
164 Ga0209025_1042001 3300025294 Bacteria 1949
165 Ga0209564_1000073 3300025295 Bacteria 288080
166 Ga0209564_1000099 3300025295 Bacteria 225256
167 Ga0209758_1000044 3300025297 Bacteria 398448
168 Ga0209758_1012502 3300025297 Bacteria 4744
169 Ga0209050_1000007 3300025298 Bacteria 1187891
170 Ga0209050_1000952 3300025298 Bacteria 37637
171 Ga0209050_1004011 3300025298 Bacteria 10377
172 Ga0209256_1000020 3300025299 Bacteria 542402
173 Ga0209256_1000022 3300025299 Bacteria 481843
174 Ga0207426_1000001 3300025302 Bacteria 1341301
175 Ga0209051_1000103 3300025303 Bacteria 162029
176 Ga0209051_1000259 3300025303 Bacteria 88311
177 Ga0209051_1001166 3300025303 Bacteria 23873
178 Ga0209051_1004582 3300025303 Bacteria 8443
179 Ga0209051_1007889 3300025303 Bacteria 5741
180 Ga0209257_1000116 3300025304 Bacteria 228733
181 Ga0209257_1000491 3300025304 Bacteria 71177
182 Ga0209257_1004550 3300025304 Bacteria 10619
183 Ga0209257_1011557 3300025304 Bacteria 4231
184 Ga0209257_1021109 3300025304 Bacteria 2378
185 Ga0207656_10028052 3300025321 Bacteria 2308
186 Ga0207655_1020361 3300025728 Bacteria 3414
187 Ga0207688_10092921 3300025901 Bacteria 1734
188 Ga0207688_10415896 3300025901 Bacteria 835
189 Ga0207647_10385861 3300025904 Bacteria 790
190 Ga0207705_10300556 3300025909 Bacteria 1231
191 Ga0207705_10375375 3300025909 Bacteria 1098
192 Ga0207671_10446758 3300025914 Bacteria 1030
193 Ga0207649_10125580 3300025920 Bacteria 1736
194 Ga0207652_10438069 3300025921 Bacteria 1178
195 Ga0207694_10881709 3300025924 Bacteria 756
196 Ga0207650_10158774 3300025925 Bacteria 1790
197 Ga0207659_10696236 3300025926 Bacteria 870
198 Ga0207659_11183878 3300025926 Bacteria 657
199 Ga0207687_10215895 3300025927 Bacteria 1507
200 Ga0207709_10004077 3300025935 Bacteria 8503
201 Ga0207709_10019765 3300025935 Bacteria 3792
202 Ga0207665_10031362 3300025939 Bacteria 3516
203 Ga0207691_10162635 3300025940 Bacteria 1958
204 Ga0207689_10094396 3300025942 Bacteria 2457
205 Ga0207679_10035277 3300025945 Bacteria 3537
206 Ga0207667_10546357 3300025949 Bacteria 1172
207 Ga0207651_10211019 3300025960 Bacteria 1563
208 Ga0207651_10539285 3300025960 Bacteria 1013
209 Ga0207640_10558816 3300025981 Bacteria 963
210 Ga0207658_10435955 3300025986 Bacteria 1158
211 Ga0207639_10138532 3300026041 Bacteria 2024
212 Ga0207678_10372706 3300026067 Bacteria 1233
213 Ga0207702_10757582 3300026078 Bacteria 959
214 Ga0207641_10349074 3300026088 Bacteria 1410
215 Ga0207648_10179302 3300026089 Bacteria 1875
216 Ga0207648_10711677 3300026089 Bacteria 931
217 Ga0207676_10086079 3300026095 Bacteria 2566
218 Ga0207674_10246100 3300026116 Bacteria 1735
219 Ga0207683_10048947 3300026121 Bacteria 3699
220 Ga0209282_1000488 3300027666 Bacteria 19243
221 Ga0207428_10028385 3300027907 Bacteria 4649
222 Ga0268266_10200224 3300028379 Bacteria 1827
223 Ga0268266_10572419 3300028379 Bacteria 1083
224 Ga0268265_10060264 3300028380 Bacteria 2908
225 Ga0268264_11093701 3300028381 Bacteria 805
226 Ga0307515_10000628 3300028794 Bacteria 82043
227 Ga0307512_10198908 3300030522 Bacteria 1089
228 Ga0316177_1146803 3300030731 Bacteria 2910
229 Ga0316176_1059428 3300030732 Bacteria 3077
230 Ga0314311_1031246 3300030733 Bacteria 5147
231 Ga0316178_1111916 3300030735 Bacteria 4801
232 Ga0316180_1190288 3300030736 Bacteria 2391
233 Ga0316183_1212063 3300030742 Bacteria 4395
234 Ga0316182_1166328 3300030745 Bacteria 4044
235 Ga0265332_10013086 3300031238 Bacteria 3677
236 Ga0265327_10011171 3300031251 Bacteria 6222
237 Ga0307513_10217392 3300031456 Bacteria 1736
238 Ga0307408_100150147 3300031548 Bacteria 1838
239 Ga0307408_100193229 3300031548 Bacteria 1641
240 Ga0307514_10047780 3300031649 Bacteria 3339
241 Ga0307405_10129996 3300031731 Bacteria 1738
242 Ga0307405_10130681 3300031731 Bacteria 1734
243 Ga0307405_10452766 3300031731 Bacteria 1018
244 Ga0307405_10619793 3300031731 Bacteria 885
245 Ga0307413_10104973 3300031824 Bacteria 1877
246 Ga0307406_10003876 3300031901 Bacteria 8146
247 Ga0307406_10479092 3300031901 Bacteria 1004
248 Ga0307407_10116129 3300031903 Bacteria 1688
249 Ga0307412_10105124 3300031911 Bacteria 2004
