F463522
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 559 | 368 | 1118 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300003215|JGI25153J46596_10020623|JGI25153J46596_100206233 |
| Length | 227 |
| Sequence | MKLDVIKLDGGKAGSVDLDDAIFGIADIRGDILQRVVTWQLAKRRSGNHKIQVRNEVSRTGKKMYKQKGTGSARHGSRRAAQFVGGAKAXGPVVRSHAFXLPKKIRAMALRHALSSKAKAGSIVVLDSAVLTDPKTAALRANFDKIGLKNALVIAGPEVDGNFKLAARNIPNIDVLPNAGLNVYDVLRRQTLVLTKDAXEAISARFAEKEAAXWPQPPATTTRSCRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 134 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 135 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 136 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 137 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 143 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 144 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 146 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 148 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 152 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 156 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 157 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 162 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 163 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 164 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 165 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 166 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 167 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 168 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 170 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 171 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 172 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 173 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 174 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 175 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 176 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 177 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 178 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 179 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 180 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 181 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 182 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 183 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 184 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 243 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 244 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 268 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 274 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 275 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 276 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 278 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 282 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 283 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 284 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 286 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 287 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 288 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 289 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 290 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 291 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 292 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 293 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 296 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 297 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 299 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 300 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 302 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 303 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 304 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 306 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 307 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 308 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 310 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 312 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 313 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 314 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 315 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 316 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 317 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 318 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 321 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 322 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 323 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 327 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 328 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 336 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 337 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 338 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 339 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 340 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 341 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 342 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 343 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 344 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 345 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 346 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 347 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 348 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 349 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 350 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 351 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 352 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 353 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 354 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 355 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 356 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 357 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 358 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 359 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 360 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 361 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 362 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 363 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 364 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 365 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 366 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 367 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 368 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.27 |
| Metatranscriptomes | 4.65 |
| Isolates | 6.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.93 |
| Nodule | 0 |
| Rhizoplane | 3.04 |
| Rhizosphere | 66.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10020623 | 3300003215 | Bacteria | 2486 |
| 2 | Ga0032354_1009883 | 3300003693 | Bacteria | 2257 |
| 3 | Ga0032354_1036765 | 3300003693 | Bacteria | 2457 |
| 4 | Ga0055537_1004503 | 3300003773 | Bacteria | 3972 |
| 5 | Ga0055524_1019052 | 3300003775 | Bacteria | 2359 |
| 6 | Ga0055528_1007701 | 3300003790 | Bacteria | 4722 |
| 7 | Ga0055530_10004523 | 3300003791 | Bacteria | 7112 |
| 8 | Ga0055530_10022053 | 3300003791 | Bacteria | 1861 |
| 9 | Ga0055531_10023544 | 3300003794 | Bacteria | 2303 |
