F463499

General Info

Members Datasets Scaffolds Average Seq Length
558 339 474 215

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0049475|Ga0501074_0049475_399_1055
Length 218
Sequence VSRPGEQLLRVQNFMLTTDGYGTGEGPSLERPFGHLDPAELASWAGATASWPNRADPGGTRGLDDYFTRDFSHDIGVEIMGSGKFGPPGWHEDPAWQGWWGDEPPFHTPVLVLTRHVRPSITLSDTTFHFVDAEPVEALRQAKDAAGGKDVRLGGGVSVVRSFLEADLVDTMHVAVAPVSAGGRGGKLWDSPDELLDRFHLEVVPSPSGITHHIFWRR

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
5 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221670 Streptomyces sp. Root431 Isolate Unclassified
11 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
12 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
13 2643221679 Angustibacter sp. Root456 Isolate Unclassified
14 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
15 2643221692 Nocardia sp. Root136 Isolate Unclassified
16 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
17 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
18 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
19 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
20 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
21 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
22 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
23 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
24 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
25 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
26 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
27 2808606448 Streptomyces sp. 193411 Isolate Unclassified
28 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
29 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
30 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
31 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
32 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
33 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
34 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
35 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
36 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
37 2867428634 Streptomyces sp. RP5T Isolate Unclassified
38 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
39 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
40 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
41 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
42 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
43 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
44 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
45 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
46 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
47 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
48 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
49 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
50 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
51 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
52 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
53 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
54 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
55 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
56 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
57 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
58 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
59 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
60 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
61 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
62 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
63 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
64 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
65 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
66 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
67 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
68 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
69 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
70 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
71 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
72 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
73 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
74 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
75 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
76 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
121 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
147 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
148 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
174 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
175 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
176 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
181 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
182 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
320 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
321 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
327 8002784119 Frankia sp. AgB1.9 Isolate Nodule
328 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
329 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
330 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
331 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
332 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
333 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
334 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
335 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
336 8054920844 Frankia tisae Agncl-8 Isolate Nodule
337 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
338 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
339 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.59
Metatranscriptomes 0.36
Isolates 15.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 7.89
Nodule 0.9
Rhizoplane 6.63
Rhizosphere 73.3
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10017258 3300002239 Bacteria 1116
2 rootH1_10074083 3300003316 Bacteria 1736
3 rootH2_10053788 3300003320 Bacteria 4998
4 rootL2_10043628 3300003322 Bacteria 1107
5 rootH1_10106340 3300003323 Bacteria 1438
6 JGI25160J50197_1027640 3300003354 Bacteria 1539
7 Ga0006562J51391_1062637 3300003578 Bacteria 1830
8 Ga0070668_100588106 3300005347 Bacteria 972
9 Ga0070671_100000977 3300005355 Bacteria 20963
10 Ga0070671_100086632 3300005355 Bacteria 2621
11 Ga0070667_100078813 3300005367 Bacteria 2815
12 Ga0070711_100554426 3300005439 Bacteria 954
13 Ga0070706_100097385 3300005467 Bacteria 2732
14 Ga0070698_100050895 3300005471 Bacteria 4220
15 Ga0070684_100934660 3300005535 Bacteria 813
16 Ga0070686_100113400 3300005544 Bacteria 1851
17 Ga0070665_100092094 3300005548 Bacteria 3036
18 Ga0070665_100673170 3300005548 Bacteria 1048
19 Ga0070665_100675617 3300005548 Bacteria 1046
20 Ga0068864_100379088 3300005618 Bacteria 1340
21 Ga0068864_100612132 3300005618 Bacteria 1058
22 Ga0068863_100002336 3300005841 Bacteria 18844
23 Ga0068863_100169632 3300005841 Bacteria 2093
24 Ga0068858_100661886 3300005842 Bacteria 1015
25 Ga0068860_100252541 3300005843 Bacteria 1718
26 Ga0068862_100001101 3300005844 Bacteria 25645
27 Ga0068862_100711111 3300005844 Bacteria 974
28 Ga0081455_10073688 3300005937 Bacteria 2822
29 Ga0075365_10011291 3300006038 Bacteria 5246
30 Ga0075365_10119155 3300006038 Bacteria 1819
31 Ga0075368_10009006 3300006042 Bacteria 3581
32 Ga0075368_10035210 3300006042 Bacteria 1953
33 Ga0075368_10089979 3300006042 Bacteria 1255
34 Ga0075363_100003846 3300006048 Bacteria 6473
35 Ga0075363_100007494 3300006048 Bacteria 5023
36 Ga0075364_10000849 3300006051 Bacteria 16097
37 Ga0075364_10042089 3300006051 Bacteria 2967
38 Ga0075364_10315730 3300006051 Bacteria 1064
39 Ga0075362_10009082 3300006177 Bacteria 3829
40 Ga0075367_10065174 3300006178 Bacteria 2181
41 Ga0075369_10008100 3300006186 Bacteria 4031
42 Ga0075369_10013387 3300006186 Bacteria 3256
43 Ga0075366_10151332 3300006195 Bacteria 1405
44 Ga0075370_10189034 3300006353 Bacteria 1213