250 Ga0307412_10136093 3300031911 Bacteria 1792
251 Ga0307412_10150893 3300031911 Bacteria 1714
252 Ga0307412_10306683 3300031911 Bacteria 1257
253 Ga0307409_100451339 3300031995 Bacteria 1241
254 Ga0307416_100215742 3300032002 Bacteria 1835
255 Ga0307416_100358133 3300032002 Bacteria 1480
256 Ga0307416_101291943 3300032002 Bacteria 835
257 Ga0307416_101663776 3300032002 Bacteria 743
258 Ga0307414_10737499 3300032004 Bacteria 894
259 Ga0307411_10063724 3300032005 Bacteria 2464
260 Ga0307411_10635683 3300032005 Bacteria 922
261 Ga0373925_0882560 3300037068 Unclassified 737
262 Ga0395900_0345177 3300037418 Bacteria 1463
263 Ga0395905_0345312 3300037471 Bacteria 1380
264 Ga0395905_0358647 3300037471 Bacteria 1350
265 Ga0395905_0681056 3300037471 Bacteria 930
266 Ga0395905_0818735 3300037471 Bacteria 834
267 Ga0395901_0090542 3300038443 Bacteria 3202
268 Ga0395901_0101252 3300038443 Bacteria 3023
269 Ga0395901_0164471 3300038443 Bacteria 2330
270 Ga0436361_0968351 3300039447 Bacteria 1268
271 Ga0439436_0002082 3300041404 Bacteria 5969
272 Ga0439436_0025063 3300041404 Bacteria 1755
273 Ga0439439_0013823 3300041406 Bacteria 1959
274 Ga0439439_0077800 3300041406 Bacteria 894
275 Ga0439447_024968 3300041407 Bacteria 1543
276 Ga0439447_045899 3300041407 Bacteria 1053
277 Ga0439461_0008900 3300041410 Bacteria 1811
278 Ga0439461_0029046 3300041410 Bacteria 1142
279 Ga0439461_0126574 3300041410 Bacteria 643
280 Ga0439466_0019659 3300041411 Bacteria 2416
281 Ga0439466_0022992 3300041411 Bacteria 2195
282 Ga0439466_0105552 3300041411 Bacteria 876
283 Ga0439465_0000776 3300041413 Bacteria 9955
284 Ga0439465_0043783 3300041413 Bacteria 1453
285 Ga0451791_0112917 3300041451 Bacteria 651
286 Ga0451797_0305433 3300041453 Bacteria 1057
287 Ga0451795_1510973 3300041456 Bacteria 1059
288 Ga0451837_0037507 3300041494 Bacteria 654
289 Ga0451841_0414732 3300041498 Bacteria 781
290 Ga0439431_0003869 3300041997 Bacteria 3303
291 Ga0439431_0006040 3300041997 Bacteria 2672
292 Ga0439431_0043437 3300041997 Bacteria 1150
293 Ga0439433_0001065 3300041999 Bacteria 5580
294 Ga0439442_002129 3300042002 Bacteria 3895
295 Ga0439442_049256 3300042002 Bacteria 888
296 Ga0439442_083356 3300042002 Bacteria 685
297 Ga0439445_0001549 3300042004 Bacteria 5004
298 Ga0439445_0007002 3300042004 Bacteria 2605
299 Ga0439432_001320 3300042006 Bacteria 9393
300 Ga0439432_026408 3300042006 Bacteria 1901
301 Ga0439449_0000266 3300042007 Bacteria 18812
302 Ga0439449_0001247 3300042007 Bacteria 9978
303 Ga0439449_0039410 3300042007 Bacteria 1756
304 Ga0439449_0105253 3300042007 Bacteria 1044
305 Ga0439452_007264 3300042010 Bacteria 3404
306 Ga0439452_009824 3300042010 Bacteria 2807
307 Ga0439457_002895 3300042014 Bacteria 4785
308 Ga0439457_021962 3300042014 Bacteria 1413
309 Ga0439462_0001251 3300042015 Bacteria 5564
310 Ga0439462_0019071 3300042015 Bacteria 1783
311 Ga0450920_011530 3300042122 Bacteria 1649
312 Ga0450923_000384 3300042125 Bacteria 4674
313 Ga0450923_007453 3300042125 Bacteria 1852
314 Ga0450896_001037 3300042133 Bacteria 3258
315 Ga0450898_007197 3300042134 Bacteria 1729
316 Ga0450906_013074 3300042145 Bacteria 1534
317 Ga0450910_017575 3300042147 Bacteria 1065
318 Ga0450910_022532 3300042147 Bacteria 958
319 Ga0439446_0025365 3300042156 Bacteria 1694
320 Ga0439446_0025819 3300042156 Bacteria 1680
321 Ga0439446_0033419 3300042156 Bacteria 1494
322 Ga0450908_006751 3300042184 Bacteria 2172
323 Ga0439434_0007537 3300042435 Bacteria 3190
324 Ga0439434_0039535 3300042435 Bacteria 1447
325 Ga0439434_0178619 3300042435 Bacteria 710
326 Ga0450918_006518 3300042531 Bacteria 2078
327 Ga0451577_0006257 3300042876 Bacteria 11928
328 Ga0451577_0042046 3300042876 Bacteria 4100
329 Ga0451577_0255441 3300042876 Bacteria 1587
330 Ga0451577_0753814 3300042876 Bacteria 880
331 Ga0453683_0157035 3300044673 Bacteria 1438
332 Ga0453683_0482960 3300044673 Bacteria 803
333 Ga0466965_0048397 3300044683 Bacteria 2106
334 Ga0453684_0000005 3300044712 Bacteria 1431632
335 Ga0453684_0000512 3300044712 Bacteria 150627
336 Ga0453684_0000692 3300044712 Bacteria 120085
