F463402

General Info

Members Datasets Scaffolds Average Seq Length
558 340 1116 323

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100002296|Ga0068868_1000022966
Length 341
Sequence MIAAAIVGLGRWGRNFVESIQGRSSRLQFVCAVDSAPAKVRDFAARHGLEVRPELAQALGDPQIQAVVIATPHSLHRPMVEASARAGKQVFCEKPLALNIVDATAMIDACDCAAVILGVGHNRRLWPSMQALKRIARSGELGDILHIEGHFSNEHSNNTAGTWRDSPAESPGGGMTGAGLHILDAFINTIGPIQRVSGQLLVLKPPPVPRDVATVLVQFANGVSGTIATVRATPFFWRVHVFGDKGSAESLGEHELVLHKSGVPPQRLVLDPVDALRIELEVFADAIEGKAAFPIARSDMLGTVAAFEAVVKALETDDSVEVQPLPPLDQRNAKFIAGAPR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
267 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
288 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
305 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
306 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
307 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
308 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
309 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
310 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
313 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
314 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
315 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
316 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
317 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
318 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
319 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
320 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
321 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
322 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
323 2904699407
324 2906610324
325 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
326 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
327 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
328 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
329 2922425934
330 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
331 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
332 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
333 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
334 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
335 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
336 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
337 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
338 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
339 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
340 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.2
Nodule 3.94
Rhizoplane 7.17
Rhizosphere 76.7
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100002296 3300005338 Bacteria 13228
2 JGI25406J46586_10000055 3300003203 Bacteria 53491
3 JGI25153J46596_10002074 3300003215 Bacteria 11795
4 rootH1_10193604 3300003316 Bacteria 1230
5 rootH2_10070939 3300003320 Bacteria 3926
6 rootH2_10126105 3300003320 Bacteria 1631
7 JGI25404J52841_10000246 3300003659 Bacteria 6803
8 JGI25404J52841_10002709 3300003659 Bacteria 3394
9 JGI25404J52841_10030992 3300003659 Bacteria 1143
10 Ga0070658_10017720 3300005327 Bacteria 5696
11 Ga0070676_10152529 3300005328 Bacteria 1480
12 Ga0070683_100000231 3300005329 Bacteria 38055
13 Ga0070683_100013594 3300005329 Bacteria 7103
14 Ga0070690_100018721 3300005330 Bacteria 4188
15 Ga0070670_100000483 3300005331 Bacteria 31999
16 Ga0070677_10006444 3300005333 Bacteria 3900
17 Ga0068869_100000209 3300005334 Bacteria 30398
18 Ga0070666_10027623 3300005335 Bacteria 3718
19 Ga0070680_100009146 3300005336 Bacteria 7598
20 Ga0070682_100010902 3300005337 Bacteria 5177
21 Ga0068868_100000421 3300005338 Bacteria 28678
22 Ga0068868_100013027 3300005338 Bacteria 6087
23 Ga0068868_100057526 3300005338 Bacteria 3072
24 Ga0070689_100000715 3300005340 Bacteria 20226
25 Ga0070691_10002903 3300005341 Bacteria 7684
26 Ga0070687_100007507 3300005343 Bacteria 4551
27 Ga0070661_100002938 3300005344 Bacteria 11761
28 Ga0070661_100017966 3300005344 Bacteria 5023
29 Ga0070661_100124636 3300005344 Bacteria 1932
30 Ga0070669_100202777 3300005353 Bacteria 1561
31 Ga0070669_100207505 3300005353 Bacteria 1544
32 Ga0070675_100023339 3300005354 Bacteria 4945
33 Ga0070673_100029676 3300005364 Bacteria 4080
34 Ga0070673_100251274 3300005364 Bacteria 1541
35 Ga0070688_100274604 3300005365 Bacteria 1209
36 Ga0070667_100020630 3300005367 Bacteria 5471
37 Ga0070709_10000424 3300005434 Bacteria 25604
38 Ga0070709_10021383 3300005434 Bacteria 3767
39 Ga0070714_100003678 3300005435 Bacteria 11483
40 Ga0070714_100386643 3300005435 Unclassified 1320
41 Ga0070713_100002079 3300005436 Bacteria 12939
42 Ga0070713_100027367 3300005436 Bacteria 4488
43 Ga0070713_100027428 3300005436 Bacteria 4484
44 Ga0070713_100027565 3300005436 Bacteria 4474
45 Ga0070713_100123924 3300005436 Bacteria 2270
46 Ga0070710_10002647 3300005437 Bacteria 8509
47 Ga0070701_10000474 3300005438 Bacteria 13761
48 Ga0070711_100001539 3300005439 Bacteria 12700
49 Ga0070711_100042101 3300005439 Bacteria 3086
50 Ga0070711_100252123 3300005439 Bacteria 1385
51 Ga0070711_100377248 3300005439 Bacteria 1146
52 Ga0070705_100103550 3300005440 Bacteria 1803
53 Ga0070694_100003366 3300005444 Bacteria 9577
54 Ga0070663_100002382 3300005455 Bacteria 10569
55 Ga0070678_100006425 3300005456 Bacteria 6898
56 Ga0070678_100008841 3300005456 Bacteria 6059
57 Ga0070678_100049651 3300005456 Bacteria 3029
58 Ga0070678_100091720 3300005456 Bacteria 2332
59 Ga0070678_100174132 3300005456 Bacteria 1755
60 Ga0070681_10022307 3300005458 Bacteria 6356
61 Ga0070681_10027692 3300005458 Bacteria 5697
62 Ga0070681_10092471 3300005458 Bacteria 2974
63 Ga0070681_10184962 3300005458 Bacteria 2004
64 Ga0070681_10255005 3300005458 Bacteria 1666
65 Ga0070706_100310355 3300005467 Bacteria 1471
66 Ga0070706_100350890 3300005467 Bacteria 1375
67 Ga0070699_100121318 3300005518 Bacteria 2299
68 Ga0070699_100261346 3300005518 Bacteria 1548
69 Ga0070679_100022460 3300005530 Bacteria 6166
70 Ga0070679_100069489 3300005530 Bacteria 3512