45 Ga0075430_100117270 3300006846 Bacteria 2219
46 Ga0097620_100000044 3300006931 Bacteria 144391
47 Ga0075435_100973025 3300007076 Bacteria 741
48 Ga0105250_10034352 3300009092 Bacteria 2035
49 Ga0105250_10135670 3300009092 Bacteria 1018
50 Ga0105245_10019505 3300009098 Bacteria 5941
51 Ga0105245_10857071 3300009098 Bacteria 949
52 Ga0105247_10031072 3300009101 Bacteria 3240
53 Ga0105243_10000750 3300009148 Bacteria 31118
54 Ga0105243_10566844 3300009148 Bacteria 1088
55 Ga0105242_11330710 3300009176 Bacteria 743
56 Ga0105248_10239575 3300009177 Bacteria 2042
57 Ga0105248_10880598 3300009177 Bacteria 1011
58 Ga0105249_10003809 3300009553 Bacteria 13021
59 Ga0105249_10007789 3300009553 Bacteria 9333
60 Ga0105249_10641426 3300009553 Bacteria 1119
61 Ga0105239_10326097 3300010375 Bacteria 1732
62 Ga0105239_11000410 3300010375 Bacteria 961
63 Ga0105246_10490932 3300011119 Bacteria 1041
64 Ga0157369_10777689 3300013105 Bacteria 984
65 Ga0163162_10511978 3300013306 Bacteria 1330
66 Ga0157375_10575770 3300013308 Bacteria 1286
67 Ga0157375_10803871 3300013308 Bacteria 1089
68 Ga0163163_10021894 3300014325 Bacteria 6041
69 Ga0157380_10550716 3300014326 Bacteria 1131
70 Ga0157380_10588136 3300014326 Bacteria 1099
71 Ga0157379_10059877 3300014968 Bacteria 3405
72 Ga0157379_10241363 3300014968 Bacteria 1639
73 Ga0182007_10000820 3300015262 Bacteria 17338
74 Ga0183367_1004 3300015688 Bacteria 716880
75 Ga0213873_10092445 3300021358 Bacteria 861
76 Ga0213876_10022886 3300021384 Bacteria 3301
77 Ga0213875_10005320 3300021388 Bacteria 6923
78 Ga0213875_10011596 3300021388 Bacteria 4380
79 Ga0209758_1012033 3300025297 Bacteria 4909
80 Ga0207426_1001852 3300025302 Bacteria 15531
81 Ga0207642_10354007 3300025899 Bacteria 867
82 Ga0207684_10272654 3300025910 Bacteria 1460
83 Ga0207663_10488708 3300025916 Bacteria 955
84 Ga0207694_10456195 3300025924 Bacteria 1067
85 Ga0207687_10122487 3300025927 Bacteria 1947
86 Ga0207687_10336090 3300025927 Bacteria 1227
87 Ga0207644_10000835 3300025931 Bacteria 19555
88 Ga0207644_10749264 3300025931 Bacteria 816
89 Ga0207686_10286469 3300025934 Bacteria 1218
90 Ga0207709_10001151 3300025935 Bacteria 19257
91 Ga0207670_10783290 3300025936 Bacteria 794
92 Ga0207711_10315213 3300025941 Bacteria 1444
93 Ga0207712_10031034 3300025961 Bacteria 3596
94 Ga0207712_10079714 3300025961 Bacteria 2379
95 Ga0207668_10287574 3300025972 Bacteria 1351
96 Ga0207703_10184902 3300026035 Bacteria 1841
97 Ga0207703_10558660 3300026035 Bacteria 1080
98 Ga0207641_10003507 3300026088 Bacteria 13886
99 Ga0207641_10244651 3300026088 Bacteria 1673
100 Ga0207676_10307053 3300026095 Bacteria 1451
101 Ga0207675_100862520 3300026118 Bacteria 921
102 Ga0209813_10085617 3300027866 Bacteria 1049
103 Ga0209813_10160413 3300027866 Bacteria 811
104 Ga0268266_10062249 3300028379 Bacteria 3220
105 Ga0268265_10000205 3300028380 Bacteria 68729
106 Ga0268264_10075109 3300028381 Bacteria 2873
107 Ga0316177_1078076 3300030731 Bacteria 2304
108 Ga0314311_1183463 3300030733 Bacteria 2900
109 Ga0316180_1114495 3300030736 Bacteria 1373
110 Ga0265327_10013716 3300031251 Bacteria 5361
111 Ga0307509_10111814 3300031507 Bacteria 2733
112 Ga0307509_10144905 3300031507 Bacteria 2303
113 Ga0307408_100199833 3300031548 Bacteria 1617
114 Ga0307408_100767347 3300031548 Bacteria 872
115 Ga0307514_10162596 3300031649 Bacteria 1475
116 Ga0265314_10072367 3300031711 Bacteria 2303
117 Ga0316576_10169855 3300031727 Bacteria 1646
118 Ga0307516_10021923 3300031730 Bacteria 6563
119 Ga0307405_10107696 3300031731 Bacteria 1882
120 Ga0307410_10012126 3300031852 Bacteria 4966
121 Ga0307410_10172314 3300031852 Bacteria 1632
122 Ga0307410_10187966 3300031852 Bacteria 1569
123 Ga0307410_10386480 3300031852 Bacteria 1127
124 Ga0307406_10027987 3300031901 Bacteria 3402
125 Ga0307406_10468812 3300031901 Bacteria 1014
126 Ga0307406_10729932 3300031901 Bacteria 830
127 Ga0307406_10887214 3300031901 Bacteria 758
128 Ga0307407_10567272 3300031903 Bacteria 841
129 Ga0307409_100008711 3300031995 Bacteria 6180
130 Ga0307409_100692446 3300031995 Bacteria 1017
131 Ga0307416_100747255 3300032002 Bacteria 1070
132 Ga0307414_10346294 3300032004 Bacteria 1274
133 Ga0307507_10152726 3300033179 Bacteria 1731
134 Ga0373944_0119861 3300035089 Bacteria 906
135 Ga0373936_0230297 3300035113 Bacteria 824
136 Ga0373947_0077679 3300035725 Bacteria 2048
137 Ga0395898_0000804 3300037466 Bacteria 52956
138 Ga0395898_0160102 3300037466 Bacteria 2153
139 Ga0436364_0103177 3300037853 Bacteria 67977
140 Ga0436364_1000426 3300037853 Bacteria 33245
141 Ga0395901_0917122 3300038443 Bacteria 857
142 Ga0436365_0380684 3300039437 Bacteria 2891
143 Ga0436365_0926350 3300039437 Bacteria 810
144 Ga0436360_1196039 3300039438 Bacteria 3299
145 Ga0436362_0729387 3300039453 Bacteria 1554
146 Ga0436362_0777322 3300039453 Bacteria 9511
147 Ga0439436_0003333 3300041404 Bacteria 4872
148 Ga0439436_0008617 3300041404 Bacteria 3135
149 Ga0439439_0031775 3300041406 Bacteria 1346
150 Ga0439461_0003552 3300041410 Bacteria 2568
151 Ga0439466_0035115 3300041411 Bacteria 1696
152 Ga0439465_0003133 3300041413 Bacteria 5399
153 Ga0439465_0022572 3300041413 Bacteria 1977
154 Ga0451841_1195414 3300041498 Bacteria 1057
155 Ga0451853_4084173 3300041512 Bacteria 1139
156 Ga0439431_0000401 3300041997 Bacteria 9161
157 Ga0439433_0007032 3300041999 Bacteria 2429
158 Ga0439442_015914 3300042002 Bacteria 1550
159 Ga0439445_0006000 3300042004 Bacteria 2783
160 Ga0439445_0034740 3300042004 Bacteria 1322
161 Ga0439449_0000109 3300042007 Bacteria 26857
162 Ga0439449_0009889 3300042007 Bacteria 3606
163 Ga0439449_0019723 3300042007 Bacteria 2527
164 Ga0439457_000294 3300042014 Bacteria 13807
165 Ga0439457_000938 3300042014 Bacteria 8756
166 Ga0439462_0000129 3300042015 Bacteria 11957
167 Ga0439462_0002037 3300042015 Bacteria 4635
168 Ga0439434_0001224 3300042435 Bacteria 7394
169 Ga0466969_0064144 3300044656 Bacteria 1779
170 Ga0466972_0002980 3300044658 Bacteria 8379
171 Ga0466972_0006871 3300044658 Bacteria 5711
172 Ga0466972_0024808 3300044658 Bacteria 2975
173 Ga0466972_0039295 3300044658 Bacteria 2309
174 Ga0466965_0001514 3300044683 Bacteria 9421
175 Ga0466965_0002399 3300044683 Bacteria 7948
176 Ga0466965_0025537 3300044683 Bacteria 2859
177 Ga0466965_0044134 3300044683 Bacteria 2202
178 Ga0466965_0161679 3300044683 Bacteria 1174
179 Ga0466966_0032726 3300044684 Bacteria 3367
180 Ga0466966_0062149 3300044684 Bacteria 2355
181 Ga0466961_0003600 3300044693 Bacteria 9666
182 Ga0466961_0067637 3300044693 Bacteria 2269
183 Ga0466961_0083416 3300044693 Bacteria 2021
184 Ga0466963_0008454 3300044694 Bacteria 6167
185 Ga0466963_0178399 3300044694 Bacteria 1482
186 Ga0466963_0208162 3300044694 Bacteria 1368
187 Ga0466964_0003045 3300044706 Bacteria 6084
188 Ga0466964_0018576 3300044706 Bacteria 2669
189 Ga0466964_0274413 3300044706 Bacteria 840
190 Ga0466971_0000592 3300044719 Bacteria 14355
191 Ga0466971_0105748 3300044719 Bacteria 1296
192 Ga0466971_0311323 3300044719 Bacteria 757
193 Ga0466968_0000740 3300044735 Bacteria 11310
194 Ga0466968_0201591 3300044735 Bacteria 932
195 Ga0466970_0001101 3300044765 Bacteria 13083
196 Ga0466970_0004857 3300044765 Bacteria 6635
197 Ga0466970_0005433 3300044765 Bacteria 6323
198 Ga0466970_0030354 3300044765 Bacteria 2850
199 Ga0466970_0252582 3300044765 Bacteria 988
200 Ga0466957_0065851 3300044842 Bacteria 2232
201 Ga0466957_0170766 3300044842 Bacteria 1416
202 Ga0466960_0000211 3300044901 Bacteria 20062
203 Ga0466960_0001994 3300044901 Bacteria 7573
204 Ga0466960_0046631 3300044901 Bacteria 2075
205 Ga0466960_0090671 3300044901 Bacteria 1557
206 Ga0466960_0162857 3300044901 Bacteria 1199
207 Ga0466960_0200447 3300044901 Bacteria 1090
208 Ga0466960_0393608 3300044901 Bacteria 797
209 Ga0466959_0016218 3300045049 Bacteria 5439
210 Ga0466959_0034141 3300045049 Bacteria 3764
211 Ga0466959_0223484 3300045049 Bacteria 1305