337 Ga0453684_1663067 3300044712 Bacteria 653
338 Ga0466960_0125779 3300044901 Bacteria 1347
339 Ga0451576_0000461 3300045051 Bacteria 92083
340 Ga0451576_0001147 3300045051 Bacteria 47866
341 Ga0451576_0210371 3300045051 Bacteria 2031
342 Ga0451576_0393855 3300045051 Bacteria 1452
343 Ga0451576_0615052 3300045051 Bacteria 1142
344 Ga0451576_0778998 3300045051 Bacteria 1004
345 Ga0495627_018930 3300046453 Bacteria 2315
346 Ga0495629_0250106 3300046459 Bacteria 1220
347 Ga0495629_0375172 3300046459 Bacteria 968
348 Ga0495638_0132484 3300046460 Bacteria 1463
349 Ga0495639_0002601 3300046475 Bacteria 7854
350 Ga0495610_0035135 3300046512 Bacteria 2576
351 Ga0495610_0215951 3300046512 Bacteria 777
352 Ga0495616_0004736 3300046513 Bacteria 8531
353 Ga0495631_0002450 3300046518 Bacteria 10461
354 Ga0495637_0013851 3300046520 Bacteria 3818
355 Ga0495637_0183422 3300046520 Bacteria 775
356 Ga0495663_0024492 3300046525 Bacteria 1755
357 Ga0495663_0055153 3300046525 Bacteria 1239
358 Ga0495642_0107701 3300046528 Bacteria 1190
359 Ga0495654_0376549 3300046530 Bacteria 567
360 Ga0495665_0617052 3300046531 Bacteria 541
361 Ga0495587_0272341 3300046536 Bacteria 950
362 Ga0495609_0068373 3300046538 Bacteria 1563
363 Ga0495621_0006742 3300046539 Bacteria 3368
364 Ga0495621_0182937 3300046539 Bacteria 837
365 Ga0495621_0434779 3300046539 Bacteria 560
366 Ga0495622_0144986 3300046557 Bacteria 1076
367 Ga0495656_0001663 3300046615 Bacteria 7264
368 Ga0495656_0027102 3300046615 Bacteria 2287
369 Ga0495656_0029722 3300046615 Bacteria 2202
370 Ga0495668_0217563 3300046616 Bacteria 1046
371 Ga0495625_0000301 3300046660 Bacteria 76108
372 Ga0495625_0038284 3300046660 Bacteria 3512
373 Ga0495659_0286751 3300046664 Bacteria 693
374 Ga0495659_0425828 3300046664 Bacteria 575
375 Ga0495661_0216629 3300046665 Bacteria 994
376 Ga0495661_0520113 3300046665 Bacteria 566
377 Ga0495588_0017990 3300046674 Bacteria 3441
378 Ga0495588_0040267 3300046674 Bacteria 2382
379 Ga0495646_0357169 3300046680 Bacteria 765
380 Ga0495658_0099032 3300046683 Bacteria 1737
381 Ga0495613_0862978 3300046689 Bacteria 588
382 Ga0495624_0108584 3300046690 Bacteria 1707
383 Ga0495670_0132105 3300046691 Bacteria 1302
384 Ga0495670_0279023 3300046691 Bacteria 893
385 Ga0495671_0008696 3300046692 Bacteria 5703
386 Ga0495676_0397141 3300047321 Bacteria 915
387 Ga0495687_252198 3300047443 Bacteria 526
388 Ga0495685_154976 3300047447 Bacteria 743
389 Ga0495593_0003865 3300047673 Bacteria 8948
390 Ga0495593_0288355 3300047673 Bacteria 821
391 Ga0495602_0287039 3300048088 Bacteria 1210
392 Ga0495602_0742866 3300048088 Bacteria 663
393 Ga0495614_0088271 3300048089 Bacteria 1347
394 Ga0495615_0018457 3300048090 Bacteria 1535
395 Ga0496100_0123364 3300048903 Bacteria 1815
396 Ga0496101_0020349 3300048904 Bacteria 4540
397 Ga0496101_0134464 3300048904 Bacteria 1880
398 Ga0496102_0108629 3300048905 Bacteria 2584
399 Ga0496103_0109274 3300048906 Bacteria 1755
400 Ga0496104_0066302 3300048907 Bacteria 3427
401 Ga0496105_0046143 3300048908 Bacteria 3596
402 Ga0496105_0475232 3300048908 Bacteria 984
403 Ga0496107_0169484 3300048910 Bacteria 1620
404 Ga0496107_0229457 3300048910 Bacteria 1381
405 Ga0496108_0273156 3300048911 Bacteria 1471
406 Ga0496108_1096841 3300048911 Bacteria 676
407 Ga0496109_0249204 3300048912 Bacteria 1672
408 Ga0496109_0420257 3300048912 Bacteria 1263
409 Ga0496110_0056262 3300048913 Bacteria 3461
410 Ga0496110_0378569 3300048913 Bacteria 1290
411 Ga0496111_0044719 3300048914 Bacteria 3183
412 Ga0496111_0073525 3300048914 Bacteria 2489
413 Ga0496112_0525217 3300048915 Bacteria 1118
414 Ga0496113_0162488 3300048916 Bacteria 1766
415 Ga0496113_1141412 3300048916 Bacteria 610
416 Ga0496114_0145055 3300048917 Bacteria 2057
417 Ga0496116_0043676 3300048919 Bacteria 3051
418 Ga0496116_0049089 3300048919 Bacteria 2826
419 Ga0496116_0097410 3300048919 Bacteria 1768
420 Ga0496117_0028570 3300048920 Bacteria 4316
421 Ga0496117_0079130 3300048920 Bacteria 2167
422 Ga0496118_0013068 3300048921 Bacteria 7894
423 Ga0496118_0015078 3300048921 Bacteria 7182