71 Ga0070679_100374753 3300005530 Bacteria 1370
72 Ga0070684_100030885 3300005535 Bacteria 4556
73 Ga0070684_100060146 3300005535 Bacteria 3322
74 Ga0070684_100112823 3300005535 Bacteria 2439
75 Ga0068853_100031988 3300005539 Bacteria 4454
76 Ga0068853_100065851 3300005539 Bacteria 3144
77 Ga0068853_100323421 3300005539 Bacteria 1430
78 Ga0070672_100002063 3300005543 Bacteria 12654
79 Ga0070672_100078570 3300005543 Bacteria 2640
80 Ga0070672_100213406 3300005543 Bacteria 1617
81 Ga0070672_100233805 3300005543 Bacteria 1545
82 Ga0070686_100016583 3300005544 Bacteria 4287
83 Ga0070695_100002310 3300005545 Bacteria 10933
84 Ga0070695_100148230 3300005545 Bacteria 1635
85 Ga0070696_100001500 3300005546 Bacteria 15319
86 Ga0070693_100000171 3300005547 Bacteria 29969
87 Ga0070693_100143409 3300005547 Bacteria 1506
88 Ga0070665_100048781 3300005548 Bacteria 4250
89 Ga0070665_100083630 3300005548 Bacteria 3196
90 Ga0070704_100002324 3300005549 Bacteria 10648
91 Ga0068855_100019660 3300005563 Bacteria 8111
92 Ga0068855_100059576 3300005563 Bacteria 4467
93 Ga0070664_100080344 3300005564 Bacteria 2808
94 Ga0068857_100074554 3300005577 Bacteria 3024
95 Ga0068857_100264714 3300005577 Bacteria 1579
96 Ga0068854_100000817 3300005578 Bacteria 18611
97 Ga0068854_100010030 3300005578 Bacteria 6134
98 Ga0068854_100011066 3300005578 Bacteria 5856
99 Ga0068856_100000050 3300005614 Bacteria 108220
100 Ga0070702_100000148 3300005615 Bacteria 21963
101 Ga0070702_100050097 3300005615 Unclassified 2384
102 Ga0070702_100128584 3300005615 Bacteria 1597
103 Ga0068852_100001250 3300005616 Bacteria 16933
104 Ga0068852_100010934 3300005616 Bacteria 6802
105 Ga0068852_100194949 3300005616 Bacteria 1914
106 Ga0068859_100000935 3300005617 Bacteria 29960
107 Ga0068859_100433673 3300005617 Bacteria 1410
108 Ga0068864_100020901 3300005618 Bacteria 5479
109 Ga0068864_100067205 3300005618 Bacteria 3112
110 Ga0068864_100068335 3300005618 Bacteria 3087
111 Ga0068864_100075310 3300005618 Bacteria 2947
112 Ga0068866_10000302 3300005718 Bacteria 23469
113 Ga0068861_100000070 3300005719 Bacteria 49394
114 Ga0068851_10031836 3300005834 Bacteria 2622
115 Ga0068851_10034654 3300005834 Bacteria 2520
116 Ga0068863_100184539 3300005841 Bacteria 2003
117 Ga0068858_100029840 3300005842 Bacteria 5066
118 Ga0068858_100125115 3300005842 Bacteria 2406
119 Ga0068862_100016181 3300005844 Bacteria 6203
120 Ga0081540_1003513 3300005983 Bacteria 12370
121 Ga0081540_1006839 3300005983 Bacteria 8234
122 Ga0081540_1009084 3300005983 Bacteria 6868
123 Ga0081540_1019287 3300005983 Bacteria 4152
124 Ga0081539_10000099 3300005985 Bacteria 201018
125 Ga0081539_10057201 3300005985 Bacteria 2160
126 Ga0070717_10003119 3300006028 Bacteria 11831
127 Ga0075365_10032272 3300006038 Bacteria 3364
128 Ga0075364_10131709 3300006051 Bacteria 1678
129 Ga0070715_10009656 3300006163 Bacteria 3409
130 Ga0070716_100006553 3300006173 Bacteria 5692
131 Ga0070716_100200061 3300006173 Bacteria 1327
132 Ga0070712_100013416 3300006175 Bacteria 5237
133 Ga0070712_100103936 3300006175 Bacteria 2107
134 Ga0075367_10017351 3300006178 Bacteria 3950
135 Ga0075367_10233593 3300006178 Bacteria 1152
136 Ga0075369_10134644 3300006186 Bacteria 1124
137 Ga0097621_100008507 3300006237 Bacteria 7389
138 Ga0097621_100232942 3300006237 Unclassified 1608
139 Ga0068871_100011838 3300006358 Bacteria 6413
140 Ga0068871_100069953 3300006358 Bacteria 2883
141 Ga0075428_100005164 3300006844 Bacteria 14510
142 Ga0075428_100395084 3300006844 Bacteria 1482
143 Ga0075431_100028301 3300006847 Bacteria 5756
144 Ga0075433_10004777 3300006852 Bacteria 10573
145 Ga0075433_10377827 3300006852 Bacteria 1251
146 Ga0075434_100029480 3300006871 Bacteria 5401
147 Ga0075434_100036505 3300006871 Bacteria 4862
148 Ga0075434_100235499 3300006871 Bacteria 1851
149 Ga0075429_100000076 3300006880 Bacteria 49832
150 Ga0068865_100000242 3300006881 Bacteria 30369
151 Ga0068865_100056493 3300006881 Bacteria 2735
152 Ga0068865_100283580 3300006881 Bacteria 1319
153 Ga0075436_100015097 3300006914 Bacteria 5293
154 Ga0075436_100089116 3300006914 Bacteria 2144
155 Ga0097620_100000935 3300006931 Bacteria 29960
156 Ga0097620_100433675 3300006931 Bacteria 1410
157 Ga0075435_100008614 3300007076 Bacteria 7330
158 Ga0075435_100288330 3300007076 Bacteria 1402
159 Ga0099795_10002092 3300007788 Bacteria 4592
160 Ga0105240_10002325 3300009093 Bacteria 30753
161 Ga0105240_10010045 3300009093 Bacteria 13330
162 Ga0111539_10025280 3300009094 Bacteria 7279
163 Ga0111539_10035641 3300009094 Bacteria 6023
164 Ga0105245_10001017 3300009098 Bacteria 25471
165 Ga0105245_10041992 3300009098 Bacteria 4079
166 Ga0105245_10204773 3300009098 Bacteria 1896
167 Ga0105247_10047431 3300009101 Bacteria 2638
168 Ga0114129_10000791 3300009147 Bacteria 40561
169 Ga0105243_10339277 3300009148 Bacteria 1376
170 Ga0105241_10010156 3300009174 Bacteria 6914
171 Ga0105241_10024479 3300009174 Bacteria 4483
172 Ga0105242_10000161 3300009176 Bacteria 50082
173 Ga0105248_10055853 3300009177 Bacteria 4430
174 Ga0105248_10058672 3300009177 Bacteria 4322
175 Ga0105248_10067440 3300009177 Bacteria 4017
176 Ga0105248_10306386 3300009177 Bacteria 1789
177 Ga0105237_10110823 3300009545 Bacteria 2736
178 Ga0105237_10195326 3300009545 Bacteria 2023
179 Ga0105238_10030273 3300009551 Bacteria 5509
180 Ga0105238_10060119 3300009551 Bacteria 3805
181 Ga0105249_10001161 3300009553 Bacteria 23275
182 Ga0105249_10313539 3300009553 Bacteria 1578
183 Ga0099796_10006938 3300010159 Bacteria 2931
184 Ga0105239_10077897 3300010375 Bacteria 3648
185 Ga0105239_10306722 3300010375 Bacteria 1788
186 Ga0105246_10014606 3300011119 Bacteria 4942
187 Ga0105246_10018977 3300011119 Bacteria 4387
188 Ga0157369_10006757 3300013105 Bacteria 13240
189 Ga0157369_10112143 3300013105 Bacteria 2898
190 Ga0157369_10592611 3300013105 Bacteria 1145
191 Ga0157374_10018845 3300013296 Bacteria 6100
192 Ga0157374_10020612 3300013296 Bacteria 5854
193 Ga0157374_10040848 3300013296 Bacteria 4273
194 Ga0157374_10046763 3300013296 Bacteria 4009
