F463471

General Info

Members Datasets Scaffolds Average Seq Length
558 256 1116 444

Family's Representative Sequence

Representative Sequence 3300042533|Ga0450901_000264|Ga0450901_000264_4201_5601
Length 466
Sequence LISQFENKNEETIMNKVIALGQGLALLACAIALPLHAAVPADQAQRLKGDLTPTGAEKGGNADGSIPAWTGGLTKPTPGDVPGGRRGDPFKDEKPQFSINAQNMAQYAGNLSDGVQAMLKKYPDYRLDVYPTRRTSAAPQWVYDNTFANATRGTLEKGVPQGVYGGIPYPIPQSAEEVMWNHVLRWRGARFQHFNNWYQILADGRAVLVTDAEINEQLPYYDKNSSLEQFQSEGKPFWQVAIRNVGPPLRAGEALLAHEYLDPDKLQTWVYLKGQRRVRKLPNGCCDTPTPAAAGVMTFDEMYTWTGRMDRFDWKMIGKKELFIPYNANRTLQPTKDEDMLKGNFLNPDHVRWEKHRVWVVEANVRSGQRHQAAKSRYYCDEDTWICVLADRWDANGQLWRTLWSQVVVVPELPGSAIASFGYNDLQTGTAFVAQLNNSKPKHYVLKEIDNDKVFSPDGLAGSSVR

Samples

Sample ID Description Type Environment
1 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
109 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
110 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
111 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
114 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
119 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
120 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
121 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
122 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
123 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
124 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
125 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
126 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
127 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
128 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
129 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
130 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
131 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
132 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
133 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
136 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
137 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
147 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
215 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
216 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
217 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
224 2511231012 Pseudomonas sp. GM33 Isolate Nodule
225 2511231015 Pseudomonas sp. GM49 Isolate Nodule
226 2511231020 Pseudomonas sp. GM74 Isolate Nodule
227 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
228 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
229 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
230 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
231 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
232 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
233 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
234 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
235 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
236 2643221611 Acidovorax sp. Root219 Isolate Unclassified
237 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
238 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
239 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
240 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
241 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
242 2773857673 Pseudomonas sp. 443 Isolate Unclassified
243 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
244 2842711865 Duganella sp. R-73148 Isolate Unclassified
245 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
246 2904424332 Duganella sp. 1411 Isolate Rhizosphere
247 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
248 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
249 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
250 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
251 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
252 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
253 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
254 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
255 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
256 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.37
Metatranscriptomes 0
Isolates 6.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.84
Nodule 1.61
Rhizoplane 1.43
Rhizosphere 83.15
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450901_000264 3300042533 Bacteria 6348
2 SwRhRL2b_contig_988414 2162886007 Bacteria 6656
3 rootL2_10000467 3300003322 Bacteria 50803
4 Ga0055526_1000028 3300003771 Bacteria 150301
5 Ga0055530_10000004 3300003791 Bacteria 231465
6 Ga0055530_10000051 3300003791 Bacteria 104737
7 Ga0055540_1000017 3300003792 Bacteria 231465
8 Ga0055540_1000019 3300003792 Bacteria 210593
9 Ga0055531_10000499 3300003794 Bacteria 35910
10 Ga0065714_10002545 3300005288 Bacteria 15128
11 Ga0065714_10004222 3300005288 Bacteria 6460
12 Ga0065714_10010937 3300005288 Bacteria 3700
13 Ga0065714_10011432 3300005288 Bacteria 6194
14 Ga0065714_10066080 3300005288 Bacteria 7658
15 Ga0065704_10070219 3300005289 Bacteria 67905
16 Ga0065712_10079116 3300005290 Bacteria 3256
17 Ga0070676_10019242 3300005328 Bacteria 3797
18 Ga0070670_100097911 3300005331 Bacteria 2523
19 Ga0070670_100166891 3300005331 Bacteria 1909
20 Ga0068868_100001114 3300005338 Bacteria 18403
21 Ga0070661_100000016 3300005344 Bacteria 153545
22 Ga0070674_100062406 3300005356 Bacteria 2604
23 Ga0070673_100009324 3300005364 Bacteria 6586
24 Ga0070673_100032353 3300005364 Bacteria 3937
25 Ga0070667_100020197 3300005367 Bacteria 5530
26 Ga0070711_100043854 3300005439 Unclassified 3032
27 Ga0070708_100034229 3300005445 Bacteria 4419