212 Ga0466958_0003654 3300045836 Bacteria 8030
213 Ga0466958_0037421 3300045836 Bacteria 2907
214 Ga0466958_0478388 3300045836 Bacteria 807
215 Ga0466967_0017271 3300045976 Bacteria 5722
216 Ga0466967_0109662 3300045976 Bacteria 2534
217 Ga0466967_0892094 3300045976 Bacteria 884
218 Ga0466967_1076754 3300045976 Bacteria 801
219 Ga0495592_0077915 3300046454 Bacteria 2401
220 Ga0495592_0225759 3300046454 Bacteria 1249
221 Ga0495603_0002322 3300046455 Bacteria 11164
222 Ga0495603_0019438 3300046455 Bacteria 4110
223 Ga0495603_0038104 3300046455 Bacteria 2883
224 Ga0495629_0002081 3300046459 Bacteria 15520
225 Ga0495638_0202120 3300046460 Bacteria 1121
226 Ga0495638_0204256 3300046460 Bacteria 1113
227 Ga0495651_0106461 3300046462 Bacteria 2078
228 Ga0495653_0111818 3300046463 Bacteria 1961
229 Ga0495662_0000547 3300046476 Bacteria 17232
230 Ga0495585_0013239 3300046492 Bacteria 4832
231 Ga0495585_0015891 3300046492 Bacteria 4368
232 Ga0495585_0028621 3300046492 Bacteria 3177
233 Ga0495594_0002842 3300046499 Bacteria 9002
234 Ga0495594_0009130 3300046499 Bacteria 5118
235 Ga0495594_0078508 3300046499 Bacteria 1842
236 Ga0495594_0292609 3300046499 Bacteria 928
237 Ga0495583_0151532 3300046506 Bacteria 961
238 Ga0495608_0009100 3300046511 Bacteria 6942
239 Ga0495608_0133987 3300046511 Bacteria 1584
240 Ga0495618_0018061 3300046514 Bacteria 4329
241 Ga0495618_0102918 3300046514 Bacteria 1828
242 Ga0495620_0013702 3300046515 Bacteria 4145
243 Ga0495628_0003272 3300046516 Bacteria 14506
244 Ga0495628_0004772 3300046516 Bacteria 11946
245 Ga0495628_0009608 3300046516 Bacteria 8252
246 Ga0495630_0034365 3300046517 Bacteria 3786
247 Ga0495631_0107065 3300046518 Bacteria 1202
248 Ga0495648_0011675 3300046524 Bacteria 6596
249 Ga0495648_0155259 3300046524 Bacteria 1189
250 Ga0495666_0004007 3300046526 Bacteria 7445
251 Ga0495666_0063679 3300046526 Bacteria 1760
252 Ga0495652_0001657 3300046529 Bacteria 24202
253 Ga0495654_0042419 3300046530 Bacteria 2259
254 Ga0495640_0002082 3300046533 Bacteria 15936
255 Ga0495640_0040188 3300046533 Bacteria 3276
256 Ga0495640_0183313 3300046533 Bacteria 1333
257 Ga0495586_0004211 3300046535 Bacteria 7706
258 Ga0495586_0285764 3300046535 Bacteria 944
259 Ga0495586_0306556 3300046535 Bacteria 910
260 Ga0495587_0006071 3300046536 Bacteria 7880
261 Ga0495587_0071459 3300046536 Bacteria 2018
262 Ga0495645_0025308 3300046543 Bacteria 4306
263 Ga0495645_0126268 3300046543 Bacteria 1797
264 Ga0495645_0167564 3300046543 Bacteria 1514
265 Ga0495622_0001327 3300046557 Bacteria 12666
266 Ga0495667_0007329 3300046559 Bacteria 7481
267 Ga0495667_0112976 3300046559 Bacteria 1755
268 Ga0495668_0022079 3300046616 Bacteria 3641
269 Ga0495668_0022327 3300046616 Bacteria 3618
270 Ga0495668_0483775 3300046616 Bacteria 682
271 Ga0495634_0048813 3300046642 Bacteria 2848
272 Ga0495634_0060553 3300046642 Bacteria 2518
273 Ga0495634_0139408 3300046642 Bacteria 1541
274 Ga0495611_0013640 3300046648 Bacteria 3462
275 Ga0495611_0194719 3300046648 Bacteria 946
276 Ga0495635_0007290 3300046663 Bacteria 7726
277 Ga0495588_0013525 3300046674 Bacteria 3890
278 Ga0495588_0069685 3300046674 Bacteria 1828
279 Ga0495657_0009359 3300046675 Bacteria 7431
280 Ga0495599_0027395 3300046678 Bacteria 3572
281 Ga0495623_0041863 3300046679 Bacteria 2919
282 Ga0495623_0194047 3300046679 Bacteria 1171
283 Ga0495646_0001219 3300046680 Bacteria 15076
284 Ga0495646_0098114 3300046680 Bacteria 1683
285 Ga0495613_0001604 3300046689 Bacteria 17173
286 Ga0495613_0047613 3300046689 Bacteria 3167
287 Ga0495613_0093607 3300046689 Bacteria 2175
288 Ga0495624_0052502 3300046690 Bacteria 2576
289 Ga0495624_0228874 3300046690 Bacteria 1126
290 Ga0495624_0331998 3300046690 Bacteria 915
291 Ga0495589_0022590 3300046794 Bacteria 3209
292 Ga0495600_0221964 3300046809 Bacteria 1208
293 Ga0495600_0370010 3300046809 Bacteria 895
294 Ga0495581_0207623 3300047315 Bacteria 1146
295 Ga0495604_0040314 3300047317 Bacteria 3667
296 Ga0495674_0109895 3300047319 Bacteria 2338
297 Ga0495672_0013120 3300047320 Bacteria 5731
298 Ga0495676_0002322 3300047321 Bacteria 16872
299 Ga0495676_0024673 3300047321 Bacteria 5200
300 Ga0495676_0025920 3300047321 Bacteria 5053
301 Ga0495676_0039139 3300047321 Bacteria 3930
302 Ga0495680_0022675 3300047322 Bacteria 5231
303 Ga0495683_0023102 3300047323 Bacteria 3197
304 Ga0495687_010335 3300047443 Bacteria 5125
305 Ga0495675_0013724 3300047444 Bacteria 5120
306 Ga0495675_0127096 3300047444 Bacteria 1586
307 Ga0495675_0294790 3300047444 Bacteria 964
308 Ga0495677_0235676 3300047445 Bacteria 714
309 Ga0495673_0002452 3300047469 Bacteria 13057
310 Ga0495684_0034436 3300047471 Bacteria 3885
311 Ga0495686_0209016 3300047472 Bacteria 1116
312 Ga0495593_0054589 3300047673 Bacteria 2105
313 Ga0495602_0005980 3300048088 Bacteria 12776
314 Ga0495602_0252806 3300048088 Bacteria 1312
315 Ga0496100_0038566 3300048903 Bacteria 3028
316 Ga0496101_0025252 3300048904 Bacteria 4121
317 Ga0496101_0480319 3300048904 Bacteria 981
318 Ga0496102_0000590 3300048905 Bacteria 38332
319 Ga0496102_0104015 3300048905 Bacteria 2641
320 Ga0496102_0154458 3300048905 Bacteria 2157
321 Ga0496102_0232061 3300048905 Bacteria 1740
322 Ga0496103_0079792 3300048906 Bacteria 2057
323 Ga0496104_0490451 3300048907 Bacteria 1140
324 Ga0496104_0495339 3300048907 Bacteria 1133
325 Ga0496105_0022926 3300048908 Bacteria 5062
326 Ga0496105_0055119 3300048908 Bacteria 3283
327 Ga0496106_0000747 3300048909 Bacteria 23467
328 Ga0496106_0043235 3300048909 Bacteria 3380
329 Ga0496106_0212102 3300048909 Bacteria 1543
330 Ga0496108_0015708 3300048911 Bacteria 6176
331 Ga0496108_0124761 3300048911 Bacteria 2210
332 Ga0496108_0619928 3300048911 Bacteria 942
333 Ga0496108_0624370 3300048911 Bacteria 938
334 Ga0496109_0009070 3300048912 Bacteria 8472
335 Ga0496109_0018281 3300048912 Bacteria 6156
336 Ga0496109_0288446 3300048912 Bacteria 1547
337 Ga0496109_0547912 3300048912 Bacteria 1091
338 Ga0496110_0013951 3300048913 Bacteria 6658
339 Ga0496110_0017095 3300048913 Bacteria 6064
340 Ga0496110_0097497 3300048913 Bacteria 2634
341 Ga0496110_0408425 3300048913 Bacteria 1238
342 Ga0496111_0066284 3300048914 Bacteria 2622
343 Ga0496111_0155111 3300048914 Bacteria 1699
344 Ga0496111_0206415 3300048914 Bacteria 1460
345 Ga0496112_0041345 3300048915 Bacteria 4510
346 Ga0496112_0277697 3300048915 Bacteria 1623
347 Ga0496113_0397505 3300048916 Bacteria 1106
348 Ga0496114_0136760 3300048917 Bacteria 2119
349 Ga0496114_0176818 3300048917 Bacteria 1863
350 Ga0496115_0022882 3300048918 Bacteria 4848
351 Ga0496122_0019211 3300048925 Bacteria 6254
352 Ga0496123_0081978 3300048926 Bacteria 1957
353 Ga0496125_0042008 3300048928 Bacteria 3901
354 Ga0496126_0000037 3300048929 Bacteria 353425
355 Ga0496126_0020724 3300048929 Bacteria 6438
356 Ga0501321_015613 3300049537 Bacteria 896
357 Ga0501032_0000689 3300049569 Bacteria 27464
358 Ga0501032_0119194 3300049569 Bacteria 1745
359 Ga0501033_0018191 3300049570 Bacteria 5310
360 Ga0501033_0109880 3300049570 Bacteria 2007
361 Ga0501034_0003410 3300049571 Bacteria 18139
362 Ga0501034_0007309 3300049571 Bacteria 11771
363 Ga0501034_0019166 3300049571 Bacteria 7005
364 Ga0501034_0024703 3300049571 Bacteria 6112
365 Ga0501034_0035561 3300049571 Bacteria 5049
366 Ga0501034_0120583 3300049571 Bacteria 2609
367 Ga0501034_0130730 3300049571 Bacteria 2494
368 Ga0501036_0000486 3300049572 Bacteria 28397
369 Ga0501036_0002369 3300049572 Bacteria 14736
370 Ga0501036_0075313 3300049572 Bacteria 2855
371 Ga0501036_0079713 3300049572 Bacteria 2769
372 Ga0501036_0538942 3300049572 Bacteria 970
373 Ga0501037_0000239 3300049573 Bacteria 47096
374 Ga0501037_0006239 3300049573 Bacteria 8719
375 Ga0501037_0012641 3300049573 Bacteria 6220
376 Ga0501037_0630647 3300049573 Bacteria 718
377 Ga0501038_0003441 3300049574 Bacteria 14762
378 Ga0501038_0018884 3300049574 Bacteria 6224
379 Ga0501038_0136804 3300049574 Bacteria 2006