195 Ga0157378_10011956 3300013297 Bacteria 7601
196 Ga0157378_10013619 3300013297 Bacteria 7111
197 Ga0157378_10016653 3300013297 Bacteria 6440
198 Ga0157378_10055754 3300013297 Bacteria 3521
199 Ga0157378_10578230 3300013297 Bacteria 1132
200 Ga0163162_10006849 3300013306 Bacteria 11059
201 Ga0163162_10011613 3300013306 Bacteria 8587
202 Ga0157375_10075196 3300013308 Bacteria 3402
203 Ga0157375_10197658 3300013308 Bacteria 2166
204 Ga0157375_10201540 3300013308 Bacteria 2146
205 Ga0163163_10078447 3300014325 Bacteria 3299
206 Ga0157380_10424950 3300014326 Bacteria 1268
207 Ga0157377_10070586 3300014745 Bacteria 2018
208 Ga0157379_10420572 3300014968 Bacteria 1231
209 Ga0157376_10006789 3300014969 Bacteria 8104
210 Ga0157376_10063346 3300014969 Bacteria 3114
211 Ga0157376_10166337 3300014969 Bacteria 2004
212 Ga0213876_10012456 3300021384 Bacteria 4526
213 Ga0213876_10033436 3300021384 Bacteria 2712
214 Ga0213871_10004227 3300021441 Bacteria 2855
215 Ga0209233_1007398 3300025261 Bacteria 3482
216 Ga0209758_1001548 3300025297 Bacteria 26409
217 Ga0209758_1003559 3300025297 Bacteria 14009
218 Ga0207692_10002831 3300025898 Bacteria 6701
219 Ga0207642_10000915 3300025899 Bacteria 9230
220 Ga0207710_10041898 3300025900 Bacteria 2032
221 Ga0207688_10020422 3300025901 Bacteria 3617
222 Ga0207680_10139203 3300025903 Bacteria 1608
223 Ga0207647_10033932 3300025904 Bacteria 3262
224 Ga0207699_10000465 3300025906 Bacteria 20602
225 Ga0207699_10209330 3300025906 Bacteria 1325
226 Ga0207643_10054183 3300025908 Bacteria 2279
227 Ga0207705_10043050 3300025909 Bacteria 3243
228 Ga0207654_10005466 3300025911 Bacteria 6428
229 Ga0207654_10052799 3300025911 Bacteria 2344
230 Ga0207707_10011648 3300025912 Bacteria 7654
231 Ga0207707_10027111 3300025912 Bacteria 5009
232 Ga0207707_10073078 3300025912 Bacteria 2990
233 Ga0207695_10018383 3300025913 Bacteria 8084
234 Ga0207695_10037142 3300025913 Bacteria 5257
235 Ga0207671_10220440 3300025914 Bacteria 1486
236 Ga0207693_10010304 3300025915 Bacteria 7586
237 Ga0207693_10056391 3300025915 Bacteria 3080
238 Ga0207663_10002729 3300025916 Bacteria 8511
239 Ga0207663_10302345 3300025916 Bacteria 1196
240 Ga0207660_10050171 3300025917 Bacteria 2962
241 Ga0207662_10000479 3300025918 Bacteria 17918
242 Ga0207657_10257945 3300025919 Bacteria 1388
243 Ga0207649_10004750 3300025920 Bacteria 7351
244 Ga0207649_10027067 3300025920 Unclassified 3361
245 Ga0207649_10047609 3300025920 Bacteria 2640
246 Ga0207652_10038136 3300025921 Bacteria 4071
247 Ga0207652_10046281 3300025921 Bacteria 3711
248 Ga0207694_10130159 3300025924 Bacteria 2017
249 Ga0207650_10039634 3300025925 Bacteria 3443
250 Ga0207659_10060612 3300025926 Bacteria 2724
251 Ga0207687_10018423 3300025927 Bacteria 4609
252 Ga0207687_10045691 3300025927 Bacteria 3028
253 Ga0207700_10019795 3300025928 Bacteria 4553
254 Ga0207700_10031733 3300025928 Bacteria 3757
255 Ga0207700_10076568 3300025928 Bacteria 2596
256 Ga0207664_10003614 3300025929 Bacteria 10348
257 Ga0207664_10190159 3300025929 Bacteria 1767
258 Ga0207644_10000952 3300025931 Bacteria 18491
259 Ga0207706_10035137 3300025933 Bacteria 4458
260 Ga0207706_10136261 3300025933 Bacteria 2160
261 Ga0207704_10045442 3300025938 Bacteria 2609
262 Ga0207665_10002891 3300025939 Bacteria 11523
263 Ga0207665_10050922 3300025939 Bacteria 2786
264 Ga0207665_10058853 3300025939 Bacteria 2599
265 Ga0207665_10143092 3300025939 Bacteria 1707
266 Ga0207691_10001135 3300025940 Bacteria 26436
267 Ga0207691_10001148 3300025940 Bacteria 26279
268 Ga0207691_10213892 3300025940 Bacteria 1674
269 Ga0207689_10000200 3300025942 Bacteria 52703
270 Ga0207689_10162544 3300025942 Bacteria 1840
271 Ga0207661_10000171 3300025944 Bacteria 41708
272 Ga0207661_10031842 3300025944 Bacteria 4079
273 Ga0207661_10053261 3300025944 Bacteria 3237
274 Ga0207667_10018732 3300025949 Bacteria 7753
275 Ga0207667_10124613 3300025949 Bacteria 2654
276 Ga0207667_10195105 3300025949 Bacteria 2077
277 Ga0207651_10025300 3300025960 Bacteria 3688
278 Ga0207651_10095489 3300025960 Bacteria 2189
279 Ga0207640_10008663 3300025981 Bacteria 5656
280 Ga0207658_10024972 3300025986 Unclassified 4182
281 Ga0207677_10005099 3300026023 Bacteria 7104
282 Ga0207677_10011474 3300026023 Bacteria 5057
283 Ga0207677_10016625 3300026023 Bacteria 4363
284 Ga0207639_10399153 3300026041 Bacteria 1238
285 Ga0207678_10006898 3300026067 Bacteria 10076
286 Ga0207678_10021269 3300026067 Bacteria 5688
287 Ga0207708_10010915 3300026075 Bacteria 6756
288 Ga0207708_10023173 3300026075 Bacteria 4691
289 Ga0207702_10000197 3300026078 Bacteria 71667
290 Ga0207702_10027012 3300026078 Bacteria 4766
291 Ga0207702_10099284 3300026078 Bacteria 2566
292 Ga0207641_10183916 3300026088 Bacteria 1916
293 Ga0207648_10000309 3300026089 Bacteria 53487
294 Ga0207648_10044862 3300026089 Bacteria 3879
295 Ga0207676_10028620 3300026095 Bacteria 4164
296 Ga0207676_10051385 3300026095 Bacteria 3218
297 Ga0207676_10079630 3300026095 Bacteria 2657
298 Ga0207674_10052339 3300026116 Bacteria 4164
299 Ga0207674_10064035 3300026116 Bacteria 3709
300 Ga0207675_100000089 3300026118 Bacteria 71258
301 Ga0207675_100118415 3300026118 Bacteria 2504
302 Ga0207683_10000394 3300026121 Bacteria 40159
303 Ga0207683_10002585 3300026121 Bacteria 15810
304 Ga0207683_10016918 3300026121 Bacteria 6206
305 Ga0207683_10028440 3300026121 Bacteria 4833
306 Ga0207698_10004691 3300026142 Bacteria 8357
307 Ga0207698_10010354 3300026142 Bacteria 5984
308 Ga0209179_1005792 3300027512 Bacteria 1955
309 Ga0209179_1008352 3300027512 Bacteria 1743
310 Ga0209588_1026355 3300027671 Bacteria 1845
311 Ga0207428_10032207 3300027907 Bacteria 4314
312 Ga0268266_10190707 3300028379 Bacteria 1871
313 Ga0268266_10214921 3300028379 Bacteria 1765
314 Ga0268265_10004854 3300028380 Bacteria 9267
315 Ga0268264_10007668 3300028381 Bacteria 8994
316 Ga0307517_10000176 3300028786 Bacteria 105402
317 Ga0307515_10066782 3300028794 Bacteria 4974
318 Ga0307513_10161171 3300031456 Bacteria 2136