28 Ga0070662_100130185 3300005457 Bacteria 1939
29 Ga0068867_100000041 3300005459 Bacteria 78472
30 Ga0068867_100018723 3300005459 Bacteria 4923
31 Ga0070706_100006414 3300005467 Bacteria 11119
32 Ga0070665_100245257 3300005548 Bacteria 1792
33 Ga0070664_100000013 3300005564 Bacteria 153909
34 Ga0068857_100042770 3300005577 Bacteria 4019
35 Ga0068861_100040197 3300005719 Bacteria 3496
36 Ga0068863_100015958 3300005841 Bacteria 7203
37 Ga0075365_10000798 3300006038 Bacteria 12913
38 Ga0075362_10022103 3300006177 Bacteria 2676
39 Ga0075369_10003066 3300006186 Bacteria 6050
40 Ga0075366_10086039 3300006195 Bacteria 1881
41 Ga0075370_10078328 3300006353 Bacteria 1898
42 Ga0075436_100064253 3300006914 Bacteria 2536
43 Ga0079104_1000006 3300006946 Bacteria 396255
44 Ga0079104_1000469 3300006946 Bacteria 45007
45 Ga0105251_10008614 3300009011 Bacteria 6119
46 Ga0105244_10000647 3300009036 Bacteria 30688
47 Ga0105244_10002647 3300009036 Bacteria 13424
48 Ga0105244_10006838 3300009036 Bacteria 7330
49 Ga0105244_10009294 3300009036 Bacteria 6058
50 Ga0105244_10026469 3300009036 Bacteria 3138
51 Ga0105244_10031919 3300009036 Bacteria 2793
52 Ga0105250_10040434 3300009092 Bacteria 1870
53 Ga0105240_10019845 3300009093 Bacteria 8978
54 Ga0105245_10011850 3300009098 Bacteria 7585
55 Ga0105247_10037170 3300009101 Bacteria 2971
56 Ga0105243_10000045 3300009148 Bacteria 156620
57 Ga0105243_10008816 3300009148 Bacteria 7723
58 Ga0105243_10009226 3300009148 Bacteria 7531
59 Ga0105242_10001142 3300009176 Bacteria 20946
60 Ga0105242_10054418 3300009176 Bacteria 3271
61 Ga0105237_10000090 3300009545 Bacteria 123394
62 Ga0105237_10002040 3300009545 Bacteria 25677
63 Ga0105249_10200932 3300009553 Bacteria 1951
64 Ga0105239_10013470 3300010375 Bacteria 9083
65 Ga0157373_10002997 3300013100 Bacteria 12769
66 Ga0157373_10015008 3300013100 Bacteria 5665
67 Ga0157371_10000162 3300013102 Bacteria 98237
68 Ga0157370_10002476 3300013104 Bacteria 22268
69 Ga0157369_10002211 3300013105 Bacteria 23426
70 Ga0157378_10074196 3300013297 Bacteria 3061
71 Ga0163162_10000148 3300013306 Bacteria 64886
72 Ga0163162_10016217 3300013306 Bacteria 7286
73 Ga0157375_10000882 3300013308 Bacteria 26043
74 Ga0157375_10174246 3300013308 Bacteria 2300
75 Ga0182008_10003779 3300014497 Bacteria 9000
76 Ga0182008_10010334 3300014497 Bacteria 4996
77 Ga0182008_10043466 3300014497 Bacteria 2237
78 Ga0157377_10000020 3300014745 Bacteria 151620
79 Ga0157379_10067548 3300014968 Bacteria 3195
80 Ga0182006_1000199 3300015261 Bacteria 61642
81 Ga0182006_1000305 3300015261 Bacteria 42860
82 Ga0182005_1000086 3300015265 Bacteria 70203
83 Ga0182005_1001916 3300015265 Bacteria 7877
84 Ga0163161_10002442 3300017792 Bacteria 13273
85 Ga0163161_10002593 3300017792 Bacteria 12886
86 Ga0163161_10059827 3300017792 Bacteria 2771
87 Ga0209676_1001053 3300025292 Bacteria 31708
88 Ga0209564_1000011 3300025295 Bacteria 822327
89 Ga0209050_1000037 3300025298 Bacteria 415612
90 Ga0209050_1000137 3300025298 Bacteria 178099
91 Ga0209050_1006142 3300025298 Bacteria 7237
92 Ga0209051_1000040 3300025303 Bacteria 315055
93 Ga0209051_1000071 3300025303 Bacteria 210843
94 Ga0209051_1009236 3300025303 Bacteria 5102
95 Ga0209257_1000268 3300025304 Bacteria 119801
96 Ga0207655_1000109 3300025728 Bacteria 172040
97 Ga0207655_1000514 3300025728 Bacteria 49219
98 Ga0207655_1026778 3300025728 Bacteria 2760
99 Ga0207713_1040363 3300025735 Bacteria 1959
100 Ga0207645_10022464 3300025907 Bacteria 4104
101 Ga0207684_10000788 3300025910 Bacteria 36846
102 Ga0207695_10040351 3300025913 Bacteria 5007
103 Ga0207671_10000118 3300025914 Bacteria 121904
104 Ga0207671_10041623 3300025914 Bacteria 3400
105 Ga0207649_10000046 3300025920 Bacteria 112669
106 Ga0207650_10000192 3300025925 Bacteria 70742
107 Ga0207650_10000208 3300025925 Bacteria 67183
108 Ga0207659_10048855 3300025926 Bacteria 2999
109 Ga0207706_10089843 3300025933 Bacteria 2701
110 Ga0207709_10000011 3300025935 Bacteria 552881
111 Ga0207709_10008051 3300025935 Bacteria 5838
112 Ga0207704_10018457 3300025938 Bacteria 3641
113 Ga0207691_10052346 3300025940 Bacteria 3729
114 Ga0207689_10011265 3300025942 Bacteria 7674
115 Ga0207689_10156330 3300025942 Bacteria 1880
116 Ga0207679_10000033 3300025945 Bacteria 155875
117 Ga0207651_10006935 3300025960 Bacteria 5990
118 Ga0207658_10001270 3300025986 Bacteria 19950
119 Ga0207658_10177454 3300025986 Bacteria 1760
120 Ga0207648_10000026 3300026089 Bacteria 131314
121 Ga0207648_10006950 3300026089 Bacteria 11202
122 Ga0207648_10016388 3300026089 Bacteria 6772
123 Ga0207674_10041976 3300026116 Bacteria 4727
124 Ga0207698_10059829 3300026142 Bacteria 2960
125 Ga0209281_1000011 3300027111 Bacteria 695292
126 Ga0209281_1000320 3300027111 Bacteria 84410
127 Ga0207428_10028389 3300027907 Bacteria 4649
128 Ga0268266_10100310 3300028379 Bacteria 2550
129 Ga0307515_10000006 3300028794 Bacteria 725810
130 Ga0307515_10000378 3300028794 Bacteria 108916
131 Ga0307515_10004730 3300028794 Bacteria 27885
132 Ga0307511_10082160 3300030521 Bacteria 2255
133 Ga0307512_10064154 3300030522 Bacteria 2800
134 Ga0307513_10027746 3300031456 Bacteria 6490
135 Ga0307509_10001516 3300031507 Bacteria 39162
136 Ga0307408_100000074 3300031548 Bacteria 111955
137 Ga0307408_100001591 3300031548 Bacteria 16759
138 Ga0307514_10000827 3300031649 Bacteria 50048
139 Ga0307405_10000130 3300031731 Bacteria 29904
140 Ga0307413_10015751 3300031824 Bacteria 3883
141 Ga0307406_10181556 3300031901 Bacteria 1532
142 Ga0307407_10161025 3300031903 Bacteria 1468
143 Ga0307412_10002957 3300031911 Bacteria 9438