380 Ga0501039_0002630 3300049575 Bacteria 13411
381 Ga0501039_0465964 3300049575 Bacteria 992
382 Ga0501039_0516415 3300049575 Bacteria 938
383 Ga0501039_0545872 3300049575 Bacteria 909
384 Ga0501040_0030738 3300049576 Bacteria 3628
385 Ga0501041_0010231 3300049577 Bacteria 5528
386 Ga0501042_0340855 3300049578 Bacteria 1084
387 Ga0501042_0409057 3300049578 Bacteria 983
388 Ga0501043_0004194 3300049579 Bacteria 11766
389 Ga0501043_0014850 3300049579 Bacteria 6096
390 Ga0501043_0016735 3300049579 Bacteria 5746
391 Ga0501043_0063589 3300049579 Bacteria 2898
392 Ga0501046_0025372 3300049580 Bacteria 4851
393 Ga0501046_0072691 3300049580 Bacteria 2670
394 Ga0501047_0016832 3300049581 Bacteria 6985
395 Ga0501047_0052308 3300049581 Bacteria 3947
396 Ga0501047_0500959 3300049581 Bacteria 1041
397 Ga0501067_0013599 3300049583 Bacteria 4506
398 Ga0501068_0001322 3300049584 Bacteria 13148
399 Ga0501068_0205828 3300049584 Bacteria 1249
400 Ga0501070_0009655 3300049586 Bacteria 8157
401 Ga0501070_0439912 3300049586 Bacteria 1052
402 Ga0501071_0008128 3300049587 Bacteria 6919
403 Ga0501071_0125734 3300049587 Bacteria 1903
404 Ga0501071_0169307 3300049587 Bacteria 1635
405 Ga0501071_0288475 3300049587 Bacteria 1243
406 Ga0501072_0022272 3300049588 Bacteria 4915
407 Ga0501073_0005451 3300049589 Bacteria 9534
408 Ga0501073_0031623 3300049589 Bacteria 3776
409 Ga0501073_0045475 3300049589 Bacteria 3091
410 Ga0501074_0031987 3300049590 Bacteria 3813
411 Ga0501074_0049475 3300049590 Bacteria 3035
412 Ga0501074_0635245 3300049590 Bacteria 754
413 Ga0501075_0264874 3300049591 Bacteria 1310
414 Ga0501076_0207157 3300049592 Bacteria 1602
415 Ga0501076_0587721 3300049592 Bacteria 918
416 Ga0501076_0799519 3300049592 Bacteria 778
417 Ga0501261_024606 3300049690 Bacteria 882
418 Ga0501079_0035300 3300049741 Bacteria 3848
419 Ga0501080_0140646 3300049742 Bacteria 2231
420 Ga0501035_0000769 3300049822 Bacteria 34454
421 Ga0501035_0048967 3300049822 Bacteria 3788
422 Ga0501035_0098939 3300049822 Bacteria 2561
423 Ga0501035_0312904 3300049822 Bacteria 1321
424 Ga0501044_0007706 3300049823 Bacteria 11841
425 Ga0501044_0008295 3300049823 Bacteria 11389
426 Ga0501044_0010533 3300049823 Bacteria 10035
427 Ga0501044_0056692 3300049823 Bacteria 4023
428 Ga0501044_0422764 3300049823 Bacteria 1242
429 Ga0501044_0609343 3300049823 Bacteria 984
430 Ga0501045_0032416 3300049824 Bacteria 3786
431 nmdc:mga03n38_100381_c1 3300050490 Bacteria 1395
432 nmdc:mga03n38_130226_c1 3300050490 Bacteria 1246
433 nmdc:mga03n38_39051_c1 3300050490 Bacteria 2057
434 nmdc:mga00v17_177320_c1 3300050491 Bacteria 1375
435 nmdc:mga00v17_24911_c1 3300050491 Bacteria 3473
436 nmdc:mga00v17_625354_c1 3300050491 Bacteria 693
437 nmdc:mga0yw44_181579_c1 3300050492 Bacteria 1385
438 nmdc:mga0yw44_43993_c1 3300050492 Bacteria 2669
439 nmdc:mga0yw44_5969_c1 3300050492 Bacteria 5829
440 nmdc:mga0yw44_79388_c1 3300050492 Bacteria 2053
441 nmdc:mga06z11_14046_c1 3300050494 Bacteria 3535
442 nmdc:mga06z11_73613_c1 3300050494 Bacteria 1814
443 nmdc:mga04h51_100110_c1 3300050495 Bacteria 1055
444 nmdc:mga04h51_9492_c1 3300050495 Bacteria 2640
445 nmdc:mga07m45_17973_c1 3300050496 Bacteria 3807
446 nmdc:mga05p37_496825_c1 3300050507 Bacteria 1401
447 nmdc:mga0qj67_103798_c1 3300050509 Bacteria 2293
448 nmdc:mga06r32_649452_c1 3300050510 Bacteria 1023
449 nmdc:mga08y16_111255_c1 3300050511 Bacteria 2851
450 nmdc:mga0sz30_10444_c1 3300050516 Bacteria 3561
451 nmdc:mga0sz30_313355_c1 3300050516 Bacteria 700
452 nmdc:mga0sz30_37501_c1 3300050516 Bacteria 2029
453 Ga0495601_0000461 3300053077 Bacteria 21375
454 Ga0495601_0067635 3300053077 Bacteria 2276
455 Ga0495601_0174196 3300053077 Bacteria 1406
456 Ga0495612_0007194 3300053078 Bacteria 4552
457 Ga0495612_0228739 3300053078 Bacteria 824
458 Ga0495619_0002136 3300053085 Bacteria 13111
459 Ga0495619_0011923 3300053085 Bacteria 5474
460 Ga0495619_0177616 3300053085 Bacteria 1473
461 Ga0495619_0218742 3300053085 Bacteria 1319
462 Ga0500556_0001763 3300053104 Bacteria 8098
463 Ga0500560_106804 3300053107 Bacteria 938
464 Ga0500593_000181 3300053117 Bacteria 25642
465 Ga0500616_0000171 3300053153 Bacteria 108118
466 Ga0500616_0003998 3300053153 Bacteria 10756
467 Ga0501084_0016947 3300054114 Bacteria 6055
468 Ga0501084_0407026 3300054114 Bacteria 1150
469 Ga0501082_0094632 3300060353 Bacteria 2581
470 Ga0466962_0005612 3300061719 Bacteria 6026
471 Ga0466962_0047042 3300061719 Bacteria 2061
472 Ga0530510_0014960 3300061734 Bacteria 5478
473 Ga0530510_0299456 3300061734 Bacteria 1203
474 Ga0530510_0490288 3300061734 Bacteria 931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2946064051 2946067056 164
2 3300031727 Ga0316576_10169855 Ga0316576_101698551 204
3 3300046616 Ga0495668_0483775 Ga0495668_0483775_11_625 204
4 3300005471 Ga0070698_100050895 Ga0070698_1000508952 206
5 3300047472 Ga0495686_0209016 Ga0495686_0209016_199_873 206
6 3300049580 Ga0501046_0025372 Ga0501046_0025372_1217_1867 206
7 3300037466 Ga0395898_0000804 Ga0395898_0000804_45016_45639 207
8 3300038443 Ga0395901_0917122 Ga0395901_0917122_51_674 207
9 3300041404 Ga0439436_0008617 Ga0439436_0008617_1612_2235 207
10 3300041406 Ga0439439_0031775 Ga0439439_0031775_561_1184 207
11 3300042007 Ga0439449_0019723 Ga0439449_0019723_701_1324 207
12 3300042014 Ga0439457_000294 Ga0439457_000294_3715_4338 207
13 3300044658 Ga0466972_0006871 Ga0466972_0006871_2617_3240 207
14 3300044683 Ga0466965_0001514 Ga0466965_0001514_614_1237 207
15 3300044684 Ga0466966_0032726 Ga0466966_0032726_1491_2114 207
16 3300044693 Ga0466961_0003600 Ga0466961_0003600_1979_2602 207
17 3300044694 Ga0466963_0008454 Ga0466963_0008454_162_785 207
18 3300044706 Ga0466964_0003045 Ga0466964_0003045_2585_3208 207
19 3300044719 Ga0466971_0000592 Ga0466971_0000592_4498_5121 207
20 3300044765 Ga0466970_0004857 Ga0466970_0004857_2499_3122 207
21 3300044842 Ga0466957_0065851 Ga0466957_0065851_1491_2114 207
22 3300045049 Ga0466959_0016218 Ga0466959_0016218_4498_5121 207
23 3300045836 Ga0466958_0003654 Ga0466958_0003654_7160_7783 207
24 3300045976 Ga0466967_0017271 Ga0466967_0017271_1978_2601 207
25 3300046499 Ga0495594_0292609 Ga0495594_0292609_44_667 207
26 3300046809 Ga0495600_0370010 Ga0495600_0370010_28_651 207
27 3300047444 Ga0495675_0294790 Ga0495675_0294790_277_900 207
28 3300048911 Ga0496108_0015708 Ga0496108_0015708_3284_3907 207
29 3300049570 Ga0501033_0109880 Ga0501033_0109880_982_1605 207
30 3300050494 nmdc:mga06z11_73613_c1 nmdc:mga06z11_73613_c1_772_1395 207
31 3300061719 Ga0466962_0005612 Ga0466962_0005612_247_870 207
32 3300046674 Ga0495588_0069685 Ga0495588_0069685_1151_1777 208
33 3300050491 nmdc:mga00v17_24911_c1 nmdc:mga00v17_24911_c1_827_1453 208
34 3300050510 nmdc:mga06r32_649452_c1 nmdc:mga06r32_649452_c1_301_954 208
35 3300050516 nmdc:mga0sz30_313355_c1 nmdc:mga0sz30_313355_c1_53_679 208
36 3300031548 Ga0307408_100199833 Ga0307408_1001998333 209
37 3300031731 Ga0307405_10107696 Ga0307405_101076962 209
38 3300031852 Ga0307410_10012126 Ga0307410_100121261 209
39 3300031995 Ga0307409_100008711 Ga0307409_1000087114 209
40 3300050490 nmdc:mga03n38_100381_c1 nmdc:mga03n38_100381_c1_283_915 209
41 iso_pu_bacteria 2515154155 2515855005 209
42 iso_pu_bacteria 2565956761 2566992074 209
43 iso_pu_bacteria 2738541308 2738891089 209
44 iso_pu_bacteria 2738543005 2739205013 209
45 iso_pu_bacteria 2904535858 2904538523 209
46 iso_pu_bacteria 2939582691 2939585626 209
47 iso_pu_bacteria 2974315732 2974316738 209
48 iso_pu_bacteria 2984523437 2984524919 209
49 3300037466 Ga0395898_0160102 Ga0395898_0160102_1404_2036 210
50 3300048905 Ga0496102_0154458 Ga0496102_0154458_564_1223 210
51 3300048907 Ga0496104_0490451 Ga0496104_0490451_316_975 210
52 3300048908 Ga0496105_0055119 Ga0496105_0055119_657_1316 210
53 3300048912 Ga0496109_0288446 Ga0496109_0288446_508_1167 210
54 3300048913 Ga0496110_0097497 Ga0496110_0097497_884_1543 210
55 3300048914 Ga0496111_0066284 Ga0496111_0066284_1181_1840 210