| 10 | Ga0055531_10029209 | 3300003794 | Bacteria | 1882 |
| 11 | Ga0065165_1002762 | 3300005262 | Bacteria | 13954 |
| 12 | Ga0065165_1007044 | 3300005262 | Bacteria | 5660 |
| 13 | Ga0070676_10327453 | 3300005328 | Bacteria | 1047 |
| 14 | Ga0070683_100461961 | 3300005329 | Bacteria | 1212 |
| 15 | Ga0070670_100000958 | 3300005331 | Bacteria | 22640 |
| 16 | Ga0070670_100063759 | 3300005331 | Bacteria | 3162 |
| 17 | Ga0070670_100528860 | 3300005331 | Bacteria | 1050 |
| 18 | Ga0068869_100511504 | 3300005334 | Bacteria | 1004 |
| 19 | Ga0070666_10288826 | 3300005335 | Bacteria | 1167 |
| 20 | Ga0070666_10304828 | 3300005335 | Bacteria | 1135 |
| 21 | Ga0070666_10323942 | 3300005335 | Bacteria | 1099 |
| 22 | Ga0070660_100140471 | 3300005339 | Bacteria | 1937 |
| 23 | Ga0070691_10004797 | 3300005341 | Bacteria | 6156 |
| 24 | Ga0070668_100002473 | 3300005347 | Bacteria | 13591 |
| 25 | Ga0070668_100018845 | 3300005347 | Bacteria | 5184 |
| 26 | Ga0070669_100019075 | 3300005353 | Bacteria | 4902 |
| 27 | Ga0070671_100001396 | 3300005355 | Bacteria | 18034 |
| 28 | Ga0070671_100308137 | 3300005355 | Bacteria | 1348 |
| 29 | Ga0070673_100051075 | 3300005364 | Bacteria | 3236 |
| 30 | Ga0070659_100074275 | 3300005366 | Bacteria | 2708 |
| 31 | Ga0070659_100174117 | 3300005366 | Bacteria | 1764 |
| 32 | Ga0070667_100026034 | 3300005367 | Bacteria | 4864 |
| 33 | Ga0070713_101138790 | 3300005436 | Bacteria | 754 |
| 34 | Ga0070678_100198955 | 3300005456 | Bacteria | 1653 |
| 35 | Ga0070662_100432256 | 3300005457 | Bacteria | 1090 |
| 36 | Ga0070681_10068278 | 3300005458 | Bacteria | 3522 |
| 37 | Ga0070681_10099585 | 3300005458 | Bacteria | 2852 |
| 38 | Ga0068853_100233197 | 3300005539 | Bacteria | 1684 |
| 39 | Ga0068853_100399888 | 3300005539 | Bacteria | 1285 |
| 40 | Ga0070665_100055537 | 3300005548 | Bacteria | 3971 |
| 41 | Ga0070665_100063485 | 3300005548 | Bacteria | 3703 |
| 42 | Ga0070665_100076823 | 3300005548 | Bacteria | 3346 |
| 43 | Ga0070665_100182043 | 3300005548 | Bacteria | 2102 |
| 44 | Ga0068855_100722076 | 3300005563 | Bacteria | 1065 |
| 45 | Ga0068855_100853769 | 3300005563 | Bacteria | 964 |
| 46 | Ga0070664_100036245 | 3300005564 | Bacteria | 4144 |
| 47 | Ga0068854_100283607 | 3300005578 | Bacteria | 1334 |
| 48 | Ga0068854_100496692 | 3300005578 | Bacteria | 1027 |
| 49 | Ga0068856_100221172 | 3300005614 | Bacteria | 1909 |
| 50 | Ga0068856_100667723 | 3300005614 | Bacteria | 1060 |
| 51 | Ga0068856_101011214 | 3300005614 | Bacteria | 849 |
| 52 | Ga0068859_100268032 | 3300005617 | Bacteria | 1799 |
| 53 | Ga0068864_100043582 | 3300005618 | Bacteria | 3842 |
| 54 | Ga0068866_10385722 | 3300005718 | Bacteria | 900 |
| 55 | Ga0068861_100060108 | 3300005719 | Bacteria | 2911 |
| 56 | Ga0068851_10283195 | 3300005834 | Bacteria | 948 |
| 57 | Ga0068863_100045890 | 3300005841 | Bacteria | 4147 |
| 58 | Ga0068863_100064635 | 3300005841 | Bacteria | 3460 |
| 59 | Ga0068858_100050547 | 3300005842 | Bacteria | 3847 |
| 60 | Ga0068858_100524477 | 3300005842 | Bacteria | 1146 |
| 61 | Ga0068860_100001684 | 3300005843 | Bacteria | 23610 |
| 62 | Ga0068860_100022119 | 3300005843 | Bacteria | 6155 |
| 63 | Ga0068862_100028223 | 3300005844 | Bacteria | 4725 |
| 64 | Ga0068862_100305543 | 3300005844 | Bacteria | 1464 |
| 65 | Ga0075368_10008167 | 3300006042 | Bacteria | 3719 |
| 66 | Ga0075363_100047678 | 3300006048 | Bacteria | 2276 |
| 67 | Ga0075363_100103319 | 3300006048 | Bacteria | 1579 |
| 68 | Ga0075363_100438543 | 3300006048 | Bacteria | 770 |
| 69 | Ga0075364_10001038 | 3300006051 | Bacteria | 14772 |
| 70 | Ga0075367_10001012 | 3300006178 | Bacteria | 11557 |
| 71 | Ga0075369_10010071 | 3300006186 | Bacteria | 3692 |
| 72 | Ga0075366_10059395 | 3300006195 | Bacteria | 2271 |
| 73 | Ga0075366_10115902 | 3300006195 | Bacteria | 1613 |
| 74 | Ga0075366_10127469 | 3300006195 | Bacteria | 1535 |
| 75 | Ga0075366_10355356 | 3300006195 | Bacteria | 900 |
| 76 | Ga0075366_10571149 | 3300006195 | Bacteria | 700 |
| 77 | Ga0075370_10027150 | 3300006353 | Bacteria | 3175 |
| 78 | Ga0075370_10202409 | 3300006353 | Bacteria | 1171 |
| 79 | Ga0068865_100013511 | 3300006881 | Bacteria | 5161 |
| 80 | Ga0097620_100268025 | 3300006931 | Bacteria | 1799 |
| 81 | Ga0105240_10000798 | 3300009093 | Bacteria | 57073 |
| 82 | Ga0105240_10230206 | 3300009093 | Bacteria | 2154 |
| 83 | Ga0105240_10335083 | 3300009093 | Bacteria | 1720 |
| 84 | Ga0105240_10386595 | 3300009093 | Bacteria | 1579 |
| 85 | Ga0105240_10406436 | 3300009093 | Bacteria | 1532 |
| 86 | Ga0105240_10524597 | 3300009093 | Bacteria | 1314 |
| 87 | Ga0105245_10635073 | 3300009098 | Bacteria | 1097 |
| 88 | Ga0105243_11099686 | 3300009148 | Bacteria | 803 |
| 89 | Ga0105241_10051142 | 3300009174 | Bacteria | 3150 |
| 90 | Ga0105242_10218000 | 3300009176 | Bacteria | 1704 |
| 91 | Ga0105248_10008835 | 3300009177 | Bacteria | 11068 |
| 92 | Ga0105248_10259890 | 3300009177 | Bacteria | 1955 |
| 93 | Ga0105248_10382456 | 3300009177 | Bacteria | 1585 |
| 94 | Ga0105248_11214471 | 3300009177 | Bacteria | 852 |
| 95 | Ga0105238_10232374 | 3300009551 | Bacteria | 1820 |
| 96 | Ga0105238_10593494 | 3300009551 | Bacteria | 1115 |
| 97 | Ga0105249_10041843 | 3300009553 | Bacteria | 4166 |
| 98 | Ga0105249_10257956 | 3300009553 | Bacteria | 1731 |
| 99 | Ga0105239_10294484 | 3300010375 | Bacteria | 1827 |
| 100 | Ga0105239_10652689 | 3300010375 | Bacteria | 1202 |
| 101 | Ga0105246_10521316 | 3300011119 | Bacteria | 1013 |
| 102 | Ga0157373_10136423 | 3300013100 | Bacteria | 1725 |
| 103 | Ga0157370_10114023 | 3300013104 | Bacteria | 2525 |
| 104 | Ga0157369_10018315 | 3300013105 | Bacteria | 7853 |
| 105 | Ga0157369_10406132 | 3300013105 | Bacteria | 1413 |
| 106 | Ga0157374_10493874 | 3300013296 | Bacteria | 1228 |
| 107 | Ga0157374_10986379 | 3300013296 | Bacteria | 861 |
| 108 | Ga0157378_10653213 | 3300013297 | Bacteria | 1067 |
| 109 | Ga0163162_10080358 | 3300013306 | Bacteria | 3328 |
| 110 | Ga0157372_10364270 | 3300013307 | Bacteria | 1684 |
| 111 | Ga0157375_10429715 | 3300013308 | Bacteria | 1487 |
| 112 | Ga0163163_10009581 | 3300014325 | Bacteria | 8656 |
| 113 | Ga0163163_10439545 | 3300014325 | Bacteria | 1364 |
| 114 | Ga0157380_10548407 | 3300014326 | Bacteria | 1134 |
| 115 | Ga0182008_10084129 | 3300014497 | Bacteria | 1567 |
| 116 | Ga0157379_10041021 | 3300014968 | Bacteria | 4131 |
| 117 | Ga0157379_10898562 | 3300014968 | Bacteria | 840 |
| 118 | Ga0182007_10037419 | 3300015262 | Bacteria | 1630 |
| 119 | Ga0213872_10005913 | 3300021361 | Bacteria | 6209 |
| 120 | Ga0213876_10000244 | 3300021384 | Bacteria | 51875 |
| 121 | Ga0209673_1001876 | 3300025273 | Bacteria | 16959 |
| 122 | Ga0209676_1022325 | 3300025292 | Bacteria | 2100 |
| 123 | Ga0209564_1007568 | 3300025295 | Bacteria | 5584 |
| 124 | Ga0209758_1002168 | 3300025297 | Bacteria | 20636 |
| 125 | Ga0209758_1023594 | 3300025297 | Bacteria | 2776 |
| 126 | Ga0209050_1000161 | 3300025298 | Bacteria | 155713 |
| 127 | Ga0209050_1019693 | 3300025298 | Bacteria | 2548 |
| 128 | Ga0209256_1003893 | 3300025299 | Bacteria | 9891 |
| 129 | Ga0209051_1000877 | 3300025303 | Bacteria | 30359 |
| 130 | Ga0209257_1000252 | 3300025304 | Bacteria | 123718 |
| 131 | Ga0209257_1000976 | 3300025304 | Bacteria | 38920 |
| 132 | Ga0209257_1008377 | 3300025304 | Bacteria | 5898 |
| 133 | Ga0209257_1010622 | 3300025304 | Bacteria | 4615 |