424 Ga0496118_0174127 3300048921 Bacteria 1310
425 Ga0496122_0002359 3300048925 Bacteria 27157
426 Ga0496122_0059758 3300048925 Bacteria 2812
427 Ga0496122_0343654 3300048925 Bacteria 782
428 Ga0496123_0000108 3300048926 Bacteria 166102
429 Ga0496123_0032805 3300048926 Bacteria 3750
430 Ga0496123_0070875 3300048926 Bacteria 2178
431 Ga0496124_0018958 3300048927 Bacteria 6423
432 Ga0496124_0121614 3300048927 Bacteria 2085
433 Ga0496125_0037281 3300048928 Bacteria 4228
434 Ga0496125_0041569 3300048928 Bacteria 3928
435 Ga0496126_0038986 3300048929 Bacteria 4415
436 Ga0496126_0105952 3300048929 Bacteria 2454
437 Ga0501303_013928 3300049526 Bacteria 790
438 Ga0501034_0029804 3300049571 Bacteria 5547
439 Ga0501034_1441701 3300049571 Bacteria 563
440 Ga0501034_1675817 3300049571 Bacteria 508
441 Ga0501036_0941788 3300049572 Bacteria 708
442 Ga0501038_0885926 3300049574 Bacteria 659
443 Ga0501043_0033425 3300049579 Bacteria 4047
444 Ga0501047_0033428 3300049581 Bacteria 4964
445 Ga0501047_0099448 3300049581 Bacteria 2788
446 Ga0501199_016158 3300049650 Bacteria 840
447 Ga0501238_059044 3300049671 Bacteria 584
448 Ga0501249_018281 3300049679 Bacteria 1515
449 Ga0501257_074681 3300049686 Bacteria 869
450 Ga0501225_0014624 3300049705 Bacteria 2190
451 Ga0501080_0054648 3300049742 Bacteria 3718
452 Ga0501241_068699 3300049758 Bacteria 721
453 Ga0501262_002081 3300049759 Bacteria 2260
454 Ga0501035_0303661 3300049822 Bacteria 1344
455 Ga0501044_0130321 3300049823 Bacteria 2509
456 nmdc:mga03683_112023_c1 3300050489 Bacteria 1207
457 nmdc:mga03683_134253_c1 3300050489 Bacteria 1109
458 nmdc:mga03683_282570_c1 3300050489 Bacteria 776
459 nmdc:mga03683_294835_c1 3300050489 Bacteria 760
460 nmdc:mga03n38_11423_c1 3300050490 Bacteria 3309
461 nmdc:mga03n38_261404_c1 3300050490 Bacteria 918
462 nmdc:mga03n38_430718_c1 3300050490 Bacteria 731
463 nmdc:mga03n38_467544_c1 3300050490 Bacteria 703
464 nmdc:mga00v17_319066_c1 3300050491 Bacteria 1010
465 nmdc:mga00v17_369683_c1 3300050491 Bacteria 932
466 nmdc:mga0yw44_1416_c1 3300050492 Bacteria 9515
467 nmdc:mga0yw44_437468_c1 3300050492 Bacteria 886
468 nmdc:mga0yw44_771356_c1 3300050492 Bacteria 653
469 nmdc:mga0k408_119561_c2 3300050493 Bacteria 1088
470 nmdc:mga0k408_11989_c1 3300050493 Bacteria 4730
471 nmdc:mga0k408_2947_c1 3300050493 Bacteria 9023
472 nmdc:mga0k408_35564_c1 3300050493 Bacteria 2856
473 nmdc:mga0k408_4556_c1 3300050493 Bacteria 7360
474 nmdc:mga06z11_430659_c1 3300050494 Bacteria 796
475 nmdc:mga06z11_44791_c1 3300050494 Bacteria 2233
476 nmdc:mga06z11_66220_c1 3300050494 Bacteria 1898
477 nmdc:mga07m45_2006_c1 3300050496 Bacteria 9433
478 nmdc:mga07m45_355601_c1 3300050496 Bacteria 851
479 nmdc:mga07m45_376929_c1 3300050496 Bacteria 824
480 nmdc:mga07m45_536509_c1 3300050496 Bacteria 677
481 nmdc:mga07m45_584_c1 3300050496 Bacteria 15526
482 nmdc:mga07m45_675673_c1 3300050496 Bacteria 595
483 nmdc:mga07m45_8721_c1 3300050496 Bacteria 5224
484 Ga0495612_0258950 3300053078 Bacteria 775
485 Ga0500610_0153510 3300053079 Bacteria 1151
486 Ga0495655_0032721 3300053083 Bacteria 1275
487 Ga0500643_017525 3300053087 Bacteria 2397
488 Ga0500646_0058129 3300053090 Bacteria 1131
489 Ga0500651_0018395 3300053093 Bacteria 4324
490 Ga0500566_0107312 3300053094 Bacteria 1522
491 Ga0500562_018162 3300053108 Bacteria 1815
492 Ga0500569_046125 3300053109 Bacteria 1297
493 Ga0500571_002013 3300053110 Bacteria 9929
494 Ga0500593_003991 3300053117 Bacteria 5662
495 Ga0500594_0005406 3300053118 Bacteria 2833
496 Ga0500607_007699 3300053121 Bacteria 6627
497 Ga0500607_050269 3300053121 Bacteria 2222
498 Ga0500608_002571 3300053122 Bacteria 6633
499 Ga0500608_145172 3300053122 Bacteria 1047
500 Ga0500618_029137 3300053125 Bacteria 1304
501 Ga0500618_046308 3300053125 Bacteria 991
502 Ga0500626_048905 3300053128 Bacteria 1905
503 Ga0500655_001394 3300053133 Bacteria 4581
504 Ga0500658_0002731 3300053134 Bacteria 6788
505 Ga0500559_0002713 3300053136 Bacteria 8990
506 Ga0500559_0042177 3300053136 Bacteria 1990
507 Ga0500561_0125799 3300053137 Bacteria 785
508 Ga0500568_0014438 3300053139 Bacteria 3566