56 3300048917 Ga0496114_0136760 Ga0496114_0136760_699_1358 210
57 iso_pu_bacteria 2547132111 2547405822 210
58 iso_pu_bacteria 2547132111 2547409960 210
59 iso_pu_bacteria 2582581312 2585301023 210
60 iso_pu_bacteria 2582581313 2585309452 210
61 iso_pu_bacteria 2616644941 2616904815 210
62 iso_pu_bacteria 2643221548 2643764203 210
63 iso_pu_bacteria 2643221578 2643900334 210
64 iso_pu_bacteria 2643221587 2643943683 210
65 iso_pu_bacteria 2643221670 2644388299 210
66 iso_pu_bacteria 2643221673 2644405442 210
67 iso_pu_bacteria 2643221677 2644434058 210
68 iso_pu_bacteria 2643221679 2644444211 210
69 iso_pu_bacteria 2643221682 2644460461 210
70 iso_pu_bacteria 2643221692 2644513313 210
71 iso_pu_bacteria 2643221715 2644634044 210
72 iso_pu_bacteria 2684623035 2686534403 210
73 iso_pu_bacteria 2687453743 2689996540 210
74 iso_pu_bacteria 2738543011 2739236322 210
75 iso_pu_bacteria 2784746763 2785344568 210
76 iso_pu_bacteria 2791355406 2793978549 210
77 iso_pu_bacteria 2808606365 2808871966 210
78 iso_pu_bacteria 2808606375 2808914098 210
79 iso_pu_bacteria 2808606448 2809232193 210
80 iso_pu_bacteria 2811994879 2812358816 210
81 iso_pu_bacteria 2842134933 2842137436 210
82 iso_pu_bacteria 2852635781 2852641898 210
83 iso_pu_bacteria 2862178590 2862185753 210
84 iso_pu_bacteria 2862281513 2862290362 210
85 iso_pu_bacteria 2862507626 2862508822 210
86 iso_pu_bacteria 2862705112 2862705697 210
87 iso_pu_bacteria 2866552031 2866553402 210
88 iso_pu_bacteria 2866612099 2866614163 210
89 iso_pu_bacteria 2867428634 2867428903 210
90 iso_pu_bacteria 2870782633 2870787586 210
91 iso_pu_bacteria 2875391855 2875395743 210
92 iso_pu_bacteria 2889300758 2889304212 210
93 iso_pu_bacteria 2895880812 2895889695 210
94 iso_pu_bacteria 2902810491 2902813045 210
95 iso_pu_bacteria 2912715099 2912715138 210
96 iso_pu_bacteria 2912715099 2912721367 210
97 iso_pu_bacteria 2912757875 2912760930 210
98 iso_pu_bacteria 2918501144 2918506791 210
99 iso_pu_bacteria 2919468124 2919475656 210
100 iso_pu_bacteria 2929212328 2929218295 210
101 iso_pu_bacteria 2935390628 2935394230 210
102 iso_pu_bacteria 2939743619 2939745394 210
103 iso_pu_bacteria 2946045630 2946049328 210
104 iso_pu_bacteria 2946072368 2946073750 210
105 iso_pu_bacteria 2954711539 2954719715 210
106 iso_pu_bacteria 2954721474 2954729750 210
107 iso_pu_bacteria 2954731030 2954732029 210
108 iso_pu_bacteria 2954740390 2954748656 210
109 iso_pu_bacteria 2954749733 2954750998 210
110 iso_pu_bacteria 2954759201 2954767773 210
111 iso_pu_bacteria 2966598605 2966605291 210
112 iso_pu_bacteria 3006321560 3006327361 210
113 iso_pu_bacteria 3006393351 3006396812 210
114 iso_pu_bacteria 3006425503 3006429806 210
115 iso_pu_bacteria 3006486233 3006491228 210
116 iso_pu_bacteria 8002784119 8002789451 210
117 iso_pu_bacteria 8008485437 8008490849 210
118 iso_pu_bacteria 8023623736 8023629681 210
119 iso_pu_bacteria 8025524527 8025527758 210
120 iso_pu_bacteria 8047893842 8047903193 210
121 iso_pu_bacteria 8048356638 8048365779 210
122 iso_pu_bacteria 8048369669 8048379368 210
123 iso_pu_bacteria 8048379754 8048388475 210
124 iso_pu_bacteria 8048406513 8048407935 210
125 iso_pu_bacteria 8054920844 8054927319 210
126 iso_pu_bacteria 8055157932 8055162145 210
127 iso_pu_bacteria 8056060235 8056060804 210
128 iso_pu_bacteria 8056447290 8056448260 210
129 3300006038 Ga0075365_10119155 Ga0075365_101191552 211
130 3300044901 Ga0466960_0200447 Ga0466960_0200447_396_1034 211
131 3300050492 nmdc:mga0yw44_5969_c1 nmdc:mga0yw44_5969_c1_1227_1862 211
132 3300053104 Ga0500556_0001763 Ga0500556_0001763_6752_7387 211
133 3300053117 Ga0500593_000181 Ga0500593_000181_15048_15683 211
134 iso_pu_bacteria 2947224130 2947230185 212
135 3300003316 rootH1_10074083 rootH1_100740832 213
136 3300006048 Ga0075363_100003846 Ga0075363_1000038467 213
137 3300009148 Ga0105243_10000750 Ga0105243_1000075016 213
138 3300015688 Ga0183367_1004 Ga0183367_1004490 213
139 3300025935 Ga0207709_10001151 Ga0207709_1000115115 213
140 3300031852 Ga0307410_10187966 Ga0307410_101879662 213
141 3300031901 Ga0307406_10729932 Ga0307406_107299321 213
142 3300042004 Ga0439445_0034740 Ga0439445_0034740_266_967 213
143 3300048928 Ga0496125_0042008 Ga0496125_0042008_1275_1916 213
144 3300049590 Ga0501074_0049475 Ga0501074_0049475_399_1055 213
145 3300050496 nmdc:mga07m45_17973_c1 nmdc:mga07m45_17973_c1_2978_3619 213
146 3300002239 JGI24034J26672_10017258 JGI24034J26672_100172582 214
147 3300003320 rootH2_10053788 rootH2_100537886 214
148 3300003322 rootL2_10043628 rootL2_100436282 214
149 3300003323 rootH1_10106340 rootH1_101063402 214
150 3300003354 JGI25160J50197_1027640 JGI25160J50197_10276402 214
151 3300003578 Ga0006562J51391_1062637 Ga0006562J51391_10626372 214
152 3300005347 Ga0070668_100588106 Ga0070668_1005881061 214
153 3300005355 Ga0070671_100000977 Ga0070671_10000097720 214
154 3300005355 Ga0070671_100086632 Ga0070671_1000866323 214
155 3300005367 Ga0070667_100078813 Ga0070667_1000788132 214
156 3300005439 Ga0070711_100554426 Ga0070711_1005544261 214
157 3300005467 Ga0070706_100097385 Ga0070706_1000973854 214
158 3300005535 Ga0070684_100934660 Ga0070684_1009346601 214
159 3300005544 Ga0070686_100113400 Ga0070686_1001134002 214
160 3300005548 Ga0070665_100092094 Ga0070665_1000920942 214
161 3300005548 Ga0070665_100673170 Ga0070665_1006731701 214
162 3300005548 Ga0070665_100675617 Ga0070665_1006756172 214
163 3300005618 Ga0068864_100379088 Ga0068864_1003790882 214
164 3300005618 Ga0068864_100612132 Ga0068864_1006121322 214
165 3300005841 Ga0068863_100002336 Ga0068863_1000023362 214
166 3300005841 Ga0068863_100169632 Ga0068863_1001696322 214
167 3300005842 Ga0068858_100661886 Ga0068858_1006618861 214
168 3300005843 Ga0068860_100252541 Ga0068860_1002525412 214
169 3300005844 Ga0068862_100001101 Ga0068862_10000110115 214
170 3300005844 Ga0068862_100711111 Ga0068862_1007111111 214
171 3300005937 Ga0081455_10073688 Ga0081455_100736884 214
172 3300006038 Ga0075365_10011291 Ga0075365_100112915 214
173 3300006042 Ga0075368_10009006 Ga0075368_100090064 214
174 3300006042 Ga0075368_10035210 Ga0075368_100352104 214
175 3300006042 Ga0075368_10089979 Ga0075368_100899792 214
176 3300006048 Ga0075363_100007494 Ga0075363_1000074942 214
177 3300006051 Ga0075364_10000849 Ga0075364_100008495 214
178 3300006051 Ga0075364_10042089 Ga0075364_100420894 214
179 3300006051 Ga0075364_10315730 Ga0075364_103157302 214
180 3300006177 Ga0075362_10009082 Ga0075362_100090822 214
181 3300006178 Ga0075367_10065174 Ga0075367_100651741 214
182 3300006186 Ga0075369_10008100 Ga0075369_100081002 214
183 3300006186 Ga0075369_10013387 Ga0075369_100133875 214
184 3300006195 Ga0075366_10151332 Ga0075366_101513322 214
185 3300006353 Ga0075370_10189034 Ga0075370_101890342 214
186 3300006846 Ga0075430_100117270 Ga0075430_1001172703 214
187 3300006931 Ga0097620_100000044 Ga0097620_100000044116 214
188 3300007076 Ga0075435_100973025 Ga0075435_1009730251 214
189 3300009092 Ga0105250_10034352 Ga0105250_100343522 214
190 3300009092 Ga0105250_10135670 Ga0105250_101356702 214
191 3300009098 Ga0105245_10019505 Ga0105245_100195058 214
192 3300009098 Ga0105245_10857071 Ga0105245_108570712 214
193 3300009101 Ga0105247_10031072 Ga0105247_100310724 214
194 3300009148 Ga0105243_10566844 Ga0105243_105668441 214
195 3300009176 Ga0105242_11330710 Ga0105242_113307101 214
196 3300009177 Ga0105248_10239575 Ga0105248_102395752 214
197 3300009177 Ga0105248_10880598 Ga0105248_108805982 214
198 3300009553 Ga0105249_10003809 Ga0105249_100038093 214
199 3300009553 Ga0105249_10007789 Ga0105249_100077899 214
200 3300009553 Ga0105249_10641426 Ga0105249_106414261 214
201 3300010375 Ga0105239_10326097 Ga0105239_103260973 214
202 3300010375 Ga0105239_11000410 Ga0105239_110004102 214
203 3300011119 Ga0105246_10490932 Ga0105246_104909321 214
204 3300013105 Ga0157369_10777689 Ga0157369_107776892 214
205 3300013306 Ga0163162_10511978 Ga0163162_105119781 214