| 134 | Ga0207656_10099352 | 3300025321 | Bacteria | 1332 |
| 135 | Ga0207680_10043744 | 3300025903 | Bacteria | 2629 |
| 136 | Ga0207680_10057755 | 3300025903 | Bacteria | 2349 |
| 137 | Ga0207645_10029047 | 3300025907 | Bacteria | 3565 |
| 138 | Ga0207643_10064023 | 3300025908 | Bacteria | 2104 |
| 139 | Ga0207705_10018153 | 3300025909 | Bacteria | 5029 |
| 140 | Ga0207654_10077845 | 3300025911 | Bacteria | 1989 |
| 141 | Ga0207707_10183495 | 3300025912 | Bacteria | 1826 |
| 142 | Ga0207695_10000575 | 3300025913 | Bacteria | 74997 |
| 143 | Ga0207695_10010884 | 3300025913 | Bacteria | 11075 |
| 144 | Ga0207695_10273409 | 3300025913 | Bacteria | 1585 |
| 145 | Ga0207695_10372193 | 3300025913 | Bacteria | 1315 |
| 146 | Ga0207671_10217066 | 3300025914 | Bacteria | 1497 |
| 147 | Ga0207660_10000537 | 3300025917 | Bacteria | 25426 |
| 148 | Ga0207660_10193464 | 3300025917 | Bacteria | 1585 |
| 149 | Ga0207649_10107742 | 3300025920 | Bacteria | 1856 |
| 150 | Ga0207649_10355036 | 3300025920 | Bacteria | 1086 |
| 151 | Ga0207652_10002134 | 3300025921 | Bacteria | 16964 |
| 152 | Ga0207681_10164779 | 3300025923 | Bacteria | 1674 |
| 153 | Ga0207694_10228390 | 3300025924 | Bacteria | 1519 |
| 154 | Ga0207694_10244076 | 3300025924 | Bacteria | 1468 |
| 155 | Ga0207650_10000883 | 3300025925 | Bacteria | 22684 |
| 156 | Ga0207650_10051081 | 3300025925 | Bacteria | 3059 |
| 157 | Ga0207700_10184548 | 3300025928 | Bacteria | 1749 |
| 158 | Ga0207644_10019776 | 3300025931 | Bacteria | 4571 |
| 159 | Ga0207644_10035600 | 3300025931 | Bacteria | 3489 |
| 160 | Ga0207690_10018048 | 3300025932 | Bacteria | 4321 |
| 161 | Ga0207690_10175415 | 3300025932 | Bacteria | 1609 |
| 162 | Ga0207706_10019813 | 3300025933 | Bacteria | 6048 |
| 163 | Ga0207706_10561516 | 3300025933 | Bacteria | 982 |
| 164 | Ga0207711_10001469 | 3300025941 | Bacteria | 21980 |
| 165 | Ga0207711_10112712 | 3300025941 | Bacteria | 2421 |
| 166 | Ga0207711_10245260 | 3300025941 | Bacteria | 1643 |
| 167 | Ga0207689_10604496 | 3300025942 | Bacteria | 922 |
| 168 | Ga0207679_10207149 | 3300025945 | Bacteria | 1642 |
| 169 | Ga0207667_10166618 | 3300025949 | Bacteria | 2265 |
| 170 | Ga0207667_10259986 | 3300025949 | Bacteria | 1775 |
| 171 | Ga0207667_10906985 | 3300025949 | Bacteria | 873 |
| 172 | Ga0207651_10395513 | 3300025960 | Bacteria | 1174 |
| 173 | Ga0207712_10002131 | 3300025961 | Bacteria | 12933 |
| 174 | Ga0207668_10000363 | 3300025972 | Bacteria | 28976 |
| 175 | Ga0207668_10000571 | 3300025972 | Bacteria | 23129 |
| 176 | Ga0207668_10037129 | 3300025972 | Bacteria | 3258 |
| 177 | Ga0207668_10037130 | 3300025972 | Bacteria | 3258 |
| 178 | Ga0207640_10178996 | 3300025981 | Bacteria | 1588 |
| 179 | Ga0207640_10410162 | 3300025981 | Bacteria | 1106 |
| 180 | Ga0207658_10001253 | 3300025986 | Bacteria | 20099 |
| 181 | Ga0207658_10012581 | 3300025986 | Bacteria | 5776 |
| 182 | Ga0207677_10475628 | 3300026023 | Bacteria | 1075 |
| 183 | Ga0207703_10013988 | 3300026035 | Bacteria | 6256 |
| 184 | Ga0207703_10086143 | 3300026035 | Bacteria | 2631 |
| 185 | Ga0207703_10464885 | 3300026035 | Bacteria | 1184 |
| 186 | Ga0207639_10053240 | 3300026041 | Bacteria | 3087 |
| 187 | Ga0207678_10183294 | 3300026067 | Bacteria | 1788 |
| 188 | Ga0207702_10266138 | 3300026078 | Bacteria | 1616 |
| 189 | Ga0207702_10348651 | 3300026078 | Bacteria | 1416 |
| 190 | Ga0207648_10273356 | 3300026089 | Bacteria | 1510 |
| 191 | Ga0207676_10010270 | 3300026095 | Bacteria | 6663 |
| 192 | Ga0207674_10336853 | 3300026116 | Bacteria | 1458 |
| 193 | Ga0207675_100039241 | 3300026118 | Bacteria | 4420 |
| 194 | Ga0209981_1000276 | 3300027378 | Bacteria | 6562 |
| 195 | Ga0210000_1022595 | 3300027462 | Bacteria | 966 |
| 196 | Ga0209999_1001058 | 3300027543 | Bacteria | 4681 |
| 197 | Ga0209983_1005860 | 3300027665 | Bacteria | 2538 |
| 198 | Ga0209813_10061568 | 3300027866 | Bacteria | 1199 |
| 199 | Ga0268266_10000311 | 3300028379 | Bacteria | 77262 |
| 200 | Ga0268266_10023680 | 3300028379 | Bacteria | 5226 |
| 201 | Ga0268266_10040775 | 3300028379 | Bacteria | 3959 |
| 202 | Ga0268266_10053859 | 3300028379 | Bacteria | 3457 |
| 203 | Ga0268266_10077149 | 3300028379 | Bacteria | 2896 |
| 204 | Ga0268265_10004022 | 3300028380 | Bacteria | 10354 |
| 205 | Ga0268265_10695882 | 3300028380 | Bacteria | 981 |
| 206 | Ga0268264_10000383 | 3300028381 | Bacteria | 63883 |
| 207 | Ga0268264_10002325 | 3300028381 | Bacteria | 16817 |
| 208 | Ga0268264_10072664 | 3300028381 | Bacteria | 2917 |
| 209 | Ga0265326_10027785 | 3300028558 | Bacteria | 1613 |
| 210 | Ga0265334_10006043 | 3300028573 | Bacteria | 5256 |
| 211 | Ga0307517_10130623 | 3300028786 | Bacteria | 1810 |
| 212 | Ga0265338_10019380 | 3300028800 | Bacteria | 7219 |
| 213 | Ga0265338_10048593 | 3300028800 | Bacteria | 3858 |
| 214 | Ga0265338_10442167 | 3300028800 | Bacteria | 921 |
| 215 | Ga0265324_10119872 | 3300029957 | Bacteria | 894 |
| 216 | Ga0307511_10006537 | 3300030521 | Bacteria | 11736 |
| 217 | Ga0307512_10169625 | 3300030522 | Bacteria | 1255 |
| 218 | Ga0265327_10000381 | 3300031251 | Bacteria | 83617 |
| 219 | Ga0265327_10007046 | 3300031251 | Bacteria | 8808 |
| 220 | Ga0265327_10042304 | 3300031251 | Bacteria | 2447 |
| 221 | Ga0265327_10055621 | 3300031251 | Bacteria | 2042 |
| 222 | Ga0307513_10000162 | 3300031456 | Bacteria | 96000 |
| 223 | Ga0307513_10010515 | 3300031456 | Bacteria | 11583 |
| 224 | Ga0307513_10016219 | 3300031456 | Bacteria | 8997 |
| 225 | Ga0307513_10198590 | 3300031456 | Bacteria | 1849 |
| 226 | Ga0265314_10053314 | 3300031711 | Bacteria | 2806 |
| 227 | Ga0265314_10083091 | 3300031711 | Bacteria | 2106 |
| 228 | Ga0265314_10183534 | 3300031711 | Bacteria | 1251 |
| 229 | Ga0307516_10001565 | 3300031730 | Bacteria | 31484 |
| 230 | Ga0307413_10002271 | 3300031824 | Bacteria | 7767 |
| 231 | Ga0307406_10115754 | 3300031901 | Bacteria | 1854 |
| 232 | Ga0307416_100235587 | 3300032002 | Bacteria | 1769 |
| 233 | Ga0307411_10055871 | 3300032005 | Bacteria | 2599 |
| 234 | Ga0316583_10029332 | 3300032133 | Bacteria | 1962 |
| 235 | Ga0316593_10019819 | 3300032168 | Bacteria | 2082 |
| 236 | Ga0316593_10029449 | 3300032168 | Bacteria | 1776 |
| 237 | Ga0307510_10078548 | 3300033180 | Bacteria | 3227 |
| 238 | Ga0316596_1076669 | 3300033541 | Bacteria | 897 |
| 239 | Ga0373926_0062463 | 3300035083 | Bacteria | 1360 |
| 240 | Ga0373923_0172448 | 3300035111 | Bacteria | 991 |
| 241 | Ga0373946_0016115 | 3300035171 | Bacteria | 2844 |
| 242 | Ga0373931_0114957 | 3300035691 | Bacteria | 1531 |
| 243 | Ga0373927_0000479 | 3300035695 | Bacteria | 30749 |
| 244 | Ga0373927_0165324 | 3300035695 | Bacteria | 1450 |
| 245 | Ga0373947_0084504 | 3300035725 | Bacteria | 1970 |
| 246 | Ga0373937_0407622 | 3300036401 | Bacteria | 1290 |
| 247 | Ga0373925_0000023 | 3300037068 | Bacteria | 158881 |
| 248 | Ga0373925_0175832 | 3300037068 | Bacteria | 1692 |
| 249 | Ga0395899_0001195 | 3300037312 | Bacteria | 22830 |
| 250 | Ga0395899_0322286 | 3300037312 | Bacteria | 1040 |
| 251 | Ga0395900_0006999 | 3300037418 | Bacteria | 11682 |
| 252 | Ga0395900_0130918 | 3300037418 | Bacteria | 2571 |
| 253 | Ga0395900_0250561 | 3300037418 | Bacteria | 1772 |
| 254 | Ga0395898_0004322 | 3300037466 | Bacteria | 15569 |
| 255 | Ga0395898_0071967 | 3300037466 | Bacteria | 3340 |
| 256 | Ga0395898_0118241 | 3300037466 | Bacteria | 2539 |
| 257 | Ga0395905_0006270 | 3300037471 | Bacteria | 12003 |