144 Ga0307412_10003842 3300031911 Bacteria 8346
145 Ga0307412_10008387 3300031911 Bacteria 5896
146 Ga0307409_100178078 3300031995 Bacteria 1879
147 Ga0307414_10000407 3300032004 Bacteria 23346
148 Ga0307414_10010184 3300032004 Bacteria 5442
149 Ga0307411_10010322 3300032005 Bacteria 4971
150 Ga0373932_0002378 3300035112 Bacteria 4777
151 Ga0373956_0065607 3300035119 Bacteria 1650
152 Ga0373931_0001444 3300035691 Bacteria 10199
153 Ga0373937_0002021 3300036401 Bacteria 16928
154 Ga0395900_0022631 3300037418 Bacteria 6432
155 Ga0395905_0001538 3300037471 Bacteria 27621
156 Ga0395905_0042614 3300037471 Bacteria 4259
157 Ga0400484_23291 3300038725 Bacteria 2006
158 Ga0400488_60294 3300038741 Unclassified 4042
159 Ga0400489_07137 3300039093 Bacteria 33163
160 Ga0400487_12711 3300039110 Bacteria 8906
161 Ga0400487_38229 3300039110 Bacteria 25700
162 Ga0439436_0002247 3300041404 Bacteria 5780
163 Ga0439438_000028 3300041405 Bacteria 85791
164 Ga0439438_000388 3300041405 Bacteria 19668
165 Ga0439438_002065 3300041405 Bacteria 8719
166 Ga0439438_002214 3300041405 Bacteria 8367
167 Ga0439447_000012 3300041407 Bacteria 72724
168 Ga0439447_000030 3300041407 Bacteria 49948
169 Ga0439447_000231 3300041407 Bacteria 19695
170 Ga0439447_000585 3300041407 Bacteria 13600
171 Ga0439447_012711 3300041407 Bacteria 2410
172 Ga0439466_0000019 3300041411 Bacteria 98651
173 Ga0439466_0000044 3300041411 Bacteria 49151
174 Ga0439466_0001729 3300041411 Bacteria 8527
175 Ga0439466_0008604 3300041411 Bacteria 3846
176 Ga0439466_0009467 3300041411 Bacteria 3639
177 Ga0439466_0010414 3300041411 Bacteria 3456
178 Ga0451853_0910554 3300041512 Bacteria 4186
179 Ga0439432_000322 3300042006 Bacteria 17378
180 Ga0439432_010416 3300042006 Bacteria 3217
181 Ga0439451_000144 3300042009 Bacteria 13280
182 Ga0439452_000098 3300042010 Bacteria 73779
183 Ga0439452_000417 3300042010 Bacteria 24852
184 Ga0439452_000988 3300042010 Bacteria 12702
185 Ga0439452_002702 3300042010 Bacteria 6428
186 Ga0439456_000022 3300042013 Bacteria 60329
187 Ga0439456_000321 3300042013 Bacteria 10959
188 Ga0450911_000069 3300042115 Bacteria 42544
189 Ga0450911_002253 3300042115 Bacteria 3875
190 Ga0450920_001182 3300042122 Bacteria 4274
191 Ga0450920_005804 3300042122 Bacteria 2204
192 Ga0450922_000008 3300042124 Bacteria 18287
193 Ga0450888_000088 3300042126 Bacteria 7075
194 Ga0450892_001593 3300042130 Bacteria 2139
195 Ga0450898_001155 3300042134 Bacteria 3399
196 Ga0450902_002082 3300042137 Bacteria 2809
197 Ga0450903_000878 3300042138 Bacteria 5788
198 Ga0450903_002173 3300042138 Bacteria 3510
199 Ga0450903_006356 3300042138 Bacteria 1962
200 Ga0450907_000051 3300042146 Bacteria 49159
201 Ga0450907_000183 3300042146 Bacteria 22935
202 Ga0450907_001548 3300042146 Bacteria 4896
203 Ga0450907_004246 3300042146 Bacteria 2478
204 Ga0450910_000004 3300042147 Bacteria 58536
205 Ga0450910_001101 3300042147 Bacteria 3327
206 Ga0439446_0000060 3300042156 Bacteria 17273
207 Ga0439446_0000124 3300042156 Bacteria 13251
208 Ga0439446_0026347 3300042156 Bacteria 1665
209 Ga0450908_000004 3300042184 Bacteria 72969
210 Ga0450909_000037 3300042185 Bacteria 10813
211 Ga0439434_0000099 3300042435 Bacteria 22061
212 Ga0439464_0002521 3300042439 Bacteria 4518
213 Ga0439460_0000331 3300042461 Bacteria 9955
214 Ga0439460_0019581 3300042461 Bacteria 1835
215 Ga0450918_003782 3300042531 Bacteria 2792
216 Ga0451577_0003288 3300042876 Bacteria 18180
217 Ga0439440_0000068 3300042993 Bacteria 12965
218 Ga0453683_0001390 3300044673 Bacteria 21015
219 Ga0453684_0003594 3300044712 Bacteria 34598
220 Ga0453684_0031939 3300044712 Bacteria 7382
221 Ga0466968_0013934 3300044735 Bacteria 3169
222 Ga0451576_0016786 3300045051 Bacteria 8070
223 Ga0495617_000753 3300046452 Bacteria 15874
224 Ga0495617_026937 3300046452 Bacteria 1935
225 Ga0495592_0002034 3300046454 Bacteria 14238
226 Ga0495590_0000005 3300046457 Bacteria 384276
227 Ga0495590_0000617 3300046457 Bacteria 16575
228 Ga0495590_0001052 3300046457 Bacteria 12147
229 Ga0495590_0015227 3300046457 Bacteria 2795
230 Ga0495590_0048163 3300046457 Bacteria 1486
231 Ga0495591_000005 3300046458 Bacteria 394092
232 Ga0495591_000088 3300046458 Bacteria 102486
233 Ga0495591_001895 3300046458 Bacteria 12286
234 Ga0495591_011233 3300046458 Bacteria 3405
235 Ga0495591_013808 3300046458 Bacteria 2935
236 Ga0495638_0000027 3300046460 Bacteria 337569
237 Ga0495638_0000866 3300046460 Bacteria 31458
238 Ga0495638_0001203 3300046460 Bacteria 24737
239 Ga0495638_0005698 3300046460 Bacteria 9173
240 Ga0495638_0007929 3300046460 Bacteria 7574
241 Ga0495638_0009732 3300046460 Bacteria 6715
242 Ga0495638_0020266 3300046460 Bacteria 4393
243 Ga0495638_0024629 3300046460 Bacteria 3920
244 Ga0495638_0029600 3300046460 Bacteria 3531
245 Ga0495638_0050670 3300046460 Bacteria 2592
246 Ga0495638_0090323 3300046460 Bacteria 1846
247 Ga0495638_0092657 3300046460 Bacteria 1818
248 Ga0495653_0000009 3300046463 Bacteria 304207
249 Ga0495653_0001725 3300046463 Bacteria 17228
250 Ga0495650_0000184 3300046471 Bacteria 136939
251 Ga0495650_0000240 3300046471 Bacteria 109029
252 Ga0495650_0001290 3300046471 Bacteria 25556
253 Ga0495650_0001808 3300046471 Bacteria 19256
254 Ga0495650_0005226 3300046471 Bacteria 8515
255 Ga0495650_0049315 3300046471 Bacteria 1749
256 Ga0495650_0062985 3300046471 Bacteria 1480
257 Ga0495605_0000053 3300046474 Bacteria 158757
258 Ga0495605_0000195 3300046474 Bacteria 75899
259 Ga0495605_0000540 3300046474 Bacteria 31251
260 Ga0495605_0001605 3300046474 Bacteria 14650
261 Ga0495605_0005256 3300046474 Bacteria 7553
262 Ga0495605_0008398 3300046474 Bacteria 5838