206 3300013308 Ga0157375_10575770 Ga0157375_105757701 214
207 3300013308 Ga0157375_10803871 Ga0157375_108038711 214
208 3300014325 Ga0163163_10021894 Ga0163163_100218944 214
209 3300014326 Ga0157380_10550716 Ga0157380_105507162 214
210 3300014326 Ga0157380_10588136 Ga0157380_105881362 214
211 3300014968 Ga0157379_10059877 Ga0157379_100598771 214
212 3300014968 Ga0157379_10241363 Ga0157379_102413632 214
213 3300015262 Ga0182007_10000820 Ga0182007_1000082011 214
214 3300021358 Ga0213873_10092445 Ga0213873_100924451 214
215 3300021384 Ga0213876_10022886 Ga0213876_100228866 214
216 3300021388 Ga0213875_10005320 Ga0213875_100053204 214
217 3300021388 Ga0213875_10011596 Ga0213875_100115963 214
218 3300025297 Ga0209758_1012033 Ga0209758_10120331 214
219 3300025302 Ga0207426_1001852 Ga0207426_10018523 214
220 3300025899 Ga0207642_10354007 Ga0207642_103540072 214
221 3300025910 Ga0207684_10272654 Ga0207684_102726542 214
222 3300025916 Ga0207663_10488708 Ga0207663_104887081 214
223 3300025924 Ga0207694_10456195 Ga0207694_104561952 214
224 3300025927 Ga0207687_10122487 Ga0207687_101224873 214
225 3300025927 Ga0207687_10336090 Ga0207687_103360902 214
226 3300025931 Ga0207644_10000835 Ga0207644_1000083517 214
227 3300025931 Ga0207644_10749264 Ga0207644_107492641 214
228 3300025934 Ga0207686_10286469 Ga0207686_102864692 214
229 3300025936 Ga0207670_10783290 Ga0207670_107832901 214
230 3300025941 Ga0207711_10315213 Ga0207711_103152131 214
231 3300025961 Ga0207712_10031034 Ga0207712_100310342 214
232 3300025961 Ga0207712_10079714 Ga0207712_100797141 214
233 3300025972 Ga0207668_10287574 Ga0207668_102875741 214
234 3300026035 Ga0207703_10184902 Ga0207703_101849022 214
235 3300026035 Ga0207703_10558660 Ga0207703_105586602 214
236 3300026088 Ga0207641_10003507 Ga0207641_100035072 214
237 3300026088 Ga0207641_10244651 Ga0207641_102446513 214
238 3300026095 Ga0207676_10307053 Ga0207676_103070532 214
239 3300026118 Ga0207675_100862520 Ga0207675_1008625202 214
240 3300027866 Ga0209813_10085617 Ga0209813_100856171 214
241 3300027866 Ga0209813_10160413 Ga0209813_101604131 214
242 3300028379 Ga0268266_10062249 Ga0268266_100622495 214
243 3300028380 Ga0268265_10000205 Ga0268265_1000020566 214
244 3300028381 Ga0268264_10075109 Ga0268264_100751093 214
245 3300030731 Ga0316177_1078076 Ga0316177_10780761 214
246 3300030733 Ga0314311_1183463 Ga0314311_11834633 214
247 3300030736 Ga0316180_1114495 Ga0316180_11144952 214
248 3300031251 Ga0265327_10013716 Ga0265327_100137167 214
249 3300031507 Ga0307509_10111814 Ga0307509_101118142 214
250 3300031507 Ga0307509_10144905 Ga0307509_101449053 214
251 3300031548 Ga0307408_100767347 Ga0307408_1007673471 214
252 3300031649 Ga0307514_10162596 Ga0307514_101625962 214
253 3300031711 Ga0265314_10072367 Ga0265314_100723673 214
254 3300031730 Ga0307516_10021923 Ga0307516_100219233 214
255 3300031852 Ga0307410_10172314 Ga0307410_101723142 214
256 3300031852 Ga0307410_10386480 Ga0307410_103864801 214
257 3300031901 Ga0307406_10027987 Ga0307406_100279872 214
258 3300031901 Ga0307406_10468812 Ga0307406_104688122 214
259 3300031901 Ga0307406_10887214 Ga0307406_108872141 214
260 3300031903 Ga0307407_10567272 Ga0307407_105672721 214
261 3300031995 Ga0307409_100692446 Ga0307409_1006924462 214
262 3300032002 Ga0307416_100747255 Ga0307416_1007472551 214
263 3300032004 Ga0307414_10346294 Ga0307414_103462943 214
264 3300033179 Ga0307507_10152726 Ga0307507_101527261 214
265 3300035089 Ga0373944_0119861 Ga0373944_0119861_40_684 214
266 3300035113 Ga0373936_0230297 Ga0373936_0230297_50_694 214
267 3300035725 Ga0373947_0077679 Ga0373947_0077679_1108_1752 214
268 3300037853 Ga0436364_0103177 Ga0436364_0103177_1739_2383 214
269 3300037853 Ga0436364_1000426 Ga0436364_1000426_16983_17627 214
270 3300039437 Ga0436365_0380684 Ga0436365_0380684_979_1641 214
271 3300039437 Ga0436365_0926350 Ga0436365_0926350_78_749 214
272 3300039438 Ga0436360_1196039 Ga0436360_1196039_2496_3158 214
273 3300039453 Ga0436362_0729387 Ga0436362_0729387_502_1164 214
274 3300039453 Ga0436362_0777322 Ga0436362_0777322_2684_3346 214
275 3300041404 Ga0439436_0003333 Ga0439436_0003333_3034_3681 214
276 3300041410 Ga0439461_0003552 Ga0439461_0003552_1880_2524 214
277 3300041411 Ga0439466_0035115 Ga0439466_0035115_116_760 214
278 3300041413 Ga0439465_0003133 Ga0439465_0003133_970_1620 214
279 3300041413 Ga0439465_0022572 Ga0439465_0022572_564_1208 214
280 3300041498 Ga0451841_1195414 Ga0451841_1195414_42_686 214
281 3300041512 Ga0451853_4084173 Ga0451853_4084173_10_681 214
282 3300041997 Ga0439431_0000401 Ga0439431_0000401_2649_3293 214
283 3300041999 Ga0439433_0007032 Ga0439433_0007032_920_1567 214
284 3300042002 Ga0439442_015914 Ga0439442_015914_578_1228 214
285 3300042004 Ga0439445_0006000 Ga0439445_0006000_569_1219 214
286 3300042007 Ga0439449_0000109 Ga0439449_0000109_1776_2429 214
287 3300042007 Ga0439449_0009889 Ga0439449_0009889_1937_2584 214
288 3300042014 Ga0439457_000938 Ga0439457_000938_1249_1896 214
289 3300042015 Ga0439462_0000129 Ga0439462_0000129_8824_9477 214
290 3300042015 Ga0439462_0002037 Ga0439462_0002037_3813_4460 214
291 3300042435 Ga0439434_0001224 Ga0439434_0001224_4780_5424 214
292 3300044656 Ga0466969_0064144 Ga0466969_0064144_1124_1768 214
293 3300044658 Ga0466972_0002980 Ga0466972_0002980_5670_6314 214
294 3300044658 Ga0466972_0024808 Ga0466972_0024808_865_1509 214
295 3300044658 Ga0466972_0039295 Ga0466972_0039295_965_1639 214
296 3300044683 Ga0466965_0002399 Ga0466965_0002399_6962_7606 214
297 3300044683 Ga0466965_0025537 Ga0466965_0025537_257_901 214
298 3300044683 Ga0466965_0044134 Ga0466965_0044134_199_846 214
299 3300044683 Ga0466965_0161679 Ga0466965_0161679_129_776 214
300 3300044684 Ga0466966_0062149 Ga0466966_0062149_704_1348 214
301 3300044693 Ga0466961_0067637 Ga0466961_0067637_1466_2110 214
302 3300044693 Ga0466961_0083416 Ga0466961_0083416_680_1324 214
303 3300044694 Ga0466963_0178399 Ga0466963_0178399_242_886 214
304 3300044694 Ga0466963_0208162 Ga0466963_0208162_131_775 214
305 3300044706 Ga0466964_0018576 Ga0466964_0018576_1297_1941 214
306 3300044706 Ga0466964_0274413 Ga0466964_0274413_53_697 214
307 3300044719 Ga0466971_0105748 Ga0466971_0105748_510_1184 214
308 3300044719 Ga0466971_0311323 Ga0466971_0311323_66_710 214
309 3300044735 Ga0466968_0000740 Ga0466968_0000740_6869_7513 214
310 3300044735 Ga0466968_0201591 Ga0466968_0201591_92_739 214
311 3300044765 Ga0466970_0001101 Ga0466970_0001101_12013_12660 214
312 3300044765 Ga0466970_0005433 Ga0466970_0005433_5088_5732 214
313 3300044765 Ga0466970_0030354 Ga0466970_0030354_753_1397 214
314 3300044765 Ga0466970_0252582 Ga0466970_0252582_77_721 214
315 3300044842 Ga0466957_0170766 Ga0466957_0170766_182_826 214
316 3300044901 Ga0466960_0000211 Ga0466960_0000211_1327_1971 214
317 3300044901 Ga0466960_0001994 Ga0466960_0001994_38_682 214
318 3300044901 Ga0466960_0046631 Ga0466960_0046631_471_1118 214
319 3300044901 Ga0466960_0090671 Ga0466960_0090671_524_1168 214
320 3300044901 Ga0466960_0162857 Ga0466960_0162857_376_1020 214
321 3300044901 Ga0466960_0393608 Ga0466960_0393608_100_744 214
322 3300045049 Ga0466959_0034141 Ga0466959_0034141_131_775 214
323 3300045049 Ga0466959_0223484 Ga0466959_0223484_279_923 214
324 3300045836 Ga0466958_0037421 Ga0466958_0037421_155_799 214
325 3300045836 Ga0466958_0478388 Ga0466958_0478388_43_687 214
326 3300045976 Ga0466967_0109662 Ga0466967_0109662_752_1396 214
327 3300045976 Ga0466967_0892094 Ga0466967_0892094_158_802 214
328 3300045976 Ga0466967_1076754 Ga0466967_1076754_73_735 214
329 3300046454 Ga0495592_0077915 Ga0495592_0077915_606_1250 214
330 3300046454 Ga0495592_0225759 Ga0495592_0225759_303_959 214
331 3300046455 Ga0495603_0002322 Ga0495603_0002322_3643_4290 214
332 3300046455 Ga0495603_0019438 Ga0495603_0019438_3275_3919 214
333 3300046455 Ga0495603_0038104 Ga0495603_0038104_1419_2066 214
334 3300046459 Ga0495629_0002081 Ga0495629_0002081_10285_10929 214
335 3300046460 Ga0495638_0202120 Ga0495638_0202120_21_668 214
336 3300046460 Ga0495638_0204256 Ga0495638_0204256_329_1078 214
337 3300046462 Ga0495651_0106461 Ga0495651_0106461_774_1418 214
338 3300046463 Ga0495653_0111818 Ga0495653_0111818_663_1307 214
339 3300046476 Ga0495662_0000547 Ga0495662_0000547_16529_17173 214
340 3300046492 Ga0495585_0013239 Ga0495585_0013239_2594_3238 214
341 3300046492 Ga0495585_0015891 Ga0495585_0015891_1161_1808 214
342 3300046492 Ga0495585_0028621 Ga0495585_0028621_2199_2846 214
343 3300046499 Ga0495594_0002842 Ga0495594_0002842_7180_7827 214
344 3300046499 Ga0495594_0009130 Ga0495594_0009130_1639_2283 214
345 3300046499 Ga0495594_0078508 Ga0495594_0078508_695_1369 214
346 3300046506 Ga0495583_0151532 Ga0495583_0151532_45_692 214
347 3300046511 Ga0495608_0009100 Ga0495608_0009100_639_1283 214
348 3300046511 Ga0495608_0133987 Ga0495608_0133987_702_1358 214
349 3300046514 Ga0495618_0018061 Ga0495618_0018061_1036_1680 214
350 3300046514 Ga0495618_0102918 Ga0495618_0102918_697_1353 214
351 3300046515 Ga0495620_0013702 Ga0495620_0013702_1212_1859 214
352 3300046516 Ga0495628_0003272 Ga0495628_0003272_2723_3397 214
353 3300046516 Ga0495628_0004772 Ga0495628_0004772_2269_2913 214
354 3300046516 Ga0495628_0009608 Ga0495628_0009608_136_792 214
355 3300046517 Ga0495630_0034365 Ga0495630_0034365_2064_2720 214
356 3300046518 Ga0495631_0107065 Ga0495631_0107065_115_762 214
357 3300046524 Ga0495648_0011675 Ga0495648_0011675_570_1247 214
358 3300046524 Ga0495648_0155259 Ga0495648_0155259_208_852 214
359 3300046526 Ga0495666_0004007 Ga0495666_0004007_6471_7115 214
360 3300046526 Ga0495666_0063679 Ga0495666_0063679_994_1641 214
361 3300046529 Ga0495652_0001657 Ga0495652_0001657_21402_22046 214
362 3300046530 Ga0495654_0042419 Ga0495654_0042419_456_1133 214
363 3300046533 Ga0495640_0002082 Ga0495640_0002082_14337_14981 214
364 3300046533 Ga0495640_0040188 Ga0495640_0040188_607_1251 214
365 3300046533 Ga0495640_0183313 Ga0495640_0183313_185_832 214
366 3300046535 Ga0495586_0004211 Ga0495586_0004211_4588_5232 214
367 3300046535 Ga0495586_0285764 Ga0495586_0285764_284_928 214
368 3300046535 Ga0495586_0306556 Ga0495586_0306556_142_798 214
369 3300046536 Ga0495587_0006071 Ga0495587_0006071_774_1418 214
370 3300046536 Ga0495587_0071459 Ga0495587_0071459_291_935 214
371 3300046543 Ga0495645_0025308 Ga0495645_0025308_958_1602 214
372 3300046543 Ga0495645_0126268 Ga0495645_0126268_96_776 214
373 3300046543 Ga0495645_0167564 Ga0495645_0167564_686_1330 214
374 3300046557 Ga0495622_0001327 Ga0495622_0001327_4780_5427 214
375 3300046559 Ga0495667_0007329 Ga0495667_0007329_315_959 214
376 3300046559 Ga0495667_0112976 Ga0495667_0112976_294_950 214
377 3300046616 Ga0495668_0022079 Ga0495668_0022079_2697_3374 214
378 3300046616 Ga0495668_0022327 Ga0495668_0022327_1147_1794 214
379 3300046642 Ga0495634_0048813 Ga0495634_0048813_2182_2838 214
380 3300046642 Ga0495634_0060553 Ga0495634_0060553_774_1418 214
381 3300046642 Ga0495634_0139408 Ga0495634_0139408_385_1032 214
382 3300046648 Ga0495611_0013640 Ga0495611_0013640_1685_2332 214
383 3300046648 Ga0495611_0194719 Ga0495611_0194719_93_740 214
384 3300046663 Ga0495635_0007290 Ga0495635_0007290_668_1312 214
385 3300046674 Ga0495588_0013525 Ga0495588_0013525_1387_2031 214
386 3300046675 Ga0495657_0009359 Ga0495657_0009359_1814_2482 214
387 3300046678 Ga0495599_0027395 Ga0495599_0027395_760_1404 214
388 3300046679 Ga0495623_0041863 Ga0495623_0041863_1718_2362 214
389 3300046679 Ga0495623_0194047 Ga0495623_0194047_247_891 214
390 3300046680 Ga0495646_0001219 Ga0495646_0001219_2704_3348 214
391 3300046680 Ga0495646_0098114 Ga0495646_0098114_422_1066 214
392 3300046689 Ga0495613_0001604 Ga0495613_0001604_13969_14613 214
393 3300046689 Ga0495613_0047613 Ga0495613_0047613_2306_2974 214
394 3300046689 Ga0495613_0093607 Ga0495613_0093607_1314_2012 214
395 3300046690 Ga0495624_0052502 Ga0495624_0052502_22_669 214
396 3300046690 Ga0495624_0228874 Ga0495624_0228874_18_674 214
397 3300046690 Ga0495624_0331998 Ga0495624_0331998_175_819 214
398 3300046794 Ga0495589_0022590 Ga0495589_0022590_243_890 214
399 3300046809 Ga0495600_0221964 Ga0495600_0221964_43_687 214
400 3300047315 Ga0495581_0207623 Ga0495581_0207623_37_681 214
401 3300047317 Ga0495604_0040314 Ga0495604_0040314_2781_3428 214
402 3300047319 Ga0495674_0109895 Ga0495674_0109895_1321_1965 214
403 3300047320 Ga0495672_0013120 Ga0495672_0013120_2450_3127 214
404 3300047321 Ga0495676_0002322 Ga0495676_0002322_14927_15571 214
405 3300047321 Ga0495676_0024673 Ga0495676_0024673_2435_3082 214
406 3300047321 Ga0495676_0025920 Ga0495676_0025920_2031_2678 214
407 3300047321 Ga0495676_0039139 Ga0495676_0039139_2058_2705 214
408 3300047322 Ga0495680_0022675 Ga0495680_0022675_3620_4276 214
409 3300047323 Ga0495683_0023102 Ga0495683_0023102_2209_2856 214
410 3300047443 Ga0495687_010335 Ga0495687_010335_3618_4265 214
411 3300047444 Ga0495675_0013724 Ga0495675_0013724_3412_4056 214
412 3300047444 Ga0495675_0127096 Ga0495675_0127096_641_1297 214
413 3300047445 Ga0495677_0235676 Ga0495677_0235676_48_695 214
414 3300047469 Ga0495673_0002452 Ga0495673_0002452_7675_8352 214
415 3300047471 Ga0495684_0034436 Ga0495684_0034436_2951_3595 214
416 3300047673 Ga0495593_0054589 Ga0495593_0054589_29_673 214
417 3300048088 Ga0495602_0005980 Ga0495602_0005980_4338_4982 214
418 3300048088 Ga0495602_0252806 Ga0495602_0252806_161_841 214
419 3300048903 Ga0496100_0038566 Ga0496100_0038566_2343_2990 214
420 3300048904 Ga0496101_0025252 Ga0496101_0025252_3175_3822 214
421 3300048904 Ga0496101_0480319 Ga0496101_0480319_291_962 214
422 3300048905 Ga0496102_0000590 Ga0496102_0000590_24522_25226 214
423 3300048905 Ga0496102_0104015 Ga0496102_0104015_1012_1659 214
424 3300048905 Ga0496102_0232061 Ga0496102_0232061_969_1640 214
425 3300048906 Ga0496103_0079792 Ga0496103_0079792_212_916 214
426 3300048907 Ga0496104_0495339 Ga0496104_0495339_115_786 214
427 3300048908 Ga0496105_0022926 Ga0496105_0022926_1306_2010 214
428 3300048909 Ga0496106_0000747 Ga0496106_0000747_6002_6670 214
429 3300048909 Ga0496106_0043235 Ga0496106_0043235_500_1147 214
430 3300048909 Ga0496106_0212102 Ga0496106_0212102_538_1209 214
431 3300048911 Ga0496108_0124761 Ga0496108_0124761_978_1649 214
432 3300048911 Ga0496108_0619928 Ga0496108_0619928_31_675 214
433 3300048911 Ga0496108_0624370 Ga0496108_0624370_169_816 214
434 3300048912 Ga0496109_0009070 Ga0496109_0009070_447_1094 214
435 3300048912 Ga0496109_0018281 Ga0496109_0018281_4960_5604 214
436 3300048912 Ga0496109_0547912 Ga0496109_0547912_433_1077 214
437 3300048913 Ga0496110_0013951 Ga0496110_0013951_1876_2547 214
438 3300048913 Ga0496110_0017095 Ga0496110_0017095_2607_3311 214
439 3300048913 Ga0496110_0408425 Ga0496110_0408425_116_763 214
440 3300048914 Ga0496111_0155111 Ga0496111_0155111_969_1640 214
441 3300048914 Ga0496111_0206415 Ga0496111_0206415_417_1061 214
442 3300048915 Ga0496112_0041345 Ga0496112_0041345_691_1335 214
443 3300048915 Ga0496112_0277697 Ga0496112_0277697_540_1184 214
444 3300048916 Ga0496113_0397505 Ga0496113_0397505_129_776 214
445 3300048917 Ga0496114_0176818 Ga0496114_0176818_565_1212 214
446 3300048918 Ga0496115_0022882 Ga0496115_0022882_836_1483 214
447 3300048925 Ga0496122_0019211 Ga0496122_0019211_397_1074 214
448 3300048926 Ga0496123_0081978 Ga0496123_0081978_50_727 214
449 3300048929 Ga0496126_0000037 Ga0496126_0000037_165166_165810 214
450 3300048929 Ga0496126_0020724 Ga0496126_0020724_2222_2866 214
451 3300049537 Ga0501321_015613 Ga0501321_015613_28_675 214
452 3300049569 Ga0501032_0000689 Ga0501032_0000689_20683_21327 214
453 3300049569 Ga0501032_0119194 Ga0501032_0119194_424_1068 214
454 3300049570 Ga0501033_0018191 Ga0501033_0018191_1473_2117 214
455 3300049571 Ga0501034_0003410 Ga0501034_0003410_6062_6706 214
456 3300049571 Ga0501034_0007309 Ga0501034_0007309_7574_8218 214
457 3300049571 Ga0501034_0019166 Ga0501034_0019166_5119_5763 214