| 258 | Ga0395905_0012867 | 3300037471 | Bacteria | 8042 |
| 259 | Ga0395905_0055624 | 3300037471 | Bacteria | 3703 |
| 260 | Ga0395905_0079876 | 3300037471 | Bacteria | 3065 |
| 261 | Ga0395905_0096583 | 3300037471 | Bacteria | 2774 |
| 262 | Ga0436364_0059029 | 3300037853 | Bacteria | 977 |
| 263 | Ga0436364_0151535 | 3300037853 | Bacteria | 784 |
| 264 | Ga0395901_0000342 | 3300038443 | Bacteria | 56754 |
| 265 | Ga0395901_0140376 | 3300038443 | Bacteria | 2539 |
| 266 | Ga0400483_014056 | 3300039062 | Bacteria | 3378 |
| 267 | Ga0400483_052325 | 3300039062 | Bacteria | 1621 |
| 268 | Ga0400483_169471 | 3300039062 | Bacteria | 1831 |
| 269 | Ga0400483_187305 | 3300039062 | Bacteria | 5029 |
| 270 | Ga0436365_0376847 | 3300039437 | Bacteria | 89580 |
| 271 | Ga0436365_1891356 | 3300039437 | Bacteria | 3332 |
| 272 | Ga0436365_1905157 | 3300039437 | Bacteria | 743 |
| 273 | Ga0436360_0164499 | 3300039438 | Bacteria | 899 |
| 274 | Ga0436360_0409977 | 3300039438 | Bacteria | 1230 |
| 275 | Ga0436360_0551958 | 3300039438 | Bacteria | 2586 |
| 276 | Ga0436360_0905641 | 3300039438 | Bacteria | 1954 |
| 277 | Ga0436361_0100802 | 3300039447 | Bacteria | 1286 |
| 278 | Ga0436361_0953537 | 3300039447 | Bacteria | 44604 |
| 279 | Ga0436363_0347296 | 3300039450 | Bacteria | 1418 |
| 280 | Ga0436363_0411020 | 3300039450 | Bacteria | 729 |
| 281 | Ga0436363_0944849 | 3300039450 | Bacteria | 942 |
| 282 | Ga0436363_1544180 | 3300039450 | Bacteria | 1156 |
| 283 | Ga0436362_0858043 | 3300039453 | Bacteria | 1583 |
| 284 | Ga0439461_0048469 | 3300041410 | Bacteria | 936 |
| 285 | Ga0451793_0183211 | 3300041452 | Bacteria | 1055 |
| 286 | Ga0451843_1158826 | 3300041509 | Bacteria | 1295 |
| 287 | Ga0439437_004749 | 3300042000 | Bacteria | 1487 |
| 288 | Ga0439442_014552 | 3300042002 | Bacteria | 1620 |
| 289 | Ga0439445_0007571 | 3300042004 | Bacteria | 2523 |
| 290 | Ga0439432_034018 | 3300042006 | Bacteria | 1638 |
| 291 | Ga0439449_0064267 | 3300042007 | Bacteria | 1354 |
| 292 | Ga0450890_010332 | 3300042127 | Bacteria | 1201 |
| 293 | Ga0439446_0066307 | 3300042156 | Bacteria | 1098 |
| 294 | Ga0439446_0110932 | 3300042156 | Bacteria | 875 |
| 295 | Ga0439459_0000576 | 3300042438 | Bacteria | 4885 |
| 296 | Ga0450916_000234 | 3300042530 | Bacteria | 4330 |
| 297 | Ga0450893_0006119 | 3300042532 | Bacteria | 1943 |
| 298 | Ga0466961_0106082 | 3300044693 | Bacteria | 1769 |
| 299 | Ga0453684_0534082 | 3300044712 | Bacteria | 1294 |
| 300 | Ga0466970_0057669 | 3300044765 | Bacteria | 2077 |
| 301 | Ga0451576_0043660 | 3300045051 | Bacteria | 4729 |
| 302 | Ga0451576_0628970 | 3300045051 | Bacteria | 1128 |
| 303 | Ga0495627_000399 | 3300046453 | Bacteria | 38947 |
| 304 | Ga0495592_0250504 | 3300046454 | Bacteria | 1171 |
| 305 | Ga0495590_0000851 | 3300046457 | Bacteria | 13774 |
| 306 | Ga0495629_0018598 | 3300046459 | Bacteria | 4968 |
| 307 | Ga0495650_0001571 | 3300046471 | Bacteria | 21474 |
| 308 | Ga0495584_0192109 | 3300046491 | Bacteria | 1038 |
| 309 | Ga0495585_0057569 | 3300046492 | Bacteria | 2145 |
| 310 | Ga0495585_0205759 | 3300046492 | Bacteria | 1000 |
| 311 | Ga0495607_0207421 | 3300046501 | Bacteria | 966 |
| 312 | Ga0495583_0000650 | 3300046506 | Bacteria | 45814 |
| 313 | Ga0495606_0013477 | 3300046507 | Bacteria | 6451 |
| 314 | Ga0495606_0067825 | 3300046507 | Bacteria | 2258 |
| 315 | Ga0495606_0137467 | 3300046507 | Bacteria | 1445 |
| 316 | Ga0495606_0151705 | 3300046507 | Bacteria | 1359 |
| 317 | Ga0495610_0013510 | 3300046512 | Bacteria | 4850 |
| 318 | Ga0495610_0026700 | 3300046512 | Bacteria | 3079 |
| 319 | Ga0495616_0069112 | 3300046513 | Bacteria | 1713 |
| 320 | Ga0495620_0013485 | 3300046515 | Bacteria | 4181 |
| 321 | Ga0495631_0019391 | 3300046518 | Bacteria | 3189 |
| 322 | Ga0495632_0004552 | 3300046519 | Bacteria | 9398 |
| 323 | Ga0495637_0016956 | 3300046520 | Bacteria | 3401 |
| 324 | Ga0495643_0002864 | 3300046522 | Bacteria | 13105 |
| 325 | Ga0495643_0206625 | 3300046522 | Bacteria | 939 |
| 326 | Ga0495644_0147466 | 3300046523 | Bacteria | 900 |
| 327 | Ga0495648_0002288 | 3300046524 | Bacteria | 17871 |
| 328 | Ga0495648_0137128 | 3300046524 | Bacteria | 1292 |
| 329 | Ga0495663_0065355 | 3300046525 | Bacteria | 1149 |
| 330 | Ga0495663_0071665 | 3300046525 | Bacteria | 1104 |
| 331 | Ga0495642_0013507 | 3300046528 | Bacteria | 3159 |
| 332 | Ga0495654_0006712 | 3300046530 | Bacteria | 6511 |
| 333 | Ga0495609_0030354 | 3300046538 | Bacteria | 2460 |
| 334 | Ga0495597_0013809 | 3300046542 | Bacteria | 3860 |
| 335 | Ga0495597_0033708 | 3300046542 | Bacteria | 2317 |
| 336 | Ga0495597_0043806 | 3300046542 | Bacteria | 1991 |
| 337 | Ga0495622_0002985 | 3300046557 | Bacteria | 8042 |
| 338 | Ga0495633_0080184 | 3300046558 | Bacteria | 1519 |
| 339 | Ga0495668_0001818 | 3300046616 | Bacteria | 19364 |
| 340 | Ga0495668_0019185 | 3300046616 | Bacteria | 3945 |
| 341 | Ga0495668_0050196 | 3300046616 | Bacteria | 2312 |
| 342 | Ga0495668_0098794 | 3300046616 | Bacteria | 1597 |
| 343 | Ga0495668_0213466 | 3300046616 | Bacteria | 1056 |
| 344 | Ga0495611_0077613 | 3300046648 | Bacteria | 1523 |
| 345 | Ga0495625_0001925 | 3300046660 | Bacteria | 23466 |
| 346 | Ga0495625_0058314 | 3300046660 | Bacteria | 2743 |
| 347 | Ga0495625_0083154 | 3300046660 | Bacteria | 2225 |
| 348 | Ga0495625_0210534 | 3300046660 | Bacteria | 1278 |
| 349 | Ga0495661_0138934 | 3300046665 | Bacteria | 1324 |
| 350 | Ga0495669_0000044 | 3300046684 | Bacteria | 85633 |
| 351 | Ga0495669_0000371 | 3300046684 | Bacteria | 22866 |
| 352 | Ga0495669_0021716 | 3300046684 | Bacteria | 2789 |
| 353 | Ga0495669_0036871 | 3300046684 | Bacteria | 2162 |
| 354 | Ga0495613_0000576 | 3300046689 | Bacteria | 29823 |
| 355 | Ga0495670_0117572 | 3300046691 | Bacteria | 1380 |
| 356 | Ga0495670_0168018 | 3300046691 | Bacteria | 1154 |
| 357 | Ga0495649_0131040 | 3300046694 | Bacteria | 1323 |
| 358 | Ga0495589_0034715 | 3300046794 | Bacteria | 2530 |
| 359 | Ga0495636_0026912 | 3300047318 | Bacteria | 2341 |
| 360 | Ga0495672_0000439 | 3300047320 | Bacteria | 49666 |
| 361 | Ga0495672_0094949 | 3300047320 | Bacteria | 1629 |
| 362 | Ga0495683_0011199 | 3300047323 | Bacteria | 4727 |
| 363 | Ga0495687_080693 | 3300047443 | Bacteria | 1275 |
| 364 | Ga0495677_0023144 | 3300047445 | Bacteria | 2255 |
| 365 | Ga0495677_0041039 | 3300047445 | Bacteria | 1692 |
| 366 | Ga0495679_006048 | 3300047446 | Bacteria | 5288 |
| 367 | Ga0495673_0000189 | 3300047469 | Bacteria | 99018 |
| 368 | Ga0495673_0155445 | 3300047469 | Bacteria | 881 |
| 369 | Ga0495681_0064653 | 3300047470 | Bacteria | 1674 |
| 370 | Ga0495686_0007469 | 3300047472 | Bacteria | 8189 |
| 371 | Ga0495686_0026646 | 3300047472 | Bacteria | 3781 |
| 372 | Ga0495686_0070592 | 3300047472 | Bacteria | 2152 |
| 373 | Ga0495686_0184807 | 3300047472 | Bacteria | 1205 |
| 374 | Ga0495593_0029058 | 3300047673 | Bacteria | 3034 |
| 375 | Ga0496103_0131457 | 3300048906 | Bacteria | 1598 |
| 376 | Ga0496103_0177218 | 3300048906 | Bacteria | 1370 |
| 377 | Ga0496105_0090149 | 3300048908 | Bacteria | 2533 |
| 378 | Ga0496106_0006912 | 3300048909 | Bacteria | 8394 |
| 379 | Ga0496106_0180175 | 3300048909 | Bacteria | 1677 |
| 380 | Ga0496107_0000073 | 3300048910 | Bacteria | 48489 |
| 381 | Ga0496107_0146752 | 3300048910 | Bacteria | 1745 |
| 382 | Ga0496109_0134272 | 3300048912 | Bacteria | 2311 |
| 383 | Ga0496112_0020616 | 3300048915 | Bacteria | 6250 |