263 Ga0495605_0053219 3300046474 Bacteria 1964
264 Ga0495639_0007564 3300046475 Bacteria 4668
265 Ga0495584_0000464 3300046491 Bacteria 27902
266 Ga0495584_0003233 3300046491 Bacteria 9036
267 Ga0495584_0003911 3300046491 Bacteria 8052
268 Ga0495584_0017804 3300046491 Bacteria 3613
269 Ga0495584_0081531 3300046491 Bacteria 1628
270 Ga0495585_0000306 3300046492 Bacteria 48892
271 Ga0495585_0000573 3300046492 Bacteria 34626
272 Ga0495585_0000728 3300046492 Bacteria 29361
273 Ga0495585_0012893 3300046492 Bacteria 4913
274 Ga0495585_0023666 3300046492 Bacteria 3524
275 Ga0495596_0000061 3300046500 Bacteria 79205
276 Ga0495607_0001084 3300046501 Bacteria 24861
277 Ga0495607_0001956 3300046501 Bacteria 17394
278 Ga0495607_0003030 3300046501 Bacteria 13101
279 Ga0495607_0003164 3300046501 Bacteria 12757
280 Ga0495607_0007358 3300046501 Bacteria 7626
281 Ga0495607_0008117 3300046501 Bacteria 7207
282 Ga0495607_0011631 3300046501 Bacteria 5848
283 Ga0495607_0066190 3300046501 Bacteria 2034
284 Ga0495607_0093377 3300046501 Bacteria 1625
285 Ga0495583_0002517 3300046506 Bacteria 15512
286 Ga0495583_0017938 3300046506 Bacteria 3741
287 Ga0495606_0000062 3300046507 Bacteria 184841
288 Ga0495606_0001025 3300046507 Bacteria 40534
289 Ga0495606_0003091 3300046507 Bacteria 18131
290 Ga0495606_0003485 3300046507 Bacteria 16664
291 Ga0495606_0005506 3300046507 Bacteria 12103
292 Ga0495606_0024187 3300046507 Bacteria 4384
293 Ga0495606_0025168 3300046507 Bacteria 4269
294 Ga0495606_0055217 3300046507 Bacteria 2569
295 Ga0495606_0079841 3300046507 Bacteria 2037
296 Ga0495610_0000069 3300046512 Bacteria 121713
297 Ga0495610_0001385 3300046512 Bacteria 21530
298 Ga0495610_0001933 3300046512 Bacteria 17860
299 Ga0495610_0002533 3300046512 Bacteria 15251
300 Ga0495610_0007816 3300046512 Bacteria 7044
301 Ga0495610_0008741 3300046512 Bacteria 6505
302 Ga0495610_0014687 3300046512 Bacteria 4588
303 Ga0495610_0015812 3300046512 Bacteria 4369
304 Ga0495610_0016026 3300046512 Bacteria 4332
305 Ga0495610_0031383 3300046512 Bacteria 2772
306 Ga0495610_0047719 3300046512 Bacteria 2105
307 Ga0495610_0048775 3300046512 Bacteria 2077
308 Ga0495616_0000843 3300046513 Bacteria 22385
309 Ga0495616_0002120 3300046513 Bacteria 13302
310 Ga0495616_0011407 3300046513 Bacteria 5090
311 Ga0495616_0071295 3300046513 Bacteria 1680
312 Ga0495616_0079796 3300046513 Bacteria 1568
313 Ga0495620_0001067 3300046515 Bacteria 16797
314 Ga0495620_0001239 3300046515 Bacteria 15580
315 Ga0495620_0004731 3300046515 Bacteria 7651
316 Ga0495620_0016330 3300046515 Bacteria 3727
317 Ga0495631_0000133 3300046518 Bacteria 50217
318 Ga0495631_0000934 3300046518 Bacteria 18209
319 Ga0495631_0002957 3300046518 Bacteria 9408
320 Ga0495631_0014827 3300046518 Bacteria 3752
321 Ga0495631_0041707 3300046518 Bacteria 2030
322 Ga0495632_0000428 3300046519 Bacteria 40001
323 Ga0495632_0001959 3300046519 Bacteria 16414
324 Ga0495632_0023990 3300046519 Bacteria 3248
325 Ga0495637_0000113 3300046520 Bacteria 58600
326 Ga0495637_0000178 3300046520 Bacteria 49292
327 Ga0495637_0001244 3300046520 Bacteria 15411
328 Ga0495637_0004001 3300046520 Bacteria 7689
329 Ga0495637_0004346 3300046520 Bacteria 7354
330 Ga0495637_0029706 3300046520 Bacteria 2431
331 Ga0495643_0002308 3300046522 Bacteria 15389
332 Ga0495643_0002767 3300046522 Bacteria 13412
333 Ga0495643_0018634 3300046522 Bacteria 4029
334 Ga0495643_0098119 3300046522 Bacteria 1504
335 Ga0495648_0000002 3300046524 Bacteria 593972
336 Ga0495648_0000545 3300046524 Bacteria 40564
337 Ga0495648_0001255 3300046524 Bacteria 25333
338 Ga0495648_0001289 3300046524 Bacteria 24984
339 Ga0495648_0003774 3300046524 Bacteria 13176
340 Ga0495648_0040948 3300046524 Bacteria 2931
341 Ga0495648_0068218 3300046524 Bacteria 2076
342 Ga0495648_0082547 3300046524 Bacteria 1823
343 Ga0495648_0109655 3300046524 Bacteria 1504
344 Ga0495666_0005560 3300046526 Bacteria 6350
345 Ga0495666_0007340 3300046526 Bacteria 5527
346 Ga0495642_0001400 3300046528 Bacteria 10798
347 Ga0495642_0002970 3300046528 Bacteria 6759
348 Ga0495654_0000276 3300046530 Bacteria 46492
349 Ga0495654_0000799 3300046530 Bacteria 24142
350 Ga0495654_0002136 3300046530 Bacteria 12904
351 Ga0495654_0002625 3300046530 Bacteria 11452
352 Ga0495654_0003739 3300046530 Bacteria 9217
353 Ga0495654_0007517 3300046530 Bacteria 6083
354 Ga0495654_0024396 3300046530 Bacteria 3124
355 Ga0495654_0033305 3300046530 Bacteria 2608
356 Ga0495587_0032019 3300046536 Bacteria 3181
357 Ga0495609_0003225 3300046538 Bacteria 9458
358 Ga0495609_0005635 3300046538 Bacteria 6531
359 Ga0495609_0035249 3300046538 Bacteria 2265
360 Ga0495597_0001278 3300046542 Bacteria 18547
361 Ga0495597_0001787 3300046542 Bacteria 14770
362 Ga0495597_0004470 3300046542 Bacteria 7673
363 Ga0495597_0005082 3300046542 Bacteria 7024
364 Ga0495597_0008768 3300046542 Bacteria 5052
365 Ga0495645_0078245 3300046543 Bacteria 2377
366 Ga0495622_0000006 3300046557 Bacteria 245799
367 Ga0495622_0000200 3300046557 Bacteria 47745
368 Ga0495622_0012361 3300046557 Bacteria 3952
369 Ga0495622_0023613 3300046557 Bacteria 2868
370 Ga0495622_0038263 3300046557 Bacteria 2233
371 Ga0495633_0000033 3300046558 Bacteria 186714
372 Ga0495633_0002093 3300046558 Bacteria 14341
373 Ga0495633_0005218 3300046558 Bacteria 8015
374 Ga0495668_0000065 3300046616 Bacteria 178985
375 Ga0495668_0000091 3300046616 Bacteria 144428
376 Ga0495668_0001008 3300046616 Bacteria 30256
377 Ga0495668_0001717 3300046616 Bacteria 20199
378 Ga0495668_0015760 3300046616 Bacteria 4405
379 Ga0495634_0004297 3300046642 Bacteria 11231