319 Ga0307509_10059514 3300031507 Bacteria 4042
320 Ga0307508_10000010 3300031616 Bacteria 255747
321 Ga0307508_10125163 3300031616 Bacteria 2173
322 Ga0265342_10037664 3300031712 Bacteria 2948
323 Ga0307516_10002258 3300031730 Bacteria 25998
324 Ga0307510_10015952 3300033180 Bacteria 8878
325 Ga0307510_10048000 3300033180 Bacteria 4562
326 Ga0315911_1000021 3300033442 Bacteria 124874
327 Ga0373948_0014463 3300034817 Bacteria 1438
328 Ga0373938_0003415 3300034957 Bacteria 2604
329 Ga0373928_0001224 3300035084 Bacteria 5054
330 Ga0373929_0007616 3300035085 Bacteria 1981
331 Ga0373944_0002230 3300035089 Bacteria 4924
332 Ga0373949_0004642 3300035090 Bacteria 3126
333 Ga0373951_0011388 3300035091 Bacteria 1996
334 Ga0373923_0006241 3300035111 Bacteria 4104
335 Ga0373932_0001885 3300035112 Bacteria 5604
336 Ga0373932_0078064 3300035112 Bacteria 1040
337 Ga0373936_0008287 3300035113 Bacteria 3908
338 Ga0373936_0038592 3300035113 Bacteria 1910
339 Ga0373939_0008768 3300035114 Bacteria 2488
340 Ga0373941_0063275 3300035115 Bacteria 1209
341 Ga0373954_0001425 3300035118 Bacteria 9690
342 Ga0373943_0030923 3300035170 Bacteria 2538
343 Ga0373946_0001451 3300035171 Bacteria 8248
344 Ga0373955_0000039 3300035172 Bacteria 51994
345 Ga0373924_0001219 3300035410 Bacteria 8246
346 Ga0373931_0000382 3300035691 Bacteria 18245
347 Ga0373931_0024001 3300035691 Bacteria 3084
348 Ga0373931_0130632 3300035691 Bacteria 1445
349 Ga0373935_0000079 3300035692 Bacteria 41989
350 Ga0373935_0008975 3300035692 Bacteria 5982
351 Ga0373935_0038428 3300035692 Bacteria 2997
352 Ga0373927_0003959 3300035695 Bacteria 10487
353 Ga0373933_0094758 3300035724 Bacteria 1846
354 Ga0373947_0025796 3300035725 Bacteria 3428
355 Ga0373947_0043947 3300035725 Bacteria 2669
356 Ga0373937_0000223 3300036401 Bacteria 54957
357 Ga0373925_0024592 3300037068 Bacteria 4398
358 Ga0373925_0110416 3300037068 Bacteria 2124
359 Ga0373925_0132792 3300037068 Bacteria 1942
360 Ga0395900_0002176 3300037418 Bacteria 21908
361 Ga0395898_0007877 3300037466 Bacteria 11302
362 Ga0395901_0049939 3300038443 Bacteria 4347
363 Ga0436365_0048683 3300039437 Bacteria 3549
364 Ga0436365_0369584 3300039437 Bacteria 2871
365 Ga0436365_0471439 3300039437 Bacteria 6102
366 Ga0436361_0712458 3300039447 Bacteria 1681
367 Ga0451804_0530045 3300041463 Bacteria 1017
368 Ga0451576_0008674 3300045051 Bacteria 11902
369 Ga0451576_0042539 3300045051 Bacteria 4795
370 Ga0466967_0006713 3300045976 Bacteria 8186
371 Ga0495592_0000188 3300046454 Bacteria 54485
372 Ga0495603_0039830 3300046455 Bacteria 2814
373 Ga0495629_0011719 3300046459 Bacteria 6363
374 Ga0495651_0002458 3300046462 Bacteria 14320
375 Ga0495653_0000198 3300046463 Bacteria 49009
376 Ga0495650_0021431 3300046471 Bacteria 3124
377 Ga0495580_0109887 3300046472 Bacteria 1914
378 Ga0495582_0021405 3300046473 Bacteria 3539
379 Ga0495582_0023222 3300046473 Bacteria 3393
380 Ga0495582_0070469 3300046473 Bacteria 1934
381 Ga0495605_0116753 3300046474 Bacteria 1213
382 Ga0495639_0043039 3300046475 Bacteria 2039
383 Ga0495662_0018539 3300046476 Bacteria 3369
384 Ga0495664_0000002 3300046477 Bacteria 625183
385 Ga0495664_0096816 3300046477 Bacteria 1776
386 Ga0495585_0211564 3300046492 Bacteria 982
387 Ga0495583_0053662 3300046506 Bacteria 1828
388 Ga0495606_0004285 3300046507 Bacteria 14375
389 Ga0495606_0214427 3300046507 Bacteria 1088
390 Ga0495608_0000009 3300046511 Bacteria 266614
391 Ga0495618_0000005 3300046514 Bacteria 230421
392 Ga0495628_0000002 3300046516 Bacteria 589399
393 Ga0495630_0000614 3300046517 Bacteria 25848
394 Ga0495631_0032424 3300046518 Bacteria 2356
395 Ga0495642_0058918 3300046528 Bacteria 1591
396 Ga0495652_0000004 3300046529 Bacteria 588877
397 Ga0495652_0220081 3300046529 Bacteria 1427
398 Ga0495640_0000005 3300046533 Bacteria 318271
399 Ga0495640_0017041 3300046533 Bacteria 5422
400 Ga0495586_0066302 3300046535 Bacteria 1968
401 Ga0495587_0000007 3300046536 Bacteria 290788
402 Ga0495598_0011778 3300046537 Bacteria 2128
403 Ga0495621_0036090 3300046539 Bacteria 1714
404 Ga0495645_0000003 3300046543 Bacteria 570133
405 Ga0495667_0000002 3300046559 Bacteria 437535
406 Ga0495668_0055836 3300046616 Bacteria 2180
407 Ga0495668_0092593 3300046616 Bacteria 1655
408 Ga0495634_0000129 3300046642 Bacteria 65082
409 Ga0495611_0096736 3300046648 Bacteria 1367
410 Ga0495635_0000020 3300046663 Bacteria 189698
411 Ga0495659_0044964 3300046664 Bacteria 1589
412 Ga0495657_0001085 3300046675 Bacteria 23868
413 Ga0495599_0000001 3300046678 Bacteria 537563
414 Ga0495599_0026555 3300046678 Bacteria 3629
415 Ga0495623_0000001 3300046679 Bacteria 313861
416 Ga0495646_0000013 3300046680 Bacteria 159700
417 Ga0495658_0006188 3300046683 Bacteria 5876
418 Ga0495669_0049487 3300046684 Bacteria 1882
419 Ga0495613_0149976 3300046689 Bacteria 1663
420 Ga0495671_0044087 3300046692 Bacteria 2237
421 Ga0495600_0000233 3300046809 Bacteria 30755
422 Ga0495660_0140405 3300046810 Bacteria 1203
423 Ga0495581_0015024 3300047315 Bacteria 4493
424 Ga0495581_0040858 3300047315 Bacteria 2683
425 Ga0495604_0000005 3300047317 Bacteria 424516
426 Ga0495604_0257304 3300047317 Bacteria 1188
427 Ga0495636_0080415 3300047318 Bacteria 1403
428 Ga0495674_0000003 3300047319 Bacteria 562126
429 Ga0495676_0029671 3300047321 Bacteria 4655
430 Ga0495676_0065117 3300047321 Bacteria 2830
431 Ga0495680_0000002 3300047322 Bacteria 197533
432 Ga0495675_0000437 3300047444 Bacteria 27820
433 Ga0495677_0029328 3300047445 Bacteria 2000
434 Ga0495684_0000020 3300047471 Bacteria 148507
435 Ga0495593_0002594 3300047673 Bacteria 10863
436 Ga0495602_0000027 3300048088 Bacteria 145010
437 Ga0495615_0015884 3300048090 Bacteria 1615
438 Ga0495626_0072954 3300048091 Bacteria 1538
439 Ga0496102_0004248 3300048905 Bacteria 12114
440 Ga0496102_0087834 3300048905 Bacteria 2873
441 Ga0496102_0285414 3300048905 Bacteria 1556
442 Ga0496103_0053347 3300048906 Bacteria 2506
443 Ga0496104_0005391 3300048907 Bacteria 11192
444 Ga0496104_0126046 3300048907 Bacteria 2459
445 Ga0496104_0210467 3300048907 Bacteria 1856
446 Ga0496105_0013172 3300048908 Bacteria 6558
447 Ga0496105_0032482 3300048908 Bacteria 4283
448 Ga0496105_0125823 3300048908 Bacteria 2113
449 Ga0496106_0022992 3300048909 Bacteria 4630
450 Ga0496107_0068099 3300048910 Bacteria 2583
451 Ga0496107_0092140 3300048910 Bacteria 2215
452 Ga0496107_0212871 3300048910 Bacteria 1437
453 Ga0496108_0016448 3300048911 Bacteria 6034
454 Ga0496108_0017041 3300048911 Bacteria 5939
455 Ga0496108_0041273 3300048911 Bacteria 3851
456 Ga0496108_0167200 3300048911 Bacteria 1902
457 Ga0496109_0060596 3300048912 Bacteria 3458
458 Ga0496109_0094349 3300048912 Unclassified 2770
459 Ga0496110_0020609 3300048913 Bacteria 5569
460 Ga0496110_0022757 3300048913 Bacteria 5325
461 Ga0496111_0021072 3300048914 Bacteria 4547
462 Ga0496111_0042142 3300048914 Bacteria 3277
463 Ga0496112_0000022 3300048915 Bacteria 156255
464 Ga0496112_0032119 3300048915 Bacteria 5096
465 Ga0496112_0090191 3300048915 Bacteria 3034
466 Ga0496112_0271523 3300048915 Bacteria 1644
467 Ga0496113_0005038 3300048916 Bacteria 8196
468 Ga0496113_0031877 3300048916 Bacteria 3829
469 Ga0496114_0019749 3300048917 Bacteria 5462
470 Ga0496114_0185263 3300048917 Bacteria 1819
471 Ga0496115_0016156 3300048918 Bacteria 5677
472 Ga0496115_0017856 3300048918 Bacteria 5434
473 Ga0496115_0114303 3300048918 Bacteria 2218
474 Ga0496115_0133835 3300048918 Bacteria 2044
475 Ga0496115_0148099 3300048918 Bacteria 1938
476 Ga0496115_0350716 3300048918 Bacteria 1204
477 Ga0496116_0118262 3300048919 Bacteria 1540
478 Ga0496117_0020159 3300048920 Bacteria 5447
479 Ga0496118_0091652 3300048921 Bacteria 2089
480 Ga0496121_0007863 3300048924 Bacteria 12751
481 Ga0496121_0036348 3300048924 Bacteria 4390
482 Ga0496121_0076117 3300048924 Bacteria 2677
483 Ga0496121_0087966 3300048924 Bacteria 2437
484 Ga0496121_0093674 3300048924 Bacteria 2338
485 Ga0496121_0166191 3300048924 Bacteria 1608
486 Ga0496126_0003659 3300048929 Bacteria 19203
487 Ga0496126_0018235 3300048929 Bacteria 6964
488 Ga0496126_0018612 3300048929 Bacteria 6875
489 Ga0496126_0049071 3300048929 Bacteria 3855
490 Ga0496126_0053907 3300048929 Bacteria 3646
491 Ga0496126_0085826 3300048929 Bacteria 2774
492 Ga0495678_048156 3300049459 Bacteria 1664
493 nmdc:mga03683_196161_c1 3300050489 Bacteria 925
494 nmdc:mga00v17_151582_c1 3300050491 Bacteria 1490
495 nmdc:mga0k408_334232_c1 3300050493 Bacteria 904
496 nmdc:mga06z11_10653_c1 3300050494 Bacteria 3927
497 nmdc:mga06z11_166215_c1 3300050494 Bacteria 1264
498 nmdc:mga06z11_167933_c1 3300050494 Bacteria 1258
499 nmdc:mga07m45_66951_c1 3300050496 Bacteria 2041
500 nmdc:mga05p37_72_c1 3300050507 Bacteria 88725
501 nmdc:mga09592_23529_c1 3300050508 Bacteria 5089
502 nmdc:mga09592_344494_c1 3300050508 Unclassified 1290
503 nmdc:mga08y16_1292_c1 3300050511 Bacteria 24852
504 nmdc:mga08y16_30761_c1 3300050511 Bacteria 5646
505 nmdc:mga0n895_13530_c1 3300050512 Bacteria 7368
506 nmdc:mga0n895_41575_c1 3300050512 Bacteria 4470
507 nmdc:mga0rr50_8399_c1 3300050513 Bacteria 6427
508 nmdc:mga08x19_1264_c1 3300050514 Bacteria 15694
509 nmdc:mga08x19_251797_c1 3300050514 Unclassified 1219
510 nmdc:mga08x19_6223_c1 3300050514 Bacteria 7062
511 nmdc:mga0a205_3813_c2 3300050515 Bacteria 1444
512 nmdc:mga0a205_491861_c1 3300050515 Bacteria 1084
513 Ga0495601_0000010 3300053077 Bacteria 266222
514 Ga0495612_0000002 3300053078 Bacteria 310466
515 Ga0495612_0004649 3300053078 Bacteria 5685
516 Ga0495619_0000002 3300053085 Bacteria 530226
517 Ga0500651_0012996 3300053093 Bacteria 5058
518 Ga0500562_048412 3300053108 Bacteria 1135
519 Ga0500595_001119 3300053119 Bacteria 14871
520 Ga0500595_001755 3300053119 Bacteria 11291
521 Ga0500595_002858 3300053119 Bacteria 8301
522 Ga0500595_021683 3300053119 Bacteria 2289
523 Ga0500642_0008355 3300053130 Bacteria 3538
524 Ga0500642_0057496 3300053130 Bacteria 1735
525 Ga0500577_0097650 3300053142 Bacteria 1196
526 Ga0500603_004628 3300053150 Bacteria 2947
527 Ga0500604_0010002 3300053151 Bacteria 2533
528 Ga0500638_001009 3300053162 Bacteria 8154
529 Ga0500637_0005981 3300053178 Bacteria 5944
530 2513661031 2513237096 Bacteria 8722461
531 2513857338 2513237137 Bacteria 9558895
532 2513892442 2513237141 Bacteria 8496279
533 2513918957 2513237145 Bacteria 8979722
534 2517888282 2517572143 Bacteria 9484767
535 2524533455 2524023228 Bacteria 10118060
536 2671123372 2667528175 Bacteria 7532676
537 2793067101 2791355197 Bacteria 8420563
538 2885381387 2885374607 Bacteria 8927485
539 2903756701 2903748898 Bacteria 9972761
540 2904692394 2904690495 Bacteria 9412302
541 2904709793
542 2906614361
543 2906639138 2906635258 Bacteria 8601019
544 2906666705 2906660503 Bacteria 8595048
545 2908746815 2908739725 Bacteria 8628932
546 2908764456 2908756301 Bacteria 8864324
547 2922426188
548 2935632585 2935630451 Bacteria 8169952
549 2941508751 2941507105 Bacteria 8166816
550 2941516581 2941515067 Bacteria 8166720
551 2941524403 2941523033 Bacteria 8169134
552 3005475562 3005474847 Bacteria 9259049
553 3005597699 3005594810 Bacteria 8716512
554 8006936890 8006933436 Bacteria 10410654
555 8006976860 8006973647 Bacteria 10679141
556 8019561791 8019555841 Bacteria 9642137
557 8019571860 8019565922 Bacteria 9639779
558 8056690918 8056689827 Bacteria 6712655
559 Ga0068868_100002296
560 JGI25406J46586_10000055
561 JGI25153J46596_10002074
562 rootH1_10193604
563 rootH2_10070939
564 rootH2_10126105
565 JGI25404J52841_10000246
566 JGI25404J52841_10002709
567 JGI25404J52841_10030992
568 Ga0070658_10017720
569 Ga0070676_10152529
570 Ga0070683_100000231
571 Ga0070683_100013594
572 Ga0070690_100018721
573 Ga0070670_100000483
574 Ga0070677_10006444
575 Ga0068869_100000209
576 Ga0070666_10027623
577 Ga0070680_100009146
578 Ga0070682_100010902
579 Ga0068868_100000421
580 Ga0068868_100013027
581 Ga0068868_100057526
582 Ga0070689_100000715
583 Ga0070691_10002903
584 Ga0070687_100007507
585 Ga0070661_100002938
586 Ga0070661_100017966
587 Ga0070661_100124636
588 Ga0070669_100202777
589 Ga0070669_100207505
590 Ga0070675_100023339
591 Ga0070673_100029676
592 Ga0070673_100251274
593 Ga0070688_100274604
594 Ga0070667_100020630
595 Ga0070709_10000424
596 Ga0070709_10021383
597 Ga0070714_100003678
598 Ga0070714_100386643
599 Ga0070713_100002079
600 Ga0070713_100027367
601 Ga0070713_100027428
602 Ga0070713_100027565
603 Ga0070713_100123924
604 Ga0070710_10002647
605 Ga0070701_10000474
606 Ga0070711_100001539
607 Ga0070711_100042101
608 Ga0070711_100252123
609 Ga0070711_100377248
610 Ga0070705_100103550
611 Ga0070694_100003366
612 Ga0070663_100002382
613 Ga0070678_100006425
614 Ga0070678_100008841
615 Ga0070678_100049651
616 Ga0070678_100091720
617 Ga0070678_100174132
618 Ga0070681_10022307
619 Ga0070681_10027692
620 Ga0070681_10092471
621 Ga0070681_10184962
622 Ga0070681_10255005
623 Ga0070706_100310355
624 Ga0070706_100350890
625 Ga0070699_100121318
626 Ga0070699_100261346
627 Ga0070679_100022460
628 Ga0070679_100069489
629 Ga0070679_100374753
630 Ga0070684_100030885
631 Ga0070684_100060146
632 Ga0070684_100112823
633 Ga0068853_100031988
634 Ga0068853_100065851
635 Ga0068853_100323421
636 Ga0070672_100002063
637 Ga0070672_100078570
638 Ga0070672_100213406
639 Ga0070672_100233805
640 Ga0070686_100016583
641 Ga0070695_100002310
642 Ga0070695_100148230
643 Ga0070696_100001500
644 Ga0070693_100000171
645 Ga0070693_100143409
646 Ga0070665_100048781
647 Ga0070665_100083630
648 Ga0070704_100002324
649 Ga0068855_100019660
650 Ga0068855_100059576
651 Ga0070664_100080344
652 Ga0068857_100074554
653 Ga0068857_100264714
654 Ga0068854_100000817
655 Ga0068854_100010030
656 Ga0068854_100011066
657 Ga0068856_100000050
658 Ga0070702_100000148
659 Ga0070702_100050097
660 Ga0070702_100128584
661 Ga0068852_100001250
662 Ga0068852_100010934
663 Ga0068852_100194949
664 Ga0068859_100000935
665 Ga0068859_100433673
666 Ga0068864_100020901
667 Ga0068864_100067205
668 Ga0068864_100068335
669 Ga0068864_100075310
670 Ga0068866_10000302
671 Ga0068861_100000070
672 Ga0068851_10031836
673 Ga0068851_10034654
674 Ga0068863_100184539
675 Ga0068858_100029840
676 Ga0068858_100125115
677 Ga0068862_100016181
678 Ga0081540_1003513
679 Ga0081540_1006839
680 Ga0081540_1009084
681 Ga0081540_1019287
682 Ga0081539_10000099
683 Ga0081539_10057201
684 Ga0070717_10003119
685 Ga0075365_10032272
686 Ga0075364_10131709
687 Ga0070715_10009656
688 Ga0070716_100006553
689 Ga0070716_100200061
690 Ga0070712_100013416
691 Ga0070712_100103936
692 Ga0075367_10017351
693 Ga0075367_10233593
694 Ga0075369_10134644
695 Ga0097621_100008507
696 Ga0097621_100232942
697 Ga0068871_100011838
698 Ga0068871_100069953
699 Ga0075428_100005164
700 Ga0075428_100395084
701 Ga0075431_100028301
702 Ga0075433_10004777
703 Ga0075433_10377827
704 Ga0075434_100029480
705 Ga0075434_100036505
706 Ga0075434_100235499
707 Ga0075429_100000076
708 Ga0068865_100000242
709 Ga0068865_100056493
710 Ga0068865_100283580
711 Ga0075436_100015097
712 Ga0075436_100089116
713 Ga0097620_100000935
714 Ga0097620_100433675
715 Ga0075435_100008614
716 Ga0075435_100288330
717 Ga0099795_10002092
718 Ga0105240_10002325
719 Ga0105240_10010045
720 Ga0111539_10025280
721 Ga0111539_10035641
722 Ga0105245_10001017
723 Ga0105245_10041992
724 Ga0105245_10204773
725 Ga0105247_10047431
726 Ga0114129_10000791
727 Ga0105243_10339277
728 Ga0105241_10010156
729 Ga0105241_10024479
730 Ga0105242_10000161
731 Ga0105248_10055853
732 Ga0105248_10058672
733 Ga0105248_10067440
734 Ga0105248_10306386
735 Ga0105237_10110823
736 Ga0105237_10195326
737 Ga0105238_10030273
738 Ga0105238_10060119
739 Ga0105249_10001161
740 Ga0105249_10313539
741 Ga0099796_10006938
742 Ga0105239_10077897
743 Ga0105239_10306722
744 Ga0105246_10014606
745 Ga0105246_10018977
746 Ga0157369_10006757
747 Ga0157369_10112143
748 Ga0157369_10592611
749 Ga0157374_10018845
750 Ga0157374_10020612
751 Ga0157374_10040848
752 Ga0157374_10046763
753 Ga0157378_10011956
754 Ga0157378_10013619
755 Ga0157378_10016653
756 Ga0157378_10055754
757 Ga0157378_10578230
758 Ga0163162_10006849
759 Ga0163162_10011613
760 Ga0157375_10075196
761 Ga0157375_10197658
762 Ga0157375_10201540
763 Ga0163163_10078447
764 Ga0157380_10424950
765 Ga0157377_10070586
766 Ga0157379_10420572
767 Ga0157376_10006789
768 Ga0157376_10063346
769 Ga0157376_10166337
770 Ga0213876_10012456
771 Ga0213876_10033436
772 Ga0213871_10004227
773 Ga0209233_1007398
774 Ga0209758_1001548
775 Ga0209758_1003559
776 Ga0207692_10002831
777 Ga0207642_10000915
778 Ga0207710_10041898
779 Ga0207688_10020422
780 Ga0207680_10139203
781 Ga0207647_10033932
782 Ga0207699_10000465
783 Ga0207699_10209330
784 Ga0207643_10054183
785 Ga0207705_10043050
786 Ga0207654_10005466
787 Ga0207654_10052799
788 Ga0207707_10011648
789 Ga0207707_10027111
790 Ga0207707_10073078
791 Ga0207695_10018383
792 Ga0207695_10037142
793 Ga0207671_10220440
794 Ga0207693_10010304
795 Ga0207693_10056391
796 Ga0207663_10002729
797 Ga0207663_10302345
798 Ga0207660_10050171
799 Ga0207662_10000479
800 Ga0207657_10257945
801 Ga0207649_10004750
802 Ga0207649_10027067
803 Ga0207649_10047609
804 Ga0207652_10038136
805 Ga0207652_10046281
806 Ga0207694_10130159
807 Ga0207650_10039634
808 Ga0207659_10060612
809 Ga0207687_10018423
810 Ga0207687_10045691
811 Ga0207700_10019795
812 Ga0207700_10031733
813 Ga0207700_10076568
814 Ga0207664_10003614
815 Ga0207664_10190159
816 Ga0207644_10000952
817 Ga0207706_10035137
818 Ga0207706_10136261
819 Ga0207704_10045442
820 Ga0207665_10002891
821 Ga0207665_10050922
822 Ga0207665_10058853
823 Ga0207665_10143092
824 Ga0207691_10001135
825 Ga0207691_10001148
826 Ga0207691_10213892
827 Ga0207689_10000200
828 Ga0207689_10162544
829 Ga0207661_10000171
830 Ga0207661_10031842
831 Ga0207661_10053261
832 Ga0207667_10018732
833 Ga0207667_10124613
834 Ga0207667_10195105
835 Ga0207651_10025300
836 Ga0207651_10095489
837 Ga0207640_10008663
838 Ga0207658_10024972
839 Ga0207677_10005099
840 Ga0207677_10011474
841 Ga0207677_10016625
842 Ga0207639_10399153
843 Ga0207678_10006898
844 Ga0207678_10021269
845 Ga0207708_10010915
846 Ga0207708_10023173
847 Ga0207702_10000197
848 Ga0207702_10027012
849 Ga0207702_10099284
850 Ga0207641_10183916
851 Ga0207648_10000309
852 Ga0207648_10044862
853 Ga0207676_10028620
854 Ga0207676_10051385
855 Ga0207676_10079630
856 Ga0207674_10052339
857 Ga0207674_10064035
858 Ga0207675_100000089
859 Ga0207675_100118415
860 Ga0207683_10000394
861 Ga0207683_10002585
862 Ga0207683_10016918
863 Ga0207683_10028440
864 Ga0207698_10004691
865 Ga0207698_10010354
866 Ga0209179_1005792
867 Ga0209179_1008352
868 Ga0209588_1026355
869 Ga0207428_10032207
870 Ga0268266_10190707
871 Ga0268266_10214921
872 Ga0268265_10004854
873 Ga0268264_10007668
874 Ga0307517_10000176
875 Ga0307515_10066782
876 Ga0307513_10161171
877 Ga0307509_10059514
878 Ga0307508_10000010
879 Ga0307508_10125163
880 Ga0265342_10037664
881 Ga0307516_10002258
882 Ga0307510_10015952
883 Ga0307510_10048000
884 Ga0315911_1000021
885 Ga0373948_0014463
886 Ga0373938_0003415
887 Ga0373928_0001224
888 Ga0373929_0007616
889 Ga0373944_0002230
890 Ga0373949_0004642
891 Ga0373951_0011388
892 Ga0373923_0006241
893 Ga0373932_0001885
894 Ga0373932_0078064
895 Ga0373936_0008287
896 Ga0373936_0038592
897 Ga0373939_0008768
898 Ga0373941_0063275
899 Ga0373954_0001425
900 Ga0373943_0030923
901 Ga0373946_0001451
902 Ga0373955_0000039
903 Ga0373924_0001219
904 Ga0373931_0000382
905 Ga0373931_0024001
906 Ga0373931_0130632
907 Ga0373935_0000079
908 Ga0373935_0008975
909 Ga0373935_0038428
910 Ga0373927_0003959
911 Ga0373933_0094758
912 Ga0373947_0025796
913 Ga0373947_0043947
914 Ga0373937_0000223
915 Ga0373925_0024592
916 Ga0373925_0110416
917 Ga0373925_0132792
918 Ga0395900_0002176
919 Ga0395898_0007877
920 Ga0395901_0049939
921 Ga0436365_0048683
922 Ga0436365_0369584
923 Ga0436365_0471439
924 Ga0436361_0712458
925 Ga0451804_0530045
926 Ga0451576_0008674
927 Ga0451576_0042539
928 Ga0466967_0006713
929 Ga0495592_0000188
930 Ga0495603_0039830
931 Ga0495629_0011719
932 Ga0495651_0002458
933 Ga0495653_0000198
934 Ga0495650_0021431
935 Ga0495580_0109887
936 Ga0495582_0021405
937 Ga0495582_0023222
938 Ga0495582_0070469
939 Ga0495605_0116753
940 Ga0495639_0043039
941 Ga0495662_0018539
942 Ga0495664_0000002
943 Ga0495664_0096816
944 Ga0495585_0211564
945 Ga0495583_0053662
946 Ga0495606_0004285
947 Ga0495606_0214427
948 Ga0495608_0000009
949 Ga0495618_0000005
950 Ga0495628_0000002
951 Ga0495630_0000614
952 Ga0495631_0032424
953 Ga0495642_0058918
954 Ga0495652_0000004
955 Ga0495652_0220081
956 Ga0495640_0000005
957 Ga0495640_0017041
958 Ga0495586_0066302
959 Ga0495587_0000007
960 Ga0495598_0011778
961 Ga0495621_0036090
962 Ga0495645_0000003
963 Ga0495667_0000002
964 Ga0495668_0055836
965 Ga0495668_0092593
966 Ga0495634_0000129
967 Ga0495611_0096736
968 Ga0495635_0000020
969 Ga0495659_0044964
970 Ga0495657_0001085
971 Ga0495599_0000001
972 Ga0495599_0026555
973 Ga0495623_0000001
974 Ga0495646_0000013
975 Ga0495658_0006188
976 Ga0495669_0049487
977 Ga0495613_0149976
978 Ga0495671_0044087
979 Ga0495600_0000233
980 Ga0495660_0140405
981 Ga0495581_0015024
982 Ga0495581_0040858
983 Ga0495604_0000005
984 Ga0495604_0257304
985 Ga0495636_0080415
986 Ga0495674_0000003
987 Ga0495676_0029671
988 Ga0495676_0065117
989 Ga0495680_0000002
990 Ga0495675_0000437
991 Ga0495677_0029328
992 Ga0495684_0000020
993 Ga0495593_0002594
994 Ga0495602_0000027
995 Ga0495615_0015884
996 Ga0495626_0072954
997 Ga0496102_0004248
998 Ga0496102_0087834
999 Ga0496102_0285414
1000 Ga0496103_0053347
1001 Ga0496104_0005391
1002 Ga0496104_0126046
1003 Ga0496104_0210467
1004 Ga0496105_0013172
1005 Ga0496105_0032482
1006 Ga0496105_0125823
1007 Ga0496106_0022992
1008 Ga0496107_0068099
1009 Ga0496107_0092140
1010 Ga0496107_0212871
1011 Ga0496108_0016448
1012 Ga0496108_0017041
1013 Ga0496108_0041273
1014 Ga0496108_0167200
1015 Ga0496109_0060596
1016 Ga0496109_0094349
1017 Ga0496110_0020609
1018 Ga0496110_0022757
1019 Ga0496111_0021072
1020 Ga0496111_0042142
1021 Ga0496112_0000022
1022 Ga0496112_0032119
1023 Ga0496112_0090191
1024 Ga0496112_0271523
1025 Ga0496113_0005038
1026 Ga0496113_0031877
1027 Ga0496114_0019749
1028 Ga0496114_0185263
1029 Ga0496115_0016156
1030 Ga0496115_0017856
1031 Ga0496115_0114303
1032 Ga0496115_0133835
1033 Ga0496115_0148099
1034 Ga0496115_0350716
1035 Ga0496116_0118262
1036 Ga0496117_0020159
1037 Ga0496118_0091652
1038 Ga0496121_0007863
1039 Ga0496121_0036348
1040 Ga0496121_0076117
1041 Ga0496121_0087966
1042 Ga0496121_0093674
1043 Ga0496121_0166191
1044 Ga0496126_0003659
1045 Ga0496126_0018235
1046 Ga0496126_0018612
1047 Ga0496126_0049071
1048 Ga0496126_0053907
1049 Ga0496126_0085826
1050 Ga0495678_048156
1051 nmdc:mga03683_196161_c1
1052 nmdc:mga00v17_151582_c1
1053 nmdc:mga0k408_334232_c1
1054 nmdc:mga06z11_10653_c1
1055 nmdc:mga06z11_166215_c1
1056 nmdc:mga06z11_167933_c1
1057 nmdc:mga07m45_66951_c1
1058 nmdc:mga05p37_72_c1
1059 nmdc:mga09592_23529_c1
1060 nmdc:mga09592_344494_c1
1061 nmdc:mga08y16_1292_c1
1062 nmdc:mga08y16_30761_c1
1063 nmdc:mga0n895_13530_c1
1064 nmdc:mga0n895_41575_c1
1065 nmdc:mga0rr50_8399_c1
1066 nmdc:mga08x19_1264_c1
1067 nmdc:mga08x19_251797_c1
1068 nmdc:mga08x19_6223_c1
1069 nmdc:mga0a205_3813_c2
1070 nmdc:mga0a205_491861_c1
1071 Ga0495601_0000010
1072 Ga0495612_0000002
1073 Ga0495612_0004649
1074 Ga0495619_0000002
1075 Ga0500651_0012996
1076 Ga0500562_048412
1077 Ga0500595_001119
1078 Ga0500595_001755
1079 Ga0500595_002858
1080 Ga0500595_021683
1081 Ga0500642_0008355
1082 Ga0500642_0057496
1083 Ga0500577_0097650
1084 Ga0500603_004628
1085 Ga0500604_0010002
1086 Ga0500638_001009
1087 Ga0500637_0005981
1088 2513661031
1089 2513857338
1090 2513892442
1091 2513918957
1092 2517888282
1093 2524533455
1094 2671123372
1095 2793067101
1096 2885381387
1097 2903756701
1098 2904692394
1099 2904709793
1100 2906614361
1101 2906639138
1102 2906666705
1103 2908746815
1104 2908764456
1105 2922426188
1106 2935632585
1107 2941508751
1108 2941516581
1109 2941524403
1110 3005475562
1111 3005597699
1112 8006936890
1113 8006976860
1114 8019561791
1115 8019571860
1116 8056690918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

2

121

0.98

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

129

249

0.97

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

133

322

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3db2-assembly1.cif.gz_C-2 crystal structure of a putative nadph-dependent oxidoreductase (dhaf_2064) from desulfitobacterium hafniense dcb-2 at 1.70 a resolution 0.9239 1 323
3db2-assembly2.cif.gz_B crystal structure of a putative nadph-dependent oxidoreductase (dhaf_2064) from desulfitobacterium hafniense dcb-2 at 1.70 a resolution 0.9201 1 323
5yaq-assembly1.cif.gz_D crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose 0.9124 4 322
6a3i-assembly1.cif.gz_B levoglucosan dehydrogenase, complex with nadh and levoglucosan 0.9109 2 324
6o15-assembly1.cif.gz_B crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with nad(h) 0.9108 4 325
ID Description Score Start End Superfamily
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 5 121 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9489 4 121 3.40.50.720
af_P39353_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9458 4 128 3.40.50.720
3moiA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9421 2 121 3.40.50.720
3e18B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9381 2 120 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A836SQT7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9641 3 146 GO:0000166
AF-A0A6L7ZWL5-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9591 2 326 GO:0000166
GO:0016491
AF-A0A7X3RDH1-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9588 2 147 GO:0000166
AF-A0A535DBZ8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.957 4 147 GO:0000166
GO:0003824
AF-A0A432EX25-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9567 1 91 GO:0000166

Map