| 384 | Ga0496112_0037337 | 3300048915 | Bacteria | 4742 |
| 385 | Ga0496113_0515605 | 3300048916 | Bacteria | 960 |
| 386 | Ga0496114_0245251 | 3300048917 | Bacteria | 1576 |
| 387 | Ga0496115_0021048 | 3300048918 | Bacteria | 5033 |
| 388 | Ga0496115_0049703 | 3300048918 | Bacteria | 3357 |
| 389 | Ga0496115_0354921 | 3300048918 | Bacteria | 1195 |
| 390 | Ga0496115_0614869 | 3300048918 | Bacteria | 862 |
| 391 | Ga0496116_0134067 | 3300048919 | Bacteria | 1406 |
| 392 | Ga0496117_0020336 | 3300048920 | Bacteria | 5413 |
| 393 | Ga0496118_0014068 | 3300048921 | Bacteria | 7511 |
| 394 | Ga0496118_0293978 | 3300048921 | Bacteria | 896 |
| 395 | Ga0496119_0041993 | 3300048922 | Bacteria | 2905 |
| 396 | Ga0496121_0000946 | 3300048924 | Bacteria | 52586 |
| 397 | Ga0496121_0025980 | 3300048924 | Bacteria | 5537 |
| 398 | Ga0496121_0242092 | 3300048924 | Bacteria | 1256 |
| 399 | Ga0496125_0023733 | 3300048928 | Bacteria | 5655 |
| 400 | Ga0496125_0059294 | 3300048928 | Bacteria | 3085 |
| 401 | Ga0501341_02423 | 3300049131 | Bacteria | 1008 |
| 402 | Ga0495678_001705 | 3300049459 | Bacteria | 16503 |
| 403 | Ga0495682_0062724 | 3300049460 | Bacteria | 1341 |
| 404 | Ga0501311_018176 | 3300049527 | Bacteria | 932 |
| 405 | Ga0501312_008613 | 3300049528 | Bacteria | 1328 |
| 406 | Ga0501313_015433 | 3300049529 | Bacteria | 911 |
| 407 | Ga0501313_024125 | 3300049529 | Bacteria | 765 |
| 408 | Ga0501316_018267 | 3300049532 | Bacteria | 865 |
| 409 | Ga0501319_000756 | 3300049535 | Bacteria | 1660 |
| 410 | Ga0501319_005224 | 3300049535 | Bacteria | 926 |
| 411 | Ga0501320_011731 | 3300049536 | Bacteria | 912 |
| 412 | Ga0501321_006939 | 3300049537 | Bacteria | 1165 |
| 413 | Ga0501323_002237 | 3300049539 | Bacteria | 1852 |
| 414 | Ga0501324_002768 | 3300049540 | Bacteria | 1297 |
| 415 | Ga0501325_003636 | 3300049541 | Bacteria | 1136 |
| 416 | Ga0501032_0097203 | 3300049569 | Bacteria | 1952 |
| 417 | Ga0501032_0316542 | 3300049569 | Bacteria | 1008 |
| 418 | Ga0501033_0109003 | 3300049570 | Bacteria | 2017 |
| 419 | Ga0501033_0121202 | 3300049570 | Bacteria | 1898 |
| 420 | Ga0501034_0000482 | 3300049571 | Bacteria | 65380 |
| 421 | Ga0501034_0077264 | 3300049571 | Bacteria | 3335 |
| 422 | Ga0501037_0132584 | 3300049573 | Bacteria | 1786 |
| 423 | Ga0501039_0195868 | 3300049575 | Bacteria | 1589 |
| 424 | Ga0501041_0093540 | 3300049577 | Bacteria | 1857 |
| 425 | Ga0501043_0233205 | 3300049579 | Bacteria | 1421 |
| 426 | Ga0501047_0021902 | 3300049581 | Bacteria | 6136 |
| 427 | Ga0501047_0199368 | 3300049581 | Bacteria | 1863 |
| 428 | Ga0501047_0569577 | 3300049581 | Bacteria | 956 |
| 429 | Ga0501070_0063354 | 3300049586 | Bacteria | 3063 |
| 430 | Ga0501071_0320492 | 3300049587 | Bacteria | 1177 |
| 431 | Ga0501238_000524 | 3300049671 | Bacteria | 4389 |
| 432 | Ga0501257_016026 | 3300049686 | Bacteria | 1735 |
| 433 | Ga0501083_0314903 | 3300049744 | Bacteria | 1018 |
| 434 | Ga0501280_046869 | 3300049776 | Bacteria | 716 |
| 435 | Ga0501044_0032239 | 3300049823 | Bacteria | 5509 |
| 436 | Ga0501045_0324855 | 3300049824 | Bacteria | 1145 |
| 437 | nmdc:mga03n38_123713_c1 | 3300050490 | Bacteria | 1274 |
| 438 | nmdc:mga00v17_4550_c1 | 3300050491 | Bacteria | 7225 |
| 439 | nmdc:mga0k408_174832_c1 | 3300050493 | Bacteria | 1280 |
| 440 | nmdc:mga0k408_62374_c1 | 3300050493 | Bacteria | 2168 |
| 441 | nmdc:mga06z11_319018_c1 | 3300050494 | Bacteria | 926 |
| 442 | nmdc:mga06z11_6498_c1 | 3300050494 | Bacteria | 4762 |
| 443 | nmdc:mga04h51_7138_c1 | 3300050495 | Bacteria | 2935 |
| 444 | nmdc:mga07m45_250452_c1 | 3300050496 | Bacteria | 1031 |
| 445 | nmdc:mga07m45_45178_c1 | 3300050496 | Bacteria | 2473 |
| 446 | nmdc:mga07m45_57184_c1 | 3300050496 | Bacteria | 2205 |
| 447 | nmdc:mga07m45_60756_c1 | 3300050496 | Bacteria | 2140 |
| 448 | Ga0495601_0153663 | 3300053077 | Bacteria | 1503 |
| 449 | Ga0495612_0033758 | 3300053078 | Bacteria | 2071 |
| 450 | Ga0500635_0000205 | 3300053080 | Bacteria | 29287 |
| 451 | Ga0500578_0000459 | 3300053086 | Bacteria | 49572 |
| 452 | Ga0500643_003760 | 3300053087 | Bacteria | 7124 |
| 453 | Ga0500643_013812 | 3300053087 | Bacteria | 2832 |
| 454 | Ga0500643_022575 | 3300053087 | Bacteria | 2023 |
| 455 | Ga0500643_029867 | 3300053087 | Bacteria | 1673 |
| 456 | Ga0500644_0000193 | 3300053088 | Bacteria | 37831 |
| 457 | Ga0500646_0077311 | 3300053090 | Bacteria | 1009 |
| 458 | Ga0500647_0049633 | 3300053091 | Bacteria | 2018 |
| 459 | Ga0500583_0061517 | 3300053092 | Bacteria | 1773 |
| 460 | Ga0500651_0003210 | 3300053093 | Bacteria | 8883 |
| 461 | Ga0500566_0015189 | 3300053094 | Bacteria | 4518 |
| 462 | Ga0500566_0198852 | 3300053094 | Bacteria | 1014 |
| 463 | Ga0500641_0002284 | 3300053096 | Bacteria | 6803 |
| 464 | Ga0500641_0002384 | 3300053096 | Bacteria | 6663 |
| 465 | Ga0500641_0003388 | 3300053096 | Bacteria | 5637 |
| 466 | Ga0500641_0046486 | 3300053096 | Bacteria | 1772 |
| 467 | Ga0500650_0035877 | 3300053098 | Bacteria | 2274 |
| 468 | Ga0500554_000324 | 3300053102 | Bacteria | 10286 |
| 469 | Ga0500555_001699 | 3300053103 | Bacteria | 6625 |
| 470 | Ga0500556_0001068 | 3300053104 | Bacteria | 14047 |
| 471 | Ga0500556_0027981 | 3300053104 | Bacteria | 1888 |
| 472 | Ga0500556_0083999 | 3300053104 | Bacteria | 1207 |
| 473 | Ga0500562_000644 | 3300053108 | Bacteria | 8433 |
| 474 | Ga0500562_004084 | 3300053108 | Bacteria | 3679 |
| 475 | Ga0500569_000322 | 3300053109 | Bacteria | 7683 |
| 476 | Ga0500572_066175 | 3300053111 | Bacteria | 1108 |
| 477 | Ga0500593_106042 | 3300053117 | Bacteria | 1164 |
| 478 | Ga0500594_0000153 | 3300053118 | Bacteria | 18197 |
| 479 | Ga0500595_001651 | 3300053119 | Bacteria | 11721 |
| 480 | Ga0500595_007692 | 3300053119 | Bacteria | 4456 |
| 481 | Ga0500607_051245 | 3300053121 | Bacteria | 2195 |
| 482 | Ga0500608_000165 | 3300053122 | Bacteria | 27378 |
| 483 | Ga0500608_004302 | 3300053122 | Bacteria | 5487 |
| 484 | Ga0500608_117892 | 3300053122 | Bacteria | 1208 |
| 485 | Ga0500614_000617 | 3300053123 | Bacteria | 9057 |
| 486 | Ga0500614_054013 | 3300053123 | Bacteria | 1063 |
| 487 | Ga0500618_000703 | 3300053125 | Bacteria | 19670 |
| 488 | Ga0500628_108157 | 3300053129 | Bacteria | 743 |
| 489 | Ga0500652_102870 | 3300053131 | Bacteria | 1194 |
| 490 | Ga0500655_020777 | 3300053133 | Bacteria | 1228 |
| 491 | Ga0500658_0001787 | 3300053134 | Bacteria | 8487 |
| 492 | Ga0500559_0000113 | 3300053136 | Bacteria | 63512 |
| 493 | Ga0500559_0001398 | 3300053136 | Bacteria | 13721 |
| 494 | Ga0500559_0016148 | 3300053136 | Bacteria | 3152 |
| 495 | Ga0500564_000145 | 3300053138 | Bacteria | 18335 |
| 496 | Ga0500568_0044246 | 3300053139 | Bacteria | 1777 |
| 497 | Ga0500590_085514 | 3300053148 | Bacteria | 1540 |
| 498 | Ga0500603_003920 | 3300053150 | Bacteria | 3184 |
| 499 | Ga0500616_0081933 | 3300053153 | Bacteria | 1619 |
| 500 | Ga0500620_060729 | 3300053155 | Bacteria | 1286 |
| 501 | Ga0500622_0000771 | 3300053156 | Bacteria | 27846 |
| 502 | Ga0500622_0002771 | 3300053156 | Bacteria | 12332 |
| 503 | Ga0500622_0003985 | 3300053156 | Bacteria | 9528 |
| 504 | Ga0500624_001098 | 3300053157 | Bacteria | 5109 |
| 505 | Ga0500627_0046520 | 3300053158 | Bacteria | 1880 |
| 506 | Ga0500636_0123722 | 3300053177 | Bacteria | 1448 |
| 507 | Ga0500637_0061953 | 3300053178 | Bacteria | 2143 |
| 508 | Ga0500576_091809 | 3300053725 | Bacteria | 1259 |