380 Ga0495611_0000138 3300046648 Bacteria 51231
381 Ga0495611_0001788 3300046648 Bacteria 10349
382 Ga0495625_0000053 3300046660 Bacteria 190575
383 Ga0495625_0001001 3300046660 Bacteria 37417
384 Ga0495625_0001014 3300046660 Bacteria 37048
385 Ga0495625_0002078 3300046660 Bacteria 22425
386 Ga0495625_0002413 3300046660 Bacteria 20242
387 Ga0495625_0012164 3300046660 Bacteria 6983
388 Ga0495625_0067190 3300046660 Bacteria 2523
389 Ga0495625_0167288 3300046660 Bacteria 1469
390 Ga0495661_0005885 3300046665 Bacteria 8666
391 Ga0495661_0014053 3300046665 Bacteria 5366
392 Ga0495661_0053430 3300046665 Bacteria 2429
393 Ga0495661_0054007 3300046665 Bacteria 2414
394 Ga0495588_0006983 3300046674 Bacteria 5118
395 Ga0495588_0098457 3300046674 Bacteria 1535
396 Ga0495646_0015420 3300046680 Bacteria 4851
397 Ga0495613_0015911 3300046689 Bacteria 5600
398 Ga0495624_0000246 3300046690 Bacteria 42607
399 Ga0495670_0004734 3300046691 Bacteria 6682
400 Ga0495670_0005375 3300046691 Bacteria 6295
401 Ga0495670_0054576 3300046691 Bacteria 2002
402 Ga0495670_0057790 3300046691 Bacteria 1947
403 Ga0495671_0003507 3300046692 Bacteria 9618
404 Ga0495671_0005612 3300046692 Bacteria 7319
405 Ga0495671_0006549 3300046692 Bacteria 6718
406 Ga0495671_0028796 3300046692 Bacteria 2857
407 Ga0495671_0036944 3300046692 Bacteria 2472
408 Ga0495649_0002175 3300046694 Bacteria 14027
409 Ga0495649_0002400 3300046694 Bacteria 13235
410 Ga0495649_0004099 3300046694 Bacteria 9579
411 Ga0495649_0006529 3300046694 Bacteria 7255
412 Ga0495649_0009215 3300046694 Bacteria 5882
413 Ga0495589_0000757 3300046794 Bacteria 20649
414 Ga0495589_0002303 3300046794 Bacteria 10737
415 Ga0495589_0011140 3300046794 Bacteria 4667
416 Ga0495589_0017972 3300046794 Bacteria 3627
417 Ga0495600_0009236 3300046809 Bacteria 6083
418 Ga0495660_0001627 3300046810 Bacteria 15079
419 Ga0495660_0002618 3300046810 Bacteria 11432
420 Ga0495660_0003535 3300046810 Bacteria 9636
421 Ga0495660_0004303 3300046810 Bacteria 8635
422 Ga0495660_0019129 3300046810 Bacteria 3931
423 Ga0495660_0026592 3300046810 Bacteria 3279
424 Ga0495660_0035928 3300046810 Bacteria 2765
425 Ga0495660_0047999 3300046810 Bacteria 2336
426 Ga0495660_0073786 3300046810 Bacteria 1803
427 Ga0495672_0000021 3300047320 Bacteria 422795
428 Ga0495672_0000190 3300047320 Bacteria 88698
429 Ga0495672_0002300 3300047320 Bacteria 17724
430 Ga0495672_0005183 3300047320 Bacteria 10392
431 Ga0495672_0006938 3300047320 Bacteria 8624
432 Ga0495672_0009326 3300047320 Bacteria 7123
433 Ga0495672_0010921 3300047320 Bacteria 6440
434 Ga0495676_0003503 3300047321 Bacteria 14212
435 Ga0495680_0000992 3300047322 Bacteria 31598
436 Ga0495683_0000118 3300047323 Bacteria 79578
437 Ga0495683_0000253 3300047323 Bacteria 48373
438 Ga0495683_0000432 3300047323 Bacteria 33198
439 Ga0495683_0002512 3300047323 Bacteria 11035
440 Ga0495683_0004858 3300047323 Bacteria 7530
441 Ga0495683_0013671 3300047323 Bacteria 4240
442 Ga0495687_004389 3300047443 Bacteria 9569
443 Ga0495687_005137 3300047443 Bacteria 8472
444 Ga0495687_009764 3300047443 Bacteria 5332
445 Ga0495679_011037 3300047446 Bacteria 3511
446 Ga0495673_0000178 3300047469 Bacteria 102182
447 Ga0495673_0000221 3300047469 Bacteria 84565
448 Ga0495673_0000254 3300047469 Bacteria 74340
449 Ga0495673_0000288 3300047469 Bacteria 67701
450 Ga0495673_0002129 3300047469 Bacteria 14369
451 Ga0495673_0004056 3300047469 Bacteria 9330
452 Ga0495673_0005757 3300047469 Bacteria 7430
453 Ga0495673_0010038 3300047469 Bacteria 5185
454 Ga0495681_0000026 3300047470 Bacteria 144911
455 Ga0495681_0000651 3300047470 Bacteria 26430
456 Ga0495681_0002585 3300047470 Bacteria 12847
457 Ga0495681_0003670 3300047470 Bacteria 10659
458 Ga0495681_0005251 3300047470 Bacteria 8697
459 Ga0495681_0005456 3300047470 Bacteria 8505
460 Ga0495681_0007400 3300047470 Bacteria 7023
461 Ga0495681_0008469 3300047470 Bacteria 6450
462 Ga0495681_0011006 3300047470 Bacteria 5425
463 Ga0495681_0013061 3300047470 Bacteria 4844
464 Ga0495681_0044101 3300047470 Unclassified 2146
465 Ga0495681_0063483 3300047470 Bacteria 1694
466 Ga0495686_0000919 3300047472 Bacteria 36947
467 Ga0495686_0002090 3300047472 Bacteria 19631
468 Ga0495686_0051668 3300047472 Bacteria 2578
469 Ga0495593_0005549 3300047673 Bacteria 7451
470 Ga0495602_0001096 3300048088 Bacteria 26568
471 Ga0495626_0000033 3300048091 Bacteria 184008
472 Ga0495626_0000132 3300048091 Bacteria 94157
473 Ga0495626_0000236 3300048091 Bacteria 64189
474 Ga0495626_0000467 3300048091 Bacteria 41237
475 Ga0495626_0002379 3300048091 Bacteria 13137
476 Ga0495626_0005816 3300048091 Bacteria 7113
477 Ga0495626_0007154 3300048091 Bacteria 6240
478 Ga0496110_0296033 3300048913 Bacteria 1474
479 Ga0496116_0001028 3300048919 Bacteria 34090
480 Ga0496117_0001482 3300048920 Bacteria 33689
481 Ga0496117_0005243 3300048920 Bacteria 13753
482 Ga0496117_0013991 3300048920 Bacteria 6950
483 Ga0496118_0001585 3300048921 Bacteria 33713
484 Ga0496118_0006662 3300048921 Bacteria 12602
485 Ga0496118_0007118 3300048921 Bacteria 12000
486 Ga0496121_0000871 3300048924 Bacteria 54544
487 Ga0496121_0002025 3300048924 Bacteria 32154
488 Ga0496121_0028579 3300048924 Bacteria 5188
489 Ga0496122_0001143 3300048925 Bacteria 45515
490 Ga0496122_0004800 3300048925 Bacteria 16517
491 Ga0496123_0007794 3300048926 Bacteria 9972
492 Ga0496124_0004132 3300048927 Bacteria 17149
493 Ga0496124_0028336 3300048927 Bacteria 5011
494 Ga0496124_0155062 3300048927 Bacteria 1792
495 Ga0496124_0198101 3300048927 Bacteria 1530
496 Ga0496125_0000619 3300048928 Bacteria 60020
497 Ga0496125_0001480 3300048928 Bacteria 33930
498 Ga0496125_0020605 3300048928 Bacteria 6186
499 Ga0496125_0025864 3300048928 Bacteria 5364
500 Ga0495678_003406 3300049459 Bacteria 9870
501 Ga0495678_005536 3300049459 Bacteria 6943
502 Ga0495678_007544 3300049459 Bacteria 5619
503 Ga0495678_020151 3300049459 Bacteria 2959
504 Ga0495678_022864 3300049459 Bacteria 2727
505 Ga0495678_034683 3300049459 Bacteria 2074
506 Ga0495678_056274 3300049459 Bacteria 1496
507 Ga0495682_0004546 3300049460 Bacteria 5913
508 Ga0495682_0020242 3300049460 Bacteria 2498
509 Ga0495682_0023544 3300049460 Bacteria 2298
510 Ga0501198_000017 3300049649 Bacteria 99066
511 Ga0501222_000012 3300049662 Bacteria 98204
512 Ga0501222_000076 3300049662 Bacteria 27930
513 Ga0501265_003994 3300049762 Bacteria 1676
514 Ga0501226_000123 3300049853 Bacteria 15838
515 nmdc:mga03683_8257_c1 3300050489 Bacteria 3652
516 nmdc:mga00v17_10896_c1 3300050491 Bacteria 4981
517 nmdc:mga0k408_113899_c1 3300050493 Bacteria 1599
518 nmdc:mga0k408_328_c1 3300050493 Bacteria 25950
519 nmdc:mga07m45_48940_c1 3300050496 Bacteria 2378
520 Ga0500568_0045547 3300053139 Bacteria 1745
521 Ga0500586_001287 3300053145 Bacteria 5265
522 2511304145 2511231012 Bacteria 6738011
523 2511304526 2511231012 Bacteria 6738011
524 2511322479 2511231015 Bacteria 6598026
525 2511323391 2511231015 Bacteria 6598026
526 2511352339 2511231020 Bacteria 6115223
527 2599884309 2599185289 Bacteria 6778765
528 2599896512 2599185291 Bacteria 6775623
529 2600016121 2599185315 Bacteria 6771107
530 2600030819 2599185317 Bacteria 6435722
531 2600051327 2599185321 Bacteria 6764560
532 2600360624 2600254930 Bacteria 6431253
533 2643843547 2643221565 Bacteria 6216018
534 2643953523 2643221589 Bacteria 6250934
535 2643953712 2643221589 Bacteria 6250934
536 2644021265 2643221602 Bacteria 6249926
537 2644021644 2643221602 Bacteria 6249926
538 2644072680 2643221611 Bacteria 6820941
539 2652543387 2651869719 Bacteria 6047974
540 2671089208 2667528170 Bacteria 6786960
541 2678263291 2675903515 Bacteria 6580491
542 2739260059 2738543015 Bacteria 6750701
543 2745009622 2744054620 Bacteria 6551379
544 2774137443 2773857673 Bacteria 6513460
545 2825652540 2825651385 Bacteria 6715909
546 2842714647 2842711865 Bacteria 7155354
547 2842855286 2842854478 Bacteria 6143501
548 2904425283 2904424332 Bacteria 7633521
549 2904522670 2904518522 Bacteria 6068986
550 2913041636 2913036834 Bacteria 6704877
551 2919456489 2919456309 Bacteria 6586567
552 2929146767 2929144301 Bacteria 6622272
553 2939640121 2939636861 Bacteria 6297853
554 2939656080 2939651529 Bacteria 5895393
555 3007622795 3007619802 Bacteria 6411688
556 8056129593 8056125926 Bacteria 6228218
557 8056146575 8056143049 Bacteria 6307666
558 8056178940 8056177738 Bacteria 6748268
559 Ga0450901_000264
560 SwRhRL2b_contig_988414
561 rootL2_10000467
562 Ga0055526_1000028
563 Ga0055530_10000004
564 Ga0055530_10000051
565 Ga0055540_1000017
566 Ga0055540_1000019
567 Ga0055531_10000499
568 Ga0065714_10002545
569 Ga0065714_10004222
570 Ga0065714_10010937
571 Ga0065714_10011432
572 Ga0065714_10066080
573 Ga0065704_10070219
574 Ga0065712_10079116
575 Ga0070676_10019242
576 Ga0070670_100097911
577 Ga0070670_100166891
578 Ga0068868_100001114
579 Ga0070661_100000016
580 Ga0070674_100062406
581 Ga0070673_100009324
582 Ga0070673_100032353
583 Ga0070667_100020197
584 Ga0070711_100043854
585 Ga0070708_100034229
586 Ga0070662_100130185
587 Ga0068867_100000041
588 Ga0068867_100018723
589 Ga0070706_100006414
590 Ga0070665_100245257
591 Ga0070664_100000013
592 Ga0068857_100042770
593 Ga0068861_100040197
594 Ga0068863_100015958
595 Ga0075365_10000798
596 Ga0075362_10022103
597 Ga0075369_10003066
598 Ga0075366_10086039
599 Ga0075370_10078328
600 Ga0075436_100064253
601 Ga0079104_1000006
602 Ga0079104_1000469
603 Ga0105251_10008614
604 Ga0105244_10000647
605 Ga0105244_10002647
606 Ga0105244_10006838
607 Ga0105244_10009294
608 Ga0105244_10026469
609 Ga0105244_10031919
610 Ga0105250_10040434
611 Ga0105240_10019845
612 Ga0105245_10011850
613 Ga0105247_10037170
614 Ga0105243_10000045
615 Ga0105243_10008816
616 Ga0105243_10009226
617 Ga0105242_10001142
618 Ga0105242_10054418
619 Ga0105237_10000090
620 Ga0105237_10002040
621 Ga0105249_10200932
622 Ga0105239_10013470
623 Ga0157373_10002997
624 Ga0157373_10015008
625 Ga0157371_10000162
626 Ga0157370_10002476
627 Ga0157369_10002211
628 Ga0157378_10074196
629 Ga0163162_10000148
630 Ga0163162_10016217
631 Ga0157375_10000882
632 Ga0157375_10174246
633 Ga0182008_10003779
634 Ga0182008_10010334
635 Ga0182008_10043466
636 Ga0157377_10000020
637 Ga0157379_10067548
638 Ga0182006_1000199
639 Ga0182006_1000305
640 Ga0182005_1000086
641 Ga0182005_1001916
642 Ga0163161_10002442
643 Ga0163161_10002593
644 Ga0163161_10059827
645 Ga0209676_1001053
646 Ga0209564_1000011
647 Ga0209050_1000037
648 Ga0209050_1000137
649 Ga0209050_1006142
650 Ga0209051_1000040
651 Ga0209051_1000071
652 Ga0209051_1009236
653 Ga0209257_1000268
654 Ga0207655_1000109
655 Ga0207655_1000514
656 Ga0207655_1026778
657 Ga0207713_1040363
658 Ga0207645_10022464
659 Ga0207684_10000788
660 Ga0207695_10040351
661 Ga0207671_10000118
662 Ga0207671_10041623
663 Ga0207649_10000046
664 Ga0207650_10000192
665 Ga0207650_10000208
666 Ga0207659_10048855
667 Ga0207706_10089843
668 Ga0207709_10000011
669 Ga0207709_10008051
670 Ga0207704_10018457
671 Ga0207691_10052346
672 Ga0207689_10011265
673 Ga0207689_10156330
674 Ga0207679_10000033
675 Ga0207651_10006935
676 Ga0207658_10001270
677 Ga0207658_10177454
678 Ga0207648_10000026
679 Ga0207648_10006950
680 Ga0207648_10016388
681 Ga0207674_10041976
682 Ga0207698_10059829
683 Ga0209281_1000011
684 Ga0209281_1000320
685 Ga0207428_10028389
686 Ga0268266_10100310
687 Ga0307515_10000006
688 Ga0307515_10000378
689 Ga0307515_10004730
690 Ga0307511_10082160
691 Ga0307512_10064154
692 Ga0307513_10027746
693 Ga0307509_10001516
694 Ga0307408_100000074
695 Ga0307408_100001591
696 Ga0307514_10000827
697 Ga0307405_10000130
698 Ga0307413_10015751
699 Ga0307406_10181556
700 Ga0307407_10161025
701 Ga0307412_10002957
702 Ga0307412_10003842
703 Ga0307412_10008387
704 Ga0307409_100178078
705 Ga0307414_10000407
706 Ga0307414_10010184
707 Ga0307411_10010322
708 Ga0373932_0002378
709 Ga0373956_0065607
710 Ga0373931_0001444
711 Ga0373937_0002021
712 Ga0395900_0022631
713 Ga0395905_0001538
714 Ga0395905_0042614
715 Ga0400484_23291
716 Ga0400488_60294
717 Ga0400489_07137
718 Ga0400487_12711
719 Ga0400487_38229
720 Ga0439436_0002247
721 Ga0439438_000028
722 Ga0439438_000388
723 Ga0439438_002065
724 Ga0439438_002214
725 Ga0439447_000012
726 Ga0439447_000030
727 Ga0439447_000231
728 Ga0439447_000585
729 Ga0439447_012711
730 Ga0439466_0000019
731 Ga0439466_0000044
732 Ga0439466_0001729
733 Ga0439466_0008604
734 Ga0439466_0009467
735 Ga0439466_0010414
736 Ga0451853_0910554
737 Ga0439432_000322
738 Ga0439432_010416
739 Ga0439451_000144
740 Ga0439452_000098
741 Ga0439452_000417
742 Ga0439452_000988
743 Ga0439452_002702
744 Ga0439456_000022
745 Ga0439456_000321
746 Ga0450911_000069
747 Ga0450911_002253
748 Ga0450920_001182
749 Ga0450920_005804
750 Ga0450922_000008
751 Ga0450888_000088
752 Ga0450892_001593
753 Ga0450898_001155
754 Ga0450902_002082
755 Ga0450903_000878
756 Ga0450903_002173
757 Ga0450903_006356
758 Ga0450907_000051
759 Ga0450907_000183
760 Ga0450907_001548
761 Ga0450907_004246
762 Ga0450910_000004
763 Ga0450910_001101
764 Ga0439446_0000060
765 Ga0439446_0000124
766 Ga0439446_0026347
767 Ga0450908_000004
768 Ga0450909_000037
769 Ga0439434_0000099
770 Ga0439464_0002521
771 Ga0439460_0000331
772 Ga0439460_0019581
773 Ga0450918_003782
774 Ga0451577_0003288
775 Ga0439440_0000068
776 Ga0453683_0001390
777 Ga0453684_0003594
778 Ga0453684_0031939
779 Ga0466968_0013934
780 Ga0451576_0016786
781 Ga0495617_000753
782 Ga0495617_026937
783 Ga0495592_0002034
784 Ga0495590_0000005
785 Ga0495590_0000617
786 Ga0495590_0001052
787 Ga0495590_0015227
788 Ga0495590_0048163
789 Ga0495591_000005
790 Ga0495591_000088
791 Ga0495591_001895
792 Ga0495591_011233
793 Ga0495591_013808
794 Ga0495638_0000027
795 Ga0495638_0000866
796 Ga0495638_0001203
797 Ga0495638_0005698
798 Ga0495638_0007929
799 Ga0495638_0009732
800 Ga0495638_0020266
801 Ga0495638_0024629
802 Ga0495638_0029600
803 Ga0495638_0050670
804 Ga0495638_0090323
805 Ga0495638_0092657
806 Ga0495653_0000009
807 Ga0495653_0001725
808 Ga0495650_0000184
809 Ga0495650_0000240
810 Ga0495650_0001290
811 Ga0495650_0001808
812 Ga0495650_0005226
813 Ga0495650_0049315
814 Ga0495650_0062985
815 Ga0495605_0000053
816 Ga0495605_0000195
817 Ga0495605_0000540
818 Ga0495605_0001605
819 Ga0495605_0005256
820 Ga0495605_0008398
821 Ga0495605_0053219
822 Ga0495639_0007564
823 Ga0495584_0000464
824 Ga0495584_0003233
825 Ga0495584_0003911
826 Ga0495584_0017804
827 Ga0495584_0081531
828 Ga0495585_0000306
829 Ga0495585_0000573
830 Ga0495585_0000728
831 Ga0495585_0012893
832 Ga0495585_0023666
833 Ga0495596_0000061
834 Ga0495607_0001084
835 Ga0495607_0001956
836 Ga0495607_0003030
837 Ga0495607_0003164
838 Ga0495607_0007358
839 Ga0495607_0008117
840 Ga0495607_0011631
841 Ga0495607_0066190
842 Ga0495607_0093377
843 Ga0495583_0002517
844 Ga0495583_0017938
845 Ga0495606_0000062
846 Ga0495606_0001025
847 Ga0495606_0003091
848 Ga0495606_0003485
849 Ga0495606_0005506
850 Ga0495606_0024187
851 Ga0495606_0025168
852 Ga0495606_0055217
853 Ga0495606_0079841
854 Ga0495610_0000069
855 Ga0495610_0001385
856 Ga0495610_0001933
857 Ga0495610_0002533
858 Ga0495610_0007816
859 Ga0495610_0008741
860 Ga0495610_0014687
861 Ga0495610_0015812
862 Ga0495610_0016026
863 Ga0495610_0031383
864 Ga0495610_0047719
865 Ga0495610_0048775
866 Ga0495616_0000843
867 Ga0495616_0002120
868 Ga0495616_0011407
869 Ga0495616_0071295
870 Ga0495616_0079796
871 Ga0495620_0001067
872 Ga0495620_0001239
873 Ga0495620_0004731
874 Ga0495620_0016330
875 Ga0495631_0000133
876 Ga0495631_0000934
877 Ga0495631_0002957
878 Ga0495631_0014827
879 Ga0495631_0041707
880 Ga0495632_0000428
881 Ga0495632_0001959
882 Ga0495632_0023990
883 Ga0495637_0000113
884 Ga0495637_0000178
885 Ga0495637_0001244
886 Ga0495637_0004001
887 Ga0495637_0004346
888 Ga0495637_0029706
889 Ga0495643_0002308
890 Ga0495643_0002767
891 Ga0495643_0018634
892 Ga0495643_0098119
893 Ga0495648_0000002
894 Ga0495648_0000545
895 Ga0495648_0001255
896 Ga0495648_0001289
897 Ga0495648_0003774
898 Ga0495648_0040948
899 Ga0495648_0068218
900 Ga0495648_0082547
901 Ga0495648_0109655
902 Ga0495666_0005560
903 Ga0495666_0007340
904 Ga0495642_0001400
905 Ga0495642_0002970
906 Ga0495654_0000276
907 Ga0495654_0000799
908 Ga0495654_0002136
909 Ga0495654_0002625
910 Ga0495654_0003739
911 Ga0495654_0007517
912 Ga0495654_0024396
913 Ga0495654_0033305
914 Ga0495587_0032019
915 Ga0495609_0003225
916 Ga0495609_0005635
917 Ga0495609_0035249
918 Ga0495597_0001278
919 Ga0495597_0001787
920 Ga0495597_0004470
921 Ga0495597_0005082
922 Ga0495597_0008768
923 Ga0495645_0078245
924 Ga0495622_0000006
925 Ga0495622_0000200
926 Ga0495622_0012361
927 Ga0495622_0023613
928 Ga0495622_0038263
929 Ga0495633_0000033
930 Ga0495633_0002093
931 Ga0495633_0005218
932 Ga0495668_0000065
933 Ga0495668_0000091
934 Ga0495668_0001008
935 Ga0495668_0001717
936 Ga0495668_0015760
937 Ga0495634_0004297
938 Ga0495611_0000138
939 Ga0495611_0001788
940 Ga0495625_0000053
941 Ga0495625_0001001
942 Ga0495625_0001014
943 Ga0495625_0002078
944 Ga0495625_0002413
945 Ga0495625_0012164
946 Ga0495625_0067190
947 Ga0495625_0167288
948 Ga0495661_0005885
949 Ga0495661_0014053
950 Ga0495661_0053430
951 Ga0495661_0054007
952 Ga0495588_0006983
953 Ga0495588_0098457
954 Ga0495646_0015420
955 Ga0495613_0015911
956 Ga0495624_0000246
957 Ga0495670_0004734
958 Ga0495670_0005375
959 Ga0495670_0054576
960 Ga0495670_0057790
961 Ga0495671_0003507
962 Ga0495671_0005612
963 Ga0495671_0006549
964 Ga0495671_0028796
965 Ga0495671_0036944
966 Ga0495649_0002175
967 Ga0495649_0002400
968 Ga0495649_0004099
969 Ga0495649_0006529
970 Ga0495649_0009215
971 Ga0495589_0000757
972 Ga0495589_0002303
973 Ga0495589_0011140
974 Ga0495589_0017972
975 Ga0495600_0009236
976 Ga0495660_0001627
977 Ga0495660_0002618
978 Ga0495660_0003535
979 Ga0495660_0004303
980 Ga0495660_0019129
981 Ga0495660_0026592
982 Ga0495660_0035928
983 Ga0495660_0047999
984 Ga0495660_0073786
985 Ga0495672_0000021
986 Ga0495672_0000190
987 Ga0495672_0002300
988 Ga0495672_0005183
989 Ga0495672_0006938
990 Ga0495672_0009326
991 Ga0495672_0010921
992 Ga0495676_0003503
993 Ga0495680_0000992
994 Ga0495683_0000118
995 Ga0495683_0000253
996 Ga0495683_0000432
997 Ga0495683_0002512
998 Ga0495683_0004858
999 Ga0495683_0013671
1000 Ga0495687_004389
1001 Ga0495687_005137
1002 Ga0495687_009764
1003 Ga0495679_011037
1004 Ga0495673_0000178
1005 Ga0495673_0000221
1006 Ga0495673_0000254
1007 Ga0495673_0000288
1008 Ga0495673_0002129
1009 Ga0495673_0004056
1010 Ga0495673_0005757
1011 Ga0495673_0010038
1012 Ga0495681_0000026
1013 Ga0495681_0000651
1014 Ga0495681_0002585
1015 Ga0495681_0003670
1016 Ga0495681_0005251
1017 Ga0495681_0005456
1018 Ga0495681_0007400
1019 Ga0495681_0008469
1020 Ga0495681_0011006
1021 Ga0495681_0013061
1022 Ga0495681_0044101
1023 Ga0495681_0063483
1024 Ga0495686_0000919
1025 Ga0495686_0002090
1026 Ga0495686_0051668
1027 Ga0495593_0005549
1028 Ga0495602_0001096
1029 Ga0495626_0000033
1030 Ga0495626_0000132
1031 Ga0495626_0000236
1032 Ga0495626_0000467
1033 Ga0495626_0002379
1034 Ga0495626_0005816
1035 Ga0495626_0007154
1036 Ga0496110_0296033
1037 Ga0496116_0001028
1038 Ga0496117_0001482
1039 Ga0496117_0005243
1040 Ga0496117_0013991
1041 Ga0496118_0001585
1042 Ga0496118_0006662
1043 Ga0496118_0007118
1044 Ga0496121_0000871
1045 Ga0496121_0002025
1046 Ga0496121_0028579
1047 Ga0496122_0001143
1048 Ga0496122_0004800
1049 Ga0496123_0007794
1050 Ga0496124_0004132
1051 Ga0496124_0028336
1052 Ga0496124_0155062
1053 Ga0496124_0198101
1054 Ga0496125_0000619
1055 Ga0496125_0001480
1056 Ga0496125_0020605
1057 Ga0496125_0025864
1058 Ga0495678_003406
1059 Ga0495678_005536
1060 Ga0495678_007544
1061 Ga0495678_020151
1062 Ga0495678_022864
1063 Ga0495678_034683
1064 Ga0495678_056274
1065 Ga0495682_0004546
1066 Ga0495682_0020242
1067 Ga0495682_0023544
1068 Ga0501198_000017
1069 Ga0501222_000012
1070 Ga0501222_000076
1071 Ga0501265_003994
1072 Ga0501226_000123
1073 nmdc:mga03683_8257_c1
1074 nmdc:mga00v17_10896_c1
1075 nmdc:mga0k408_113899_c1
1076 nmdc:mga0k408_328_c1
1077 nmdc:mga07m45_48940_c1
1078 Ga0500568_0045547
1079 Ga0500586_001287
1080 2511304145
1081 2511304526
1082 2511322479
1083 2511323391
1084 2511352339
1085 2599884309
1086 2599896512
1087 2600016121
1088 2600030819
1089 2600051327
1090 2600360624
1091 2643843547
1092 2643953523
1093 2643953712
1094 2644021265
1095 2644021644
1096 2644072680
1097 2652543387
1098 2671089208
1099 2678263291
1100 2739260059
1101 2745009622
1102 2774137443
1103 2825652540
1104 2842714647
1105 2842855286
1106 2904425283
1107 2904522670
1108 2913041636
1109 2919456489
1110 2929146767
1111 2939640121
1112 2939656080
1113 3007622795
1114 8056129593
1115 8056146575
1116 8056178940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07044

DUF1329

Protein of unknown function (DUF1329)

98

461

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bk5-assembly1.cif.gz_A crystal structure of putative outer membrane lipoprotein-sorting protein domain from vibrio parahaemolyticus 0.7728 166 432
3bk5-assembly1.cif.gz_A crystal structure of putative outer membrane lipoprotein-sorting protein domain from vibrio parahaemolyticus 0.7549 166 432
4z48-assembly2.cif.gz_B crystal structure of a duf1329 family protein (despig_00262) from desulfovibrio piger atcc 29098 at 1.75 a resolution 0.7445 180 431
4z48-assembly2.cif.gz_B crystal structure of a duf1329 family protein (despig_00262) from desulfovibrio piger atcc 29098 at 1.75 a resolution 0.6833 180 431
3buu-assembly2.cif.gz_B crystal structure of lola superfamily protein ne2245 from nitrosomonas europaea 0.64 163 427
ID Description Score Start End Superfamily
3bk5A00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.745 166 432 2.50.20.10
af_Q9VJ98_137_284_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.743 363 388 3.40.630.30
3bk5A00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7276 166 432 2.50.20.10
4z48A00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7271 169 431 2.50.20.10
4z48A00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.694 169 431 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A0Q8IRW4-F1-model_v4 Outer membrane lipoprotein-sorting protein 0.9686 25 437
AF-A0A1Q7VN01-F1-model_v4 DUF1329 domain-containing protein 0.9634 44 437
AF-A0A166MCD3-F1-model_v4 DUF1329 domain-containing protein 0.958 24 437
AF-A0A2R4BIU3-F1-model_v4 DUF1329 protein 0.9568 29 437
AF-A0A7Z9H7M6-F1-model_v4 DUF1329 domain-containing protein 0.9563 37 392

Map