509 Ga0500573_0040290 3300053140 Bacteria 2698
510 Ga0500606_238270 3300053152 Bacteria 536
511 Ga0500616_0020004 3300053153 Bacteria 3764
512 Ga0500622_0130021 3300053156 Bacteria 1211
513 Ga0500627_0003025 3300053158 Bacteria 5117
514 Ga0500634_0051880 3300053161 Bacteria 2205
515 Ga0500638_055444 3300053162 Bacteria 1911
516 Ga0500636_0008456 3300053177 Bacteria 5970
517 Ga0500625_152518 3300053729 Bacteria 866
518 Ga0500596_010632 3300053735 Bacteria 1418
519 Ga0501082_0533094 3300060353 Bacteria 1027
520 2513228691 2513020051 Bacteria 6053213
521 2599623749 2599185214 Bacteria 8209958
522 2599671632 2599185226 Bacteria 8233575
523 2599681355 2599185227 Bacteria 8246414
524 2599693242 2599185229 Bacteria 8216126
525 2644159662 2643221628 Bacteria 5745828
526 2644327688 2643221658 Bacteria 6064537
527 2644400363 2643221672 Bacteria 6322190
528 2644468235 2643221683 Bacteria 5749203
529 2738717803 2738541277 Bacteria 7458140
530 2738879418 2738541307 Bacteria 8606193
531 2739251362 2738543013 Bacteria 5618633
532 2739278489 2738543019 Bacteria 7459457
533 2819597292 2818991446 Bacteria 7757362
534 2831266417 2831265667 Bacteria 7184833
535 2838057461 2838054893 Bacteria 7451788
536 2842679983 2842677519 Bacteria 5615038
537 2842747789 2842747753 Bacteria 5578255
538 2885192628 2885192300 Bacteria 5882526
539 2885204553 2885198086 Bacteria 7212419
540 2885218206 2885211737 Bacteria 7212420
541 2899924799 2899924645 Bacteria 7487985
542 2904454364 2904449895 Bacteria 6927402
543 2904461193 2904456579 Bacteria 6819253
544 2904548313 2904541872 Bacteria 8915136
545 2919466102 2919462493 Bacteria 5817112
546 2928039075 2928037797 Bacteria 7273642
547 2928045320 2928044640 Bacteria 7271509
548 2928053125 2928051484 Bacteria 7773759
549 2928064204 2928064002 Bacteria 7419480
550 2928071632 2928070936 Bacteria 8062541
551 2928084417 2928084124 Bacteria 7159212
552 2928116452 2928115317 Bacteria 6477646
553 2929163303 2929160207 Bacteria 9075316
554 2929527076 2929520902 Bacteria 6765052
555 2945911735 2945909444 Bacteria 7065066
556 2945948072 2945945610 Bacteria 5951079
557 2945977261 2945972063 Bacteria 6086495
558 2945985974 2945984333 Bacteria 7358892
559 2954772238 2954767861 Bacteria 5535784
560 Ga0070670_100191397
561 SwRhRL2b_contig_2570715
562 JGI25158J39367_1011650
563 JGI25150J39212_1000968
564 JGI25150J39212_1009542
565 JGI25151J46595_10001150
566 JGI25151J46595_10006674
567 rootH1_10049748
568 rootL2_10008299
569 rootL2_10121275
570 rootH1_10018555
571 Ga0006562J51391_1088752
572 Ga0055532_1008517
573 Ga0055535_1000194
574 Ga0055535_1000937
575 Ga0055542_1000039
576 Ga0055537_1000068
577 Ga0055534_1000080
578 Ga0055534_1001964
579 Ga0055534_1006830
580 Ga0055528_1004897
581 Ga0055528_1021312
582 Ga0055530_10011056
583 Ga0055540_1004295
584 Ga0055540_1013718
585 Ga0055531_10016087
586 Ga0055531_10036269
587 Ga0065165_1077319
588 Ga0065714_10302700
589 Ga0065704_10139325
590 Ga0065707_10219893
591 Ga0070658_10122031
592 Ga0070658_10284960
593 Ga0068869_100050289
594 Ga0070661_100710515
595 Ga0070674_100528144
596 Ga0070673_100025732
597 Ga0070673_100224869
598 Ga0070667_100106599
599 Ga0070714_100477531
600 Ga0070678_100150523
601 Ga0070678_100348413
602 Ga0070662_100030106
603 Ga0068867_100433483
604 Ga0070679_100196496
605 Ga0070672_100158553
606 Ga0070665_100098307
607 Ga0070665_100206360
608 Ga0068855_100236851
609 Ga0068855_100309909
610 Ga0070664_100050494
611 Ga0068857_100060422
612 Ga0068856_100395696
613 Ga0068864_100042962
614 Ga0068851_10057813
615 Ga0068858_101034455
616 Ga0075365_10084865
617 Ga0075364_10092888
618 Ga0075364_10470029
619 Ga0075432_10037951
620 Ga0070716_101470761
621 Ga0075362_10044445
622 Ga0075362_10138978
623 Ga0075367_10103359
624 Ga0075367_10159162
625 Ga0075366_10004920
626 Ga0075366_10015121
627 Ga0075366_10076309
628 Ga0075366_10085278
629 Ga0075366_10113841
630 Ga0075370_10000091
631 Ga0075370_10000474
632 Ga0075370_10059335
633 Ga0075370_10133653
634 Ga0068871_100091870
635 Ga0099826_10000121
636 Ga0105244_10022711
637 Ga0105240_10119365
638 Ga0105240_11490735
639 Ga0111539_11514388
640 Ga0105245_10144980
641 Ga0105243_10016877
642 Ga0105243_10059780
643 Ga0105237_10615589
644 Ga0105237_11468712
645 Ga0105238_10151854
646 Ga0105249_11801186
647 Ga0105239_10878134
648 Ga0105239_10926778
649 Ga0105239_11718049
650 Ga0105246_10079849
651 Ga0105246_10180526
652 Ga0157347_1036869
653 Ga0157327_1004049
654 Ga0157373_10016087
655 Ga0157371_10536711
656 Ga0157370_10016574
657 Ga0157370_10477046
658 Ga0157369_10022998
659 Ga0157369_10458604
660 Ga0157374_12441414
661 Ga0157378_10573472
662 Ga0163162_11123792
663 Ga0163162_11974017
664 Ga0157372_10315160
665 Ga0157375_10675741
666 Ga0157375_13145916
667 Ga0157380_10543392
668 Ga0157380_11697062
669 Ga0182008_10004652
670 Ga0182008_10005023
671 Ga0182008_10005485
672 Ga0182008_10018008
673 Ga0182008_10097416
674 Ga0182008_10287258
675 Ga0157379_11142182
676 Ga0157376_10301566
677 Ga0157376_10516757
678 Ga0157376_12205516
679 Ga0182006_1003622
680 Ga0182006_1015189
681 Ga0182007_10004599
682 Ga0182007_10005832
683 Ga0182005_1193110
684 Ga0183362_10001
685 Ga0163161_10005661
686 Ga0163161_10036358
687 Ga0163161_10080821
688 Ga0163161_10089727
689 Ga0163161_10093372
690 Ga0209436_115229
691 Ga0209672_100687
692 Ga0209147_101482
693 Ga0209258_100099
694 Ga0207425_1002406
695 Ga0207425_1003931
696 Ga0209148_1000103
697 Ga0209129_1000007
698 Ga0209129_1003184
699 Ga0209129_1036987
700 Ga0209565_1000038
701 Ga0209565_1000073
702 Ga0209673_1000127
703 Ga0209673_1000128
704 Ga0209673_1002300
705 Ga0209673_1006250
706 Ga0209130_1000076
707 Ga0209130_1000590
708 Ga0209675_1000029
709 Ga0209675_1000194
710 Ga0209675_1000734
711 Ga0209675_1044115
712 Ga0209676_1000205
713 Ga0209676_1000383
714 Ga0209676_1001009
715 Ga0209676_1002941
716 Ga0209025_1000056
717 Ga0209025_1000088
718 Ga0209025_1001878
719 Ga0209025_1007177
720 Ga0209025_1010860
721 Ga0209025_1012639
722 Ga0209025_1042001
723 Ga0209564_1000073
724 Ga0209564_1000099
725 Ga0209758_1000044
726 Ga0209758_1012502
727 Ga0209050_1000007
728 Ga0209050_1000952
729 Ga0209050_1004011
730 Ga0209256_1000020
731 Ga0209256_1000022
732 Ga0207426_1000001
733 Ga0209051_1000103
734 Ga0209051_1000259
735 Ga0209051_1001166
736 Ga0209051_1004582
737 Ga0209051_1007889
738 Ga0209257_1000116
739 Ga0209257_1000491
740 Ga0209257_1004550
741 Ga0209257_1011557
742 Ga0209257_1021109
743 Ga0207656_10028052
744 Ga0207655_1020361
745 Ga0207688_10092921
746 Ga0207688_10415896
747 Ga0207647_10385861
748 Ga0207705_10300556
749 Ga0207705_10375375
750 Ga0207671_10446758
751 Ga0207649_10125580
752 Ga0207652_10438069
753 Ga0207694_10881709
754 Ga0207650_10158774
755 Ga0207659_10696236
756 Ga0207659_11183878
757 Ga0207687_10215895
758 Ga0207709_10004077
759 Ga0207709_10019765
760 Ga0207665_10031362
761 Ga0207691_10162635
762 Ga0207689_10094396
763 Ga0207679_10035277
764 Ga0207667_10546357
765 Ga0207651_10211019
766 Ga0207651_10539285
767 Ga0207640_10558816
768 Ga0207658_10435955
769 Ga0207639_10138532
770 Ga0207678_10372706
771 Ga0207702_10757582
772 Ga0207641_10349074
773 Ga0207648_10179302
774 Ga0207648_10711677
775 Ga0207676_10086079
776 Ga0207674_10246100
777 Ga0207683_10048947
778 Ga0209282_1000488
779 Ga0207428_10028385
780 Ga0268266_10200224
781 Ga0268266_10572419
782 Ga0268265_10060264
783 Ga0268264_11093701
784 Ga0307515_10000628
785 Ga0307512_10198908
786 Ga0316177_1146803
787 Ga0316176_1059428
788 Ga0314311_1031246
789 Ga0316178_1111916
790 Ga0316180_1190288
791 Ga0316183_1212063
792 Ga0316182_1166328
793 Ga0265332_10013086
794 Ga0265327_10011171
795 Ga0307513_10217392
796 Ga0307408_100150147
797 Ga0307408_100193229
798 Ga0307514_10047780
799 Ga0307405_10129996
800 Ga0307405_10130681
801 Ga0307405_10452766
802 Ga0307405_10619793
803 Ga0307413_10104973
804 Ga0307406_10003876
805 Ga0307406_10479092
806 Ga0307407_10116129
807 Ga0307412_10105124
808 Ga0307412_10136093
809 Ga0307412_10150893
810 Ga0307412_10306683
811 Ga0307409_100451339
812 Ga0307416_100215742
813 Ga0307416_100358133
814 Ga0307416_101291943
815 Ga0307416_101663776
816 Ga0307414_10737499
817 Ga0307411_10063724
818 Ga0307411_10635683
819 Ga0373925_0882560
820 Ga0395900_0345177
821 Ga0395905_0345312
822 Ga0395905_0358647
823 Ga0395905_0681056
824 Ga0395905_0818735
825 Ga0395901_0090542
826 Ga0395901_0101252
827 Ga0395901_0164471
828 Ga0436361_0968351
829 Ga0439436_0002082
830 Ga0439436_0025063
831 Ga0439439_0013823
832 Ga0439439_0077800
833 Ga0439447_024968
834 Ga0439447_045899
835 Ga0439461_0008900
836 Ga0439461_0029046
837 Ga0439461_0126574
838 Ga0439466_0019659
839 Ga0439466_0022992
840 Ga0439466_0105552
841 Ga0439465_0000776
842 Ga0439465_0043783
843 Ga0451791_0112917
844 Ga0451797_0305433
845 Ga0451795_1510973
846 Ga0451837_0037507
847 Ga0451841_0414732
848 Ga0439431_0003869
849 Ga0439431_0006040
850 Ga0439431_0043437
851 Ga0439433_0001065
852 Ga0439442_002129
853 Ga0439442_049256
854 Ga0439442_083356
855 Ga0439445_0001549
856 Ga0439445_0007002
857 Ga0439432_001320
858 Ga0439432_026408
859 Ga0439449_0000266
860 Ga0439449_0001247
861 Ga0439449_0039410
862 Ga0439449_0105253
863 Ga0439452_007264
864 Ga0439452_009824
865 Ga0439457_002895
866 Ga0439457_021962
867 Ga0439462_0001251
868 Ga0439462_0019071
869 Ga0450920_011530
870 Ga0450923_000384
871 Ga0450923_007453
872 Ga0450896_001037
873 Ga0450898_007197
874 Ga0450906_013074
875 Ga0450910_017575
876 Ga0450910_022532
877 Ga0439446_0025365
878 Ga0439446_0025819
879 Ga0439446_0033419
880 Ga0450908_006751
881 Ga0439434_0007537
882 Ga0439434_0039535
883 Ga0439434_0178619
884 Ga0450918_006518
885 Ga0451577_0006257
886 Ga0451577_0042046
887 Ga0451577_0255441
888 Ga0451577_0753814
889 Ga0453683_0157035
890 Ga0453683_0482960
891 Ga0466965_0048397
892 Ga0453684_0000005
893 Ga0453684_0000512
894 Ga0453684_0000692
895 Ga0453684_1663067
896 Ga0466960_0125779
897 Ga0451576_0000461
898 Ga0451576_0001147
899 Ga0451576_0210371
900 Ga0451576_0393855
901 Ga0451576_0615052
902 Ga0451576_0778998
903 Ga0495627_018930
904 Ga0495629_0250106
905 Ga0495629_0375172
906 Ga0495638_0132484
907 Ga0495639_0002601
908 Ga0495610_0035135
909 Ga0495610_0215951
910 Ga0495616_0004736
911 Ga0495631_0002450
912 Ga0495637_0013851
913 Ga0495637_0183422
914 Ga0495663_0024492
915 Ga0495663_0055153
916 Ga0495642_0107701
917 Ga0495654_0376549
918 Ga0495665_0617052
919 Ga0495587_0272341
920 Ga0495609_0068373
921 Ga0495621_0006742
922 Ga0495621_0182937
923 Ga0495621_0434779
924 Ga0495622_0144986
925 Ga0495656_0001663
926 Ga0495656_0027102
927 Ga0495656_0029722
928 Ga0495668_0217563
929 Ga0495625_0000301
930 Ga0495625_0038284
931 Ga0495659_0286751
932 Ga0495659_0425828
933 Ga0495661_0216629
934 Ga0495661_0520113
935 Ga0495588_0017990
936 Ga0495588_0040267
937 Ga0495646_0357169
938 Ga0495658_0099032
939 Ga0495613_0862978
940 Ga0495624_0108584
941 Ga0495670_0132105
942 Ga0495670_0279023
943 Ga0495671_0008696
944 Ga0495676_0397141
945 Ga0495687_252198
946 Ga0495685_154976
947 Ga0495593_0003865
948 Ga0495593_0288355
949 Ga0495602_0287039
950 Ga0495602_0742866
951 Ga0495614_0088271
952 Ga0495615_0018457
953 Ga0496100_0123364
954 Ga0496101_0020349
955 Ga0496101_0134464
956 Ga0496102_0108629
957 Ga0496103_0109274
958 Ga0496104_0066302
959 Ga0496105_0046143
960 Ga0496105_0475232
961 Ga0496107_0169484
962 Ga0496107_0229457
963 Ga0496108_0273156
964 Ga0496108_1096841
965 Ga0496109_0249204
966 Ga0496109_0420257
967 Ga0496110_0056262
968 Ga0496110_0378569
969 Ga0496111_0044719
970 Ga0496111_0073525
971 Ga0496112_0525217
972 Ga0496113_0162488
973 Ga0496113_1141412
974 Ga0496114_0145055
975 Ga0496116_0043676
976 Ga0496116_0049089
977 Ga0496116_0097410
978 Ga0496117_0028570
979 Ga0496117_0079130
980 Ga0496118_0013068
981 Ga0496118_0015078
982 Ga0496118_0174127
983 Ga0496122_0002359
984 Ga0496122_0059758
985 Ga0496122_0343654
986 Ga0496123_0000108
987 Ga0496123_0032805
988 Ga0496123_0070875
989 Ga0496124_0018958
990 Ga0496124_0121614
991 Ga0496125_0037281
992 Ga0496125_0041569
993 Ga0496126_0038986
994 Ga0496126_0105952
995 Ga0501303_013928
996 Ga0501034_0029804
997 Ga0501034_1441701
998 Ga0501034_1675817
999 Ga0501036_0941788
1000 Ga0501038_0885926
1001 Ga0501043_0033425
1002 Ga0501047_0033428
1003 Ga0501047_0099448
1004 Ga0501199_016158
1005 Ga0501238_059044
1006 Ga0501249_018281
1007 Ga0501257_074681
1008 Ga0501225_0014624
1009 Ga0501080_0054648
1010 Ga0501241_068699
1011 Ga0501262_002081
1012 Ga0501035_0303661
1013 Ga0501044_0130321
1014 nmdc:mga03683_112023_c1
1015 nmdc:mga03683_134253_c1
1016 nmdc:mga03683_282570_c1
1017 nmdc:mga03683_294835_c1
1018 nmdc:mga03n38_11423_c1
1019 nmdc:mga03n38_261404_c1
1020 nmdc:mga03n38_430718_c1
1021 nmdc:mga03n38_467544_c1
1022 nmdc:mga00v17_319066_c1
1023 nmdc:mga00v17_369683_c1
1024 nmdc:mga0yw44_1416_c1
1025 nmdc:mga0yw44_437468_c1
1026 nmdc:mga0yw44_771356_c1
1027 nmdc:mga0k408_119561_c2
1028 nmdc:mga0k408_11989_c1
1029 nmdc:mga0k408_2947_c1
1030 nmdc:mga0k408_35564_c1
1031 nmdc:mga0k408_4556_c1
1032 nmdc:mga06z11_430659_c1
1033 nmdc:mga06z11_44791_c1
1034 nmdc:mga06z11_66220_c1
1035 nmdc:mga07m45_2006_c1
1036 nmdc:mga07m45_355601_c1
1037 nmdc:mga07m45_376929_c1
1038 nmdc:mga07m45_536509_c1
1039 nmdc:mga07m45_584_c1
1040 nmdc:mga07m45_675673_c1
1041 nmdc:mga07m45_8721_c1
1042 Ga0495612_0258950
1043 Ga0500610_0153510
1044 Ga0495655_0032721
1045 Ga0500643_017525
1046 Ga0500646_0058129
1047 Ga0500651_0018395
1048 Ga0500566_0107312
1049 Ga0500562_018162
1050 Ga0500569_046125
1051 Ga0500571_002013
1052 Ga0500593_003991
1053 Ga0500594_0005406
1054 Ga0500607_007699
1055 Ga0500607_050269
1056 Ga0500608_002571
1057 Ga0500608_145172
1058 Ga0500618_029137
1059 Ga0500618_046308
1060 Ga0500626_048905
1061 Ga0500655_001394
1062 Ga0500658_0002731
1063 Ga0500559_0002713
1064 Ga0500559_0042177
1065 Ga0500561_0125799
1066 Ga0500568_0014438
1067 Ga0500573_0040290
1068 Ga0500606_238270
1069 Ga0500616_0020004
1070 Ga0500622_0130021
1071 Ga0500627_0003025
1072 Ga0500634_0051880
1073 Ga0500638_055444
1074 Ga0500636_0008456
1075 Ga0500625_152518
1076 Ga0500596_010632
1077 Ga0501082_0533094
1078 2513228691
1079 2599623749
1080 2599671632
1081 2599681355
1082 2599693242
1083 2644159662
1084 2644327688
1085 2644400363
1086 2644468235
1087 2738717803
1088 2738879418
1089 2739251362
1090 2739278489
1091 2819597292
1092 2831266417
1093 2838057461
1094 2842679983
1095 2842747789
1096 2885192628
1097 2885204553
1098 2885218206
1099 2899924799
1100 2904454364
1101 2904461193
1102 2904548313
1103 2919466102
1104 2928039075
1105 2928045320
1106 2928053125
1107 2928064204
1108 2928071632
1109 2928084417
1110 2928116452
1111 2929163303
1112 2929527076
1113 2945911735
1114 2945948072
1115 2945977261
1116 2945985974
1117 2954772238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

28

155

0.98

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

19

163

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfz-assembly1.cif.gz_B crystal structure of zhui aromatase/cyclase from streptomcyes sp. r1128 0.8579 2 143
3tfz-assembly1.cif.gz_B crystal structure of zhui aromatase/cyclase from streptomcyes sp. r1128 0.8208 2 143
7jta-assembly1.cif.gz_A crystal structure of a putative nuclease with anti-cas9 activity from an uncultured clostridia bacterium 0.8132 34 81
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.8032 2 148
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.7983 2 148
ID Description Score Start End Superfamily
af_P0AGL5_15_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9855 2 147 3.30.530.20
af_P0AGL5_15_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9787 2 147 3.30.530.20
af_Q304F0_1_147_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9214 2 145 3.30.530.20
af_Q8MLL3_83_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9032 2 143 3.30.530.20
af_A0A1D6NAC7_96_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9006 2 146 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A3A3G229-F1-model_v4 Type II toxin-antitoxin system RatA family toxin 0.9948 1 145 GO:0045333
GO:0048039
AF-J2UST8-F1-model_v4 Oligoketide cyclase/lipid transport protein 0.9928 1 145 GO:0045333
GO:0048039
AF-A0A6L8LBS9-F1-model_v4 deleted 0.9926 1 146
AF-A0A1I7M2N0-F1-model_v4 Ribosome association toxin PasT (RatA) of the RatAB toxin-antitoxin module 0.9916 1 147 GO:0045333
GO:0048039
AF-A0A840MNP9-F1-model_v4 Ribosome-associated toxin RatA of RatAB toxin-antitoxin module 0.9915 1 145 GO:0045333
GO:0048039

Map