| 509 | Ga0500625_102172 | 3300053729 | Bacteria | 1199 |
| 510 | Ga0500645_005399 | 3300053730 | Bacteria | 4711 |
| 511 | Ga0500645_009863 | 3300053730 | Bacteria | 3189 |
| 512 | Ga0500645_030083 | 3300053730 | Bacteria | 1636 |
| 513 | Ga0500645_038787 | 3300053730 | Bacteria | 1412 |
| 514 | Ga0500609_000093 | 3300053731 | Bacteria | 11592 |
| 515 | Ga0500596_000363 | 3300053735 | Bacteria | 8223 |
| 516 | Ga0500601_003237 | 3300053737 | Bacteria | 1765 |
| 517 | Ga0500661_020169 | 3300055283 | Bacteria | 1185 |
| 518 | Ga0587070_002120 | 3300059491 | Bacteria | 2195 |
| 519 | Ga0587070_072604 | 3300059491 | Bacteria | 737 |
| 520 | Ga0587082_018665 | 3300059504 | Bacteria | 1106 |
| 521 | Ga0587090_001712 | 3300059510 | Bacteria | 2275 |
| 522 | Ga0587092_012557 | 3300059512 | Bacteria | 1197 |
| 523 | Ga0587101_008635 | 3300059623 | Bacteria | 1237 |
| 524 | Ga0587076_030912 | 3300059645 | Bacteria | 948 |
| 525 | Ga0587079_005405 | 3300059647 | Bacteria | 1805 |
| 526 | 2511120810 | 2510917020 | Bacteria | 5657507 |
| 527 | 2585150050 | 2582581279 | Bacteria | 4980720 |
| 528 | 2585155427 | 2582581280 | Bacteria | 5994497 |
| 529 | 2585199211 | 2582581293 | Bacteria | 5907401 |
| 530 | 2587919505 | 2585428106 | Bacteria | 5179711 |
| 531 | 2643747995 | 2643221545 | Bacteria | 5083237 |
| 532 | 2643781708 | 2643221552 | Bacteria | 5708754 |
| 533 | 2643926357 | 2643221583 | Bacteria | 5218014 |
| 534 | 2643931648 | 2643221584 | Bacteria | 5511711 |
| 535 | 2643997884 | 2643221598 | Bacteria | 4578346 |
| 536 | 2644088878 | 2643221614 | Bacteria | 4260023 |
| 537 | 2644226564 | 2643221640 | Bacteria | 5258820 |
| 538 | 2644236052 | 2643221642 | Bacteria | 5357871 |
| 539 | 2644342240 | 2643221661 | Bacteria | 4267604 |
| 540 | 2644369623 | 2643221666 | Bacteria | 4265935 |
| 541 | 2644507902 | 2643221691 | Bacteria | 5093099 |
| 542 | 2739792097 | 2739367756 | Bacteria | 4553612 |
| 543 | 2792463711 | 2791355048 | Bacteria | 5832535 |
| 544 | 2819536864 | 2818991435 | Bacteria | 5433759 |
| 545 | 2819646025 | 2818991454 | Bacteria | 5563326 |
| 546 | 2840883971 | 2840878972 | Bacteria | 5483153 |
| 547 | 2843747085 | 2843744320 | Bacteria | 5659202 |
| 548 | 2849560624 | 2849560528 | Bacteria | 5393480 |
| 549 | 2849578465 | 2849573788 | Bacteria | 5421256 |
| 550 | 2851154292 | 2851153111 | Bacteria | 5542585 |
| 551 | 2854685319 | 2854681122 | Bacteria | 4548679 |
| 552 | 2857509517 | 2857504554 | Bacteria | 5369913 |
| 553 | 2884961095 | 2884960567 | Bacteria | 5437054 |
| 554 | 2898331304 | 2898329390 | Bacteria | 5168154 |
| 555 | 2898796997 | 2898795034 | Bacteria | 4294459 |
| 556 | 2899262500 | 2899259804 | Bacteria | 3320927 |
| 557 | 2928535754 | 2928531327 | Bacteria | 5101314 |
| 558 | 2941486936 | 2941485952 | Bacteria | 3591484 |
| 559 | 3000019217 | 3000017691 | Bacteria | 3772574 |
| 560 | JGI25153J46596_10020623 | |||
| 561 | Ga0032354_1009883 | |||
| 562 | Ga0032354_1036765 | |||
| 563 | Ga0055537_1004503 | |||
| 564 | Ga0055524_1019052 | |||
| 565 | Ga0055528_1007701 | |||
| 566 | Ga0055530_10004523 | |||
| 567 | Ga0055530_10022053 | |||
| 568 | Ga0055531_10023544 | |||
| 569 | Ga0055531_10029209 | |||
| 570 | Ga0065165_1002762 | |||
| 571 | Ga0065165_1007044 | |||
| 572 | Ga0070676_10327453 | |||
| 573 | Ga0070683_100461961 | |||
| 574 | Ga0070670_100000958 | |||
| 575 | Ga0070670_100063759 | |||
| 576 | Ga0070670_100528860 | |||
| 577 | Ga0068869_100511504 | |||
| 578 | Ga0070666_10288826 | |||
| 579 | Ga0070666_10304828 | |||
| 580 | Ga0070666_10323942 | |||
| 581 | Ga0070660_100140471 | |||
| 582 | Ga0070691_10004797 | |||
| 583 | Ga0070668_100002473 | |||
| 584 | Ga0070668_100018845 | |||
| 585 | Ga0070669_100019075 | |||
| 586 | Ga0070671_100001396 | |||
| 587 | Ga0070671_100308137 | |||
| 588 | Ga0070673_100051075 | |||
| 589 | Ga0070659_100074275 | |||
| 590 | Ga0070659_100174117 | |||
| 591 | Ga0070667_100026034 | |||
| 592 | Ga0070713_101138790 | |||
| 593 | Ga0070678_100198955 | |||
| 594 | Ga0070662_100432256 | |||
| 595 | Ga0070681_10068278 | |||
| 596 | Ga0070681_10099585 | |||
| 597 | Ga0068853_100233197 | |||
| 598 | Ga0068853_100399888 | |||
| 599 | Ga0070665_100055537 | |||
| 600 | Ga0070665_100063485 | |||
| 601 | Ga0070665_100076823 | |||
| 602 | Ga0070665_100182043 | |||
| 603 | Ga0068855_100722076 | |||
| 604 | Ga0068855_100853769 | |||
| 605 | Ga0070664_100036245 | |||
| 606 | Ga0068854_100283607 | |||
| 607 | Ga0068854_100496692 | |||
| 608 | Ga0068856_100221172 | |||
| 609 | Ga0068856_100667723 | |||
| 610 | Ga0068856_101011214 | |||
| 611 | Ga0068859_100268032 | |||
| 612 | Ga0068864_100043582 | |||
| 613 | Ga0068866_10385722 | |||
| 614 | Ga0068861_100060108 | |||
| 615 | Ga0068851_10283195 | |||
| 616 | Ga0068863_100045890 | |||
| 617 | Ga0068863_100064635 | |||
| 618 | Ga0068858_100050547 | |||
| 619 | Ga0068858_100524477 | |||
| 620 | Ga0068860_100001684 | |||
| 621 | Ga0068860_100022119 | |||
| 622 | Ga0068862_100028223 | |||
| 623 | Ga0068862_100305543 | |||
| 624 | Ga0075368_10008167 | |||
| 625 | Ga0075363_100047678 | |||
| 626 | Ga0075363_100103319 | |||
| 627 | Ga0075363_100438543 | |||
| 628 | Ga0075364_10001038 | |||
| 629 | Ga0075367_10001012 | |||
| 630 | Ga0075369_10010071 | |||
| 631 | Ga0075366_10059395 | |||
| 632 | Ga0075366_10115902 | |||
| 633 | Ga0075366_10127469 | |||
| 634 | Ga0075366_10355356 | |||
| 635 | Ga0075366_10571149 | |||
| 636 | Ga0075370_10027150 | |||
| 637 | Ga0075370_10202409 | |||
| 638 | Ga0068865_100013511 | |||
| 639 | Ga0097620_100268025 | |||
| 640 | Ga0105240_10000798 | |||
| 641 | Ga0105240_10230206 | |||
| 642 | Ga0105240_10335083 | |||
| 643 | Ga0105240_10386595 | |||
| 644 | Ga0105240_10406436 | |||
| 645 | Ga0105240_10524597 | |||
| 646 | Ga0105245_10635073 | |||
| 647 | Ga0105243_11099686 | |||
| 648 | Ga0105241_10051142 | |||
| 649 | Ga0105242_10218000 | |||
| 650 | Ga0105248_10008835 | |||
| 651 | Ga0105248_10259890 | |||
| 652 | Ga0105248_10382456 | |||
| 653 | Ga0105248_11214471 | |||
| 654 | Ga0105238_10232374 | |||
| 655 | Ga0105238_10593494 | |||
| 656 | Ga0105249_10041843 | |||
| 657 | Ga0105249_10257956 | |||
| 658 | Ga0105239_10294484 | |||
| 659 | Ga0105239_10652689 | |||
| 660 | Ga0105246_10521316 | |||
| 661 | Ga0157373_10136423 | |||
| 662 | Ga0157370_10114023 | |||
| 663 | Ga0157369_10018315 | |||
| 664 | Ga0157369_10406132 | |||
| 665 | Ga0157374_10493874 | |||
| 666 | Ga0157374_10986379 | |||
| 667 | Ga0157378_10653213 | |||
| 668 | Ga0163162_10080358 | |||
| 669 | Ga0157372_10364270 | |||
| 670 | Ga0157375_10429715 | |||
| 671 | Ga0163163_10009581 | |||
| 672 | Ga0163163_10439545 | |||
| 673 | Ga0157380_10548407 | |||
| 674 | Ga0182008_10084129 | |||
| 675 | Ga0157379_10041021 | |||
| 676 | Ga0157379_10898562 | |||
| 677 | Ga0182007_10037419 | |||
| 678 | Ga0213872_10005913 | |||
| 679 | Ga0213876_10000244 | |||
| 680 | Ga0209673_1001876 | |||
| 681 | Ga0209676_1022325 | |||
| 682 | Ga0209564_1007568 | |||
| 683 | Ga0209758_1002168 | |||
| 684 | Ga0209758_1023594 | |||
| 685 | Ga0209050_1000161 | |||
| 686 | Ga0209050_1019693 | |||
| 687 | Ga0209256_1003893 | |||
| 688 | Ga0209051_1000877 | |||
| 689 | Ga0209257_1000252 | |||
| 690 | Ga0209257_1000976 | |||
| 691 | Ga0209257_1008377 | |||
| 692 | Ga0209257_1010622 | |||
| 693 | Ga0207656_10099352 | |||
| 694 | Ga0207680_10043744 | |||
| 695 | Ga0207680_10057755 | |||
| 696 | Ga0207645_10029047 | |||