458 3300049571 Ga0501034_0024703 Ga0501034_0024703_2384_3028 214
459 3300049571 Ga0501034_0035561 Ga0501034_0035561_2406_3050 214
460 3300049571 Ga0501034_0120583 Ga0501034_0120583_869_1537 214
461 3300049571 Ga0501034_0130730 Ga0501034_0130730_1549_2193 214
462 3300049572 Ga0501036_0000486 Ga0501036_0000486_18418_19062 214
463 3300049572 Ga0501036_0002369 Ga0501036_0002369_11265_11909 214
464 3300049572 Ga0501036_0075313 Ga0501036_0075313_2034_2678 214
465 3300049572 Ga0501036_0079713 Ga0501036_0079713_1538_2182 214
466 3300049572 Ga0501036_0538942 Ga0501036_0538942_149_805 214
467 3300049573 Ga0501037_0000239 Ga0501037_0000239_11570_12214 214
468 3300049573 Ga0501037_0006239 Ga0501037_0006239_3599_4243 214
469 3300049573 Ga0501037_0012641 Ga0501037_0012641_3525_4169 214
470 3300049573 Ga0501037_0630647 Ga0501037_0630647_32_700 214
471 3300049574 Ga0501038_0003441 Ga0501038_0003441_5637_6281 214
472 3300049574 Ga0501038_0018884 Ga0501038_0018884_1463_2107 214
473 3300049574 Ga0501038_0136804 Ga0501038_0136804_311_955 214
474 3300049575 Ga0501039_0002630 Ga0501039_0002630_1335_1979 214
475 3300049575 Ga0501039_0465964 Ga0501039_0465964_48_692 214
476 3300049575 Ga0501039_0516415 Ga0501039_0516415_233_889 214
477 3300049575 Ga0501039_0545872 Ga0501039_0545872_30_674 214
478 3300049576 Ga0501040_0030738 Ga0501040_0030738_823_1467 214
479 3300049577 Ga0501041_0010231 Ga0501041_0010231_3325_3969 214
480 3300049578 Ga0501042_0340855 Ga0501042_0340855_41_688 214
481 3300049578 Ga0501042_0409057 Ga0501042_0409057_125_781 214
482 3300049579 Ga0501043_0004194 Ga0501043_0004194_1581_2225 214
483 3300049579 Ga0501043_0014850 Ga0501043_0014850_5077_5721 214
484 3300049579 Ga0501043_0016735 Ga0501043_0016735_3103_3747 214
485 3300049579 Ga0501043_0063589 Ga0501043_0063589_1755_2399 214
486 3300049580 Ga0501046_0072691 Ga0501046_0072691_1766_2410 214
487 3300049581 Ga0501047_0016832 Ga0501047_0016832_5184_5828 214
488 3300049581 Ga0501047_0052308 Ga0501047_0052308_2704_3348 214
489 3300049581 Ga0501047_0500959 Ga0501047_0500959_62_712 214
490 3300049583 Ga0501067_0013599 Ga0501067_0013599_3527_4171 214
491 3300049584 Ga0501068_0001322 Ga0501068_0001322_1287_1931 214
492 3300049584 Ga0501068_0205828 Ga0501068_0205828_295_939 214
493 3300049586 Ga0501070_0009655 Ga0501070_0009655_309_953 214
494 3300049586 Ga0501070_0439912 Ga0501070_0439912_336_980 214
495 3300049587 Ga0501071_0008128 Ga0501071_0008128_5554_6198 214
496 3300049587 Ga0501071_0125734 Ga0501071_0125734_1069_1725 214
497 3300049587 Ga0501071_0169307 Ga0501071_0169307_110_781 214
498 3300049587 Ga0501071_0288475 Ga0501071_0288475_253_900 214
499 3300049588 Ga0501072_0022272 Ga0501072_0022272_1287_1931 214
500 3300049589 Ga0501073_0005451 Ga0501073_0005451_4607_5251 214
501 3300049589 Ga0501073_0031623 Ga0501073_0031623_2984_3628 214
502 3300049589 Ga0501073_0045475 Ga0501073_0045475_1442_2086 214
503 3300049590 Ga0501074_0031987 Ga0501074_0031987_1083_1727 214
504 3300049590 Ga0501074_0635245 Ga0501074_0635245_90_737 214
505 3300049591 Ga0501075_0264874 Ga0501075_0264874_221_877 214
506 3300049592 Ga0501076_0207157 Ga0501076_0207157_622_1278 214
507 3300049592 Ga0501076_0587721 Ga0501076_0587721_244_888 214
508 3300049592 Ga0501076_0799519 Ga0501076_0799519_66_713 214
509 3300049690 Ga0501261_024606 Ga0501261_024606_89_790 214
510 3300049741 Ga0501079_0035300 Ga0501079_0035300_55_699 214
511 3300049742 Ga0501080_0140646 Ga0501080_0140646_1002_1646 214
512 3300049822 Ga0501035_0000769 Ga0501035_0000769_8666_9310 214
513 3300049822 Ga0501035_0048967 Ga0501035_0048967_1959_2603 214
514 3300049822 Ga0501035_0098939 Ga0501035_0098939_1473_2117 214
515 3300049822 Ga0501035_0312904 Ga0501035_0312904_431_1075 214
516 3300049823 Ga0501044_0007706 Ga0501044_0007706_1076_1720 214
517 3300049823 Ga0501044_0008295 Ga0501044_0008295_1823_2467 214
518 3300049823 Ga0501044_0010533 Ga0501044_0010533_3154_3798 214
519 3300049823 Ga0501044_0056692 Ga0501044_0056692_178_822 214
520 3300049823 Ga0501044_0422764 Ga0501044_0422764_351_995 214
521 3300049823 Ga0501044_0609343 Ga0501044_0609343_202_852 214
522 3300049824 Ga0501045_0032416 Ga0501045_0032416_2965_3609 214
523 3300050490 nmdc:mga03n38_130226_c1 nmdc:mga03n38_130226_c1_301_951 214
524 3300050490 nmdc:mga03n38_39051_c1 nmdc:mga03n38_39051_c1_817_1461 214
525 3300050491 nmdc:mga00v17_177320_c1 nmdc:mga00v17_177320_c1_177_821 214
526 3300050491 nmdc:mga00v17_625354_c1 nmdc:mga00v17_625354_c1_16_663 214
527 3300050492 nmdc:mga0yw44_181579_c1 nmdc:mga0yw44_181579_c1_137_781 214
528 3300050492 nmdc:mga0yw44_43993_c1 nmdc:mga0yw44_43993_c1_508_1152 214
529 3300050492 nmdc:mga0yw44_79388_c1 nmdc:mga0yw44_79388_c1_209_856 214
530 3300050494 nmdc:mga06z11_14046_c1 nmdc:mga06z11_14046_c1_131_778 214
531 3300050495 nmdc:mga04h51_100110_c1 nmdc:mga04h51_100110_c1_393_1037 214
532 3300050495 nmdc:mga04h51_9492_c1 nmdc:mga04h51_9492_c1_1872_2519 214
533 3300050507 nmdc:mga05p37_496825_c1 nmdc:mga05p37_496825_c1_351_1022 214
534 3300050509 nmdc:mga0qj67_103798_c1 nmdc:mga0qj67_103798_c1_864_1580 214
535 3300050511 nmdc:mga08y16_111255_c1 nmdc:mga08y16_111255_c1_2065_2736 214
536 3300050516 nmdc:mga0sz30_10444_c1 nmdc:mga0sz30_10444_c1_2740_3384 214
537 3300050516 nmdc:mga0sz30_37501_c1 nmdc:mga0sz30_37501_c1_844_1509 214
538 3300053077 Ga0495601_0000461 Ga0495601_0000461_3060_3734 214
539 3300053077 Ga0495601_0067635 Ga0495601_0067635_455_1111 214
540 3300053077 Ga0495601_0174196 Ga0495601_0174196_691_1335 214
541 3300053078 Ga0495612_0007194 Ga0495612_0007194_659_1339 214
542 3300053078 Ga0495612_0228739 Ga0495612_0228739_122_766 214
543 3300053085 Ga0495619_0002136 Ga0495619_0002136_1585_2229 214
544 3300053085 Ga0495619_0011923 Ga0495619_0011923_252_908 214
545 3300053085 Ga0495619_0177616 Ga0495619_0177616_611_1255 214
546 3300053085 Ga0495619_0218742 Ga0495619_0218742_492_1172 214
547 3300053107 Ga0500560_106804 Ga0500560_106804_135_779 214
548 3300053153 Ga0500616_0000171 Ga0500616_0000171_21794_22438 214
549 3300053153 Ga0500616_0003998 Ga0500616_0003998_3353_4000 214
550 3300054114 Ga0501084_0016947 Ga0501084_0016947_3522_4166 214
551 3300054114 Ga0501084_0407026 Ga0501084_0407026_317_961 214
552 3300060353 Ga0501082_0094632 Ga0501082_0094632_1508_2152 214
553 3300061719 Ga0466962_0047042 Ga0466962_0047042_1033_1677 214
554 3300061734 Ga0530510_0014960 Ga0530510_0014960_2747_3391 214
555 3300061734 Ga0530510_0299456 Ga0530510_0299456_472_1116 214
556 3300061734 Ga0530510_0490288 Ga0530510_0490288_212_856 214
557 iso_pu_bacteria 2808606359 2808846307 214
558 iso_pu_bacteria 3006493962 3006496110 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

88

206

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.7939 2 214
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.7834 2 214
5xcc-assembly2.cif.gz_B x-ray structure of clostridium perfringens pili protein cppa 0.729 192 213
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7259 2 214
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7228 2 214
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8035 3 214 3.40.430.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7784 3 214 3.40.430.10
af_K7VBN7_519_611_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7734 196 214 3.30.70.260
af_I1N552_1_226_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7408 196 213 3.30.420.40
3hz7A00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.74 168 212 3.30.110.40
ID Description Score Start End GO Terms
AF-A0A1X0BBT3-F1-model_v4 Deaminase 1 1 214 GO:0008703
GO:0009231
AF-A0A6G3VUI2-F1-model_v4 deleted 0.997 75 167
AF-I7G9J7-F1-model_v4 DNA-binding protein 0.9952 1 214 GO:0003677
GO:0008703
GO:0009231
AF-A0A6G9YCB5-F1-model_v4 Deaminase 0.9947 1 214
AF-A0A6G8G3Z3-F1-model_v4 Deaminase 0.9947 12 214 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
94.23 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map