| 697 | Ga0207643_10064023 | |||
| 698 | Ga0207705_10018153 | |||
| 699 | Ga0207654_10077845 | |||
| 700 | Ga0207707_10183495 | |||
| 701 | Ga0207695_10000575 | |||
| 702 | Ga0207695_10010884 | |||
| 703 | Ga0207695_10273409 | |||
| 704 | Ga0207695_10372193 | |||
| 705 | Ga0207671_10217066 | |||
| 706 | Ga0207660_10000537 | |||
| 707 | Ga0207660_10193464 | |||
| 708 | Ga0207649_10107742 | |||
| 709 | Ga0207649_10355036 | |||
| 710 | Ga0207652_10002134 | |||
| 711 | Ga0207681_10164779 | |||
| 712 | Ga0207694_10228390 | |||
| 713 | Ga0207694_10244076 | |||
| 714 | Ga0207650_10000883 | |||
| 715 | Ga0207650_10051081 | |||
| 716 | Ga0207700_10184548 | |||
| 717 | Ga0207644_10019776 | |||
| 718 | Ga0207644_10035600 | |||
| 719 | Ga0207690_10018048 | |||
| 720 | Ga0207690_10175415 | |||
| 721 | Ga0207706_10019813 | |||
| 722 | Ga0207706_10561516 | |||
| 723 | Ga0207711_10001469 | |||
| 724 | Ga0207711_10112712 | |||
| 725 | Ga0207711_10245260 | |||
| 726 | Ga0207689_10604496 | |||
| 727 | Ga0207679_10207149 | |||
| 728 | Ga0207667_10166618 | |||
| 729 | Ga0207667_10259986 | |||
| 730 | Ga0207667_10906985 | |||
| 731 | Ga0207651_10395513 | |||
| 732 | Ga0207712_10002131 | |||
| 733 | Ga0207668_10000363 | |||
| 734 | Ga0207668_10000571 | |||
| 735 | Ga0207668_10037129 | |||
| 736 | Ga0207668_10037130 | |||
| 737 | Ga0207640_10178996 | |||
| 738 | Ga0207640_10410162 | |||
| 739 | Ga0207658_10001253 | |||
| 740 | Ga0207658_10012581 | |||
| 741 | Ga0207677_10475628 | |||
| 742 | Ga0207703_10013988 | |||
| 743 | Ga0207703_10086143 | |||
| 744 | Ga0207703_10464885 | |||
| 745 | Ga0207639_10053240 | |||
| 746 | Ga0207678_10183294 | |||
| 747 | Ga0207702_10266138 | |||
| 748 | Ga0207702_10348651 | |||
| 749 | Ga0207648_10273356 | |||
| 750 | Ga0207676_10010270 | |||
| 751 | Ga0207674_10336853 | |||
| 752 | Ga0207675_100039241 | |||
| 753 | Ga0209981_1000276 | |||
| 754 | Ga0210000_1022595 | |||
| 755 | Ga0209999_1001058 | |||
| 756 | Ga0209983_1005860 | |||
| 757 | Ga0209813_10061568 | |||
| 758 | Ga0268266_10000311 | |||
| 759 | Ga0268266_10023680 | |||
| 760 | Ga0268266_10040775 | |||
| 761 | Ga0268266_10053859 | |||
| 762 | Ga0268266_10077149 | |||
| 763 | Ga0268265_10004022 | |||
| 764 | Ga0268265_10695882 | |||
| 765 | Ga0268264_10000383 | |||
| 766 | Ga0268264_10002325 | |||
| 767 | Ga0268264_10072664 | |||
| 768 | Ga0265326_10027785 | |||
| 769 | Ga0265334_10006043 | |||
| 770 | Ga0307517_10130623 | |||
| 771 | Ga0265338_10019380 | |||
| 772 | Ga0265338_10048593 | |||
| 773 | Ga0265338_10442167 | |||
| 774 | Ga0265324_10119872 | |||
| 775 | Ga0307511_10006537 | |||
| 776 | Ga0307512_10169625 | |||
| 777 | Ga0265327_10000381 | |||
| 778 | Ga0265327_10007046 | |||
| 779 | Ga0265327_10042304 | |||
| 780 | Ga0265327_10055621 | |||
| 781 | Ga0307513_10000162 | |||
| 782 | Ga0307513_10010515 | |||
| 783 | Ga0307513_10016219 | |||
| 784 | Ga0307513_10198590 | |||
| 785 | Ga0265314_10053314 | |||
| 786 | Ga0265314_10083091 | |||
| 787 | Ga0265314_10183534 | |||
| 788 | Ga0307516_10001565 | |||
| 789 | Ga0307413_10002271 | |||
| 790 | Ga0307406_10115754 | |||
| 791 | Ga0307416_100235587 | |||
| 792 | Ga0307411_10055871 | |||
| 793 | Ga0316583_10029332 | |||
| 794 | Ga0316593_10019819 | |||
| 795 | Ga0316593_10029449 | |||
| 796 | Ga0307510_10078548 | |||
| 797 | Ga0316596_1076669 | |||
| 798 | Ga0373926_0062463 | |||
| 799 | Ga0373923_0172448 | |||
| 800 | Ga0373946_0016115 | |||
| 801 | Ga0373931_0114957 | |||
| 802 | Ga0373927_0000479 | |||
| 803 | Ga0373927_0165324 | |||
| 804 | Ga0373947_0084504 | |||
| 805 | Ga0373937_0407622 | |||
| 806 | Ga0373925_0000023 | |||
| 807 | Ga0373925_0175832 | |||
| 808 | Ga0395899_0001195 | |||
| 809 | Ga0395899_0322286 | |||
| 810 | Ga0395900_0006999 | |||
| 811 | Ga0395900_0130918 | |||
| 812 | Ga0395900_0250561 | |||
| 813 | Ga0395898_0004322 | |||
| 814 | Ga0395898_0071967 | |||
| 815 | Ga0395898_0118241 | |||
| 816 | Ga0395905_0006270 | |||
| 817 | Ga0395905_0012867 | |||
| 818 | Ga0395905_0055624 | |||
| 819 | Ga0395905_0079876 | |||
| 820 | Ga0395905_0096583 | |||
| 821 | Ga0436364_0059029 | |||
| 822 | Ga0436364_0151535 | |||
| 823 | Ga0395901_0000342 | |||
| 824 | Ga0395901_0140376 | |||
| 825 | Ga0400483_014056 | |||
| 826 | Ga0400483_052325 | |||
| 827 | Ga0400483_169471 | |||
| 828 | Ga0400483_187305 | |||
| 829 | Ga0436365_0376847 | |||
| 830 | Ga0436365_1891356 | |||
| 831 | Ga0436365_1905157 | |||
| 832 | Ga0436360_0164499 | |||
| 833 | Ga0436360_0409977 | |||
| 834 | Ga0436360_0551958 | |||
| 835 | Ga0436360_0905641 | |||
| 836 | Ga0436361_0100802 | |||
| 837 | Ga0436361_0953537 | |||
| 838 | Ga0436363_0347296 | |||
| 839 | Ga0436363_0411020 | |||
| 840 | Ga0436363_0944849 | |||
| 841 | Ga0436363_1544180 | |||
| 842 | Ga0436362_0858043 | |||
| 843 | Ga0439461_0048469 | |||
| 844 | Ga0451793_0183211 | |||
| 845 | Ga0451843_1158826 | |||
| 846 | Ga0439437_004749 | |||
| 847 | Ga0439442_014552 | |||
| 848 | Ga0439445_0007571 | |||
| 849 | Ga0439432_034018 | |||
| 850 | Ga0439449_0064267 | |||
| 851 | Ga0450890_010332 | |||
| 852 | Ga0439446_0066307 | |||
| 853 | Ga0439446_0110932 | |||
| 854 | Ga0439459_0000576 | |||
| 855 | Ga0450916_000234 | |||
| 856 | Ga0450893_0006119 | |||
| 857 | Ga0466961_0106082 | |||
| 858 | Ga0453684_0534082 | |||
| 859 | Ga0466970_0057669 | |||
| 860 | Ga0451576_0043660 | |||
| 861 | Ga0451576_0628970 | |||
| 862 | Ga0495627_000399 | |||
| 863 | Ga0495592_0250504 | |||
| 864 | Ga0495590_0000851 | |||
| 865 | Ga0495629_0018598 | |||
| 866 | Ga0495650_0001571 | |||
| 867 | Ga0495584_0192109 | |||
| 868 | Ga0495585_0057569 | |||
| 869 | Ga0495585_0205759 | |||
| 870 | Ga0495607_0207421 | |||
| 871 | Ga0495583_0000650 | |||
| 872 | Ga0495606_0013477 | |||
| 873 | Ga0495606_0067825 | |||
| 874 | Ga0495606_0137467 | |||
| 875 | Ga0495606_0151705 | |||
| 876 | Ga0495610_0013510 | |||
| 877 | Ga0495610_0026700 | |||
| 878 | Ga0495616_0069112 | |||
| 879 | Ga0495620_0013485 | |||
| 880 | Ga0495631_0019391 | |||
| 881 | Ga0495632_0004552 | |||
| 882 | Ga0495637_0016956 | |||
| 883 | Ga0495643_0002864 | |||
| 884 | Ga0495643_0206625 | |||
| 885 | Ga0495644_0147466 | |||
| 886 | Ga0495648_0002288 | |||
| 887 | Ga0495648_0137128 | |||
| 888 | Ga0495663_0065355 | |||
| 889 | Ga0495663_0071665 | |||
| 890 | Ga0495642_0013507 | |||
| 891 | Ga0495654_0006712 | |||
| 892 | Ga0495609_0030354 | |||
| 893 | Ga0495597_0013809 | |||
| 894 | Ga0495597_0033708 | |||
| 895 | Ga0495597_0043806 | |||
| 896 | Ga0495622_0002985 | |||
| 897 | Ga0495633_0080184 | |||
| 898 | Ga0495668_0001818 | |||
| 899 | Ga0495668_0019185 | |||
| 900 | Ga0495668_0050196 | |||
| 901 | Ga0495668_0098794 | |||
| 902 | Ga0495668_0213466 | |||
| 903 | Ga0495611_0077613 | |||
| 904 | Ga0495625_0001925 | |||
| 905 | Ga0495625_0058314 | |||
| 906 | Ga0495625_0083154 | |||
| 907 | Ga0495625_0210534 | |||
| 908 | Ga0495661_0138934 | |||
| 909 | Ga0495669_0000044 | |||
| 910 | Ga0495669_0000371 | |||
| 911 | Ga0495669_0021716 | |||
| 912 | Ga0495669_0036871 | |||
| 913 | Ga0495613_0000576 | |||
| 914 | Ga0495670_0117572 | |||
| 915 | Ga0495670_0168018 | |||
| 916 | Ga0495649_0131040 | |||
| 917 | Ga0495589_0034715 | |||
| 918 | Ga0495636_0026912 | |||
| 919 | Ga0495672_0000439 | |||
| 920 | Ga0495672_0094949 | |||
| 921 | Ga0495683_0011199 | |||
| 922 | Ga0495687_080693 | |||
| 923 | Ga0495677_0023144 | |||
| 924 | Ga0495677_0041039 | |||
| 925 | Ga0495679_006048 | |||
| 926 | Ga0495673_0000189 | |||
| 927 | Ga0495673_0155445 | |||
| 928 | Ga0495681_0064653 | |||
| 929 | Ga0495686_0007469 | |||
| 930 | Ga0495686_0026646 | |||
| 931 | Ga0495686_0070592 | |||
| 932 | Ga0495686_0184807 | |||
| 933 | Ga0495593_0029058 | |||
| 934 | Ga0496103_0131457 | |||
| 935 | Ga0496103_0177218 | |||
| 936 | Ga0496105_0090149 | |||
| 937 | Ga0496106_0006912 | |||
| 938 | Ga0496106_0180175 | |||
| 939 | Ga0496107_0000073 | |||
| 940 | Ga0496107_0146752 | |||
| 941 | Ga0496109_0134272 | |||
| 942 | Ga0496112_0020616 | |||
| 943 | Ga0496112_0037337 | |||
| 944 | Ga0496113_0515605 | |||
| 945 | Ga0496114_0245251 | |||
| 946 | Ga0496115_0021048 | |||
| 947 | Ga0496115_0049703 | |||
| 948 | Ga0496115_0354921 | |||
| 949 | Ga0496115_0614869 | |||
| 950 | Ga0496116_0134067 | |||
| 951 | Ga0496117_0020336 | |||
| 952 | Ga0496118_0014068 | |||
| 953 | Ga0496118_0293978 | |||
| 954 | Ga0496119_0041993 | |||
| 955 | Ga0496121_0000946 | |||
| 956 | Ga0496121_0025980 | |||
| 957 | Ga0496121_0242092 | |||
| 958 | Ga0496125_0023733 | |||
| 959 | Ga0496125_0059294 | |||
| 960 | Ga0501341_02423 | |||
| 961 | Ga0495678_001705 | |||
| 962 | Ga0495682_0062724 | |||
| 963 | Ga0501311_018176 | |||
| 964 | Ga0501312_008613 | |||
| 965 | Ga0501313_015433 | |||
| 966 | Ga0501313_024125 | |||
| 967 | Ga0501316_018267 | |||
| 968 | Ga0501319_000756 | |||
| 969 | Ga0501319_005224 | |||
| 970 | Ga0501320_011731 | |||
| 971 | Ga0501321_006939 | |||
| 972 | Ga0501323_002237 | |||
| 973 | Ga0501324_002768 | |||
| 974 | Ga0501325_003636 | |||
| 975 | Ga0501032_0097203 | |||
| 976 | Ga0501032_0316542 | |||
| 977 | Ga0501033_0109003 | |||
| 978 | Ga0501033_0121202 | |||
| 979 | Ga0501034_0000482 | |||
| 980 | Ga0501034_0077264 | |||
| 981 | Ga0501037_0132584 | |||
| 982 | Ga0501039_0195868 | |||
| 983 | Ga0501041_0093540 | |||
| 984 | Ga0501043_0233205 | |||
| 985 | Ga0501047_0021902 | |||
| 986 | Ga0501047_0199368 | |||
| 987 | Ga0501047_0569577 | |||
| 988 | Ga0501070_0063354 | |||
| 989 | Ga0501071_0320492 | |||
| 990 | Ga0501238_000524 | |||
| 991 | Ga0501257_016026 | |||
| 992 | Ga0501083_0314903 | |||
| 993 | Ga0501280_046869 | |||
| 994 | Ga0501044_0032239 | |||
| 995 | Ga0501045_0324855 | |||
| 996 | nmdc:mga03n38_123713_c1 | |||
| 997 | nmdc:mga00v17_4550_c1 | |||
| 998 | nmdc:mga0k408_174832_c1 | |||
| 999 | nmdc:mga0k408_62374_c1 | |||
| 1000 | nmdc:mga06z11_319018_c1 | |||
| 1001 | nmdc:mga06z11_6498_c1 | |||
| 1002 | nmdc:mga04h51_7138_c1 | |||
| 1003 | nmdc:mga07m45_250452_c1 | |||
| 1004 | nmdc:mga07m45_45178_c1 | |||
| 1005 | nmdc:mga07m45_57184_c1 | |||
| 1006 | nmdc:mga07m45_60756_c1 | |||
| 1007 | Ga0495601_0153663 | |||
| 1008 | Ga0495612_0033758 | |||
| 1009 | Ga0500635_0000205 | |||
| 1010 | Ga0500578_0000459 | |||
| 1011 | Ga0500643_003760 | |||
| 1012 | Ga0500643_013812 | |||
| 1013 | Ga0500643_022575 | |||
| 1014 | Ga0500643_029867 | |||
| 1015 | Ga0500644_0000193 | |||
| 1016 | Ga0500646_0077311 | |||
| 1017 | Ga0500647_0049633 | |||
| 1018 | Ga0500583_0061517 | |||
| 1019 | Ga0500651_0003210 | |||
| 1020 | Ga0500566_0015189 | |||
| 1021 | Ga0500566_0198852 | |||
| 1022 | Ga0500641_0002284 | |||
| 1023 | Ga0500641_0002384 | |||
| 1024 | Ga0500641_0003388 | |||
| 1025 | Ga0500641_0046486 | |||
| 1026 | Ga0500650_0035877 | |||
| 1027 | Ga0500554_000324 | |||
| 1028 | Ga0500555_001699 | |||
| 1029 | Ga0500556_0001068 | |||
| 1030 | Ga0500556_0027981 | |||
| 1031 | Ga0500556_0083999 | |||
| 1032 | Ga0500562_000644 | |||
| 1033 | Ga0500562_004084 | |||
| 1034 | Ga0500569_000322 | |||
| 1035 | Ga0500572_066175 | |||
| 1036 | Ga0500593_106042 | |||
| 1037 | Ga0500594_0000153 | |||
| 1038 | Ga0500595_001651 | |||
| 1039 | Ga0500595_007692 | |||
| 1040 | Ga0500607_051245 | |||
| 1041 | Ga0500608_000165 | |||
| 1042 | Ga0500608_004302 | |||
| 1043 | Ga0500608_117892 | |||
| 1044 | Ga0500614_000617 | |||
| 1045 | Ga0500614_054013 | |||
| 1046 | Ga0500618_000703 | |||
| 1047 | Ga0500628_108157 | |||
| 1048 | Ga0500652_102870 | |||
| 1049 | Ga0500655_020777 | |||
| 1050 | Ga0500658_0001787 | |||
| 1051 | Ga0500559_0000113 | |||
| 1052 | Ga0500559_0001398 | |||
| 1053 | Ga0500559_0016148 | |||
| 1054 | Ga0500564_000145 | |||
| 1055 | Ga0500568_0044246 | |||
| 1056 | Ga0500590_085514 | |||
| 1057 | Ga0500603_003920 | |||
| 1058 | Ga0500616_0081933 | |||
| 1059 | Ga0500620_060729 | |||
| 1060 | Ga0500622_0000771 | |||
| 1061 | Ga0500622_0002771 | |||
| 1062 | Ga0500622_0003985 | |||
| 1063 | Ga0500624_001098 | |||
| 1064 | Ga0500627_0046520 | |||
| 1065 | Ga0500636_0123722 | |||
| 1066 | Ga0500637_0061953 | |||
| 1067 | Ga0500576_091809 | |||
| 1068 | Ga0500625_102172 | |||
| 1069 | Ga0500645_005399 | |||
| 1070 | Ga0500645_009863 | |||
| 1071 | Ga0500645_030083 | |||
| 1072 | Ga0500645_038787 | |||
| 1073 | Ga0500609_000093 | |||
| 1074 | Ga0500596_000363 | |||
| 1075 | Ga0500601_003237 | |||
| 1076 | Ga0500661_020169 | |||
| 1077 | Ga0587070_002120 | |||
| 1078 | Ga0587070_072604 | |||
| 1079 | Ga0587082_018665 | |||
| 1080 | Ga0587090_001712 | |||
| 1081 | Ga0587092_012557 | |||
| 1082 | Ga0587101_008635 | |||
| 1083 | Ga0587076_030912 | |||
| 1084 | Ga0587079_005405 | |||
| 1085 | 2511120810 | |||
| 1086 | 2585150050 | |||
| 1087 | 2585155427 | |||
| 1088 | 2585199211 | |||
| 1089 | 2587919505 | |||
| 1090 | 2643747995 | |||
| 1091 | 2643781708 | |||
| 1092 | 2643926357 | |||
| 1093 | 2643931648 | |||
| 1094 | 2643997884 | |||
| 1095 | 2644088878 | |||
| 1096 | 2644226564 | |||
| 1097 | 2644236052 | |||
| 1098 | 2644342240 | |||
| 1099 | 2644369623 | |||
| 1100 | 2644507902 | |||
| 1101 | 2739792097 | |||
| 1102 | 2792463711 | |||
| 1103 | 2819536864 | |||
| 1104 | 2819646025 | |||
| 1105 | 2840883971 | |||
| 1106 | 2843747085 | |||
| 1107 | 2849560624 | |||
| 1108 | 2849578465 | |||
| 1109 | 2851154292 | |||
| 1110 | 2854685319 | |||
| 1111 | 2857509517 | |||
| 1112 | 2884961095 | |||
| 1113 | 2898331304 | |||
| 1114 | 2898796997 | |||
| 1115 | 2899262500 | |||
| 1116 | 2928535754 | |||
| 1117 | 2941486936 | |||
| 1118 | 3000019217 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8907 | 13 | 203 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8783 | 3 | 203 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8626 | 3 | 203 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8616 | 3 | 203 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8464 | 3 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7883 | 1 | 203 | 3.40.1370.10 |
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7753 | 1 | 203 | 3.40.1370.10 |
| af_K7MAT5_102_317_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7497 | 1 | 203 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7493 | 1 | 203 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7392 | 1 | 203 | 3.40.1370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434FBH1-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9843 | 108 | 203 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A258B788-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9764 | 127 | 205 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A537R4I8-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9646 | 108 | 203 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A529VK89-F1-model_v4 | deleted | 0.9551 | 90 | 203 |
|
| AF-A0A356NL58-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9471 | 98 | 203 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |