F463522

General Info

Members Datasets Scaffolds Average Seq Length
559 368 1118 211

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10020623|JGI25153J46596_100206233
Length 227
Sequence MKLDVIKLDGGKAGSVDLDDAIFGIADIRGDILQRVVTWQLAKRRSGNHKIQVRNEVSRTGKKMYKQKGTGSARHGSRRAAQFVGGAKAXGPVVRSHAFXLPKKIRAMALRHALSSKAKAGSIVVLDSAVLTDPKTAALRANFDKIGLKNALVIAGPEVDGNFKLAARNIPNIDVLPNAGLNVYDVLRRQTLVLTKDAXEAISARFAEKEAAXWPQPPATTTRSCRR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
134 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
144 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
171 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
179 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
268 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
282 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
283 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
284 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
285 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
286 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
290 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
291 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
292 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
293 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
294 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
295 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
296 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
297 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
298 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
299 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
302 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
303 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
304 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
305 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
306 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
307 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
308 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
313 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
316 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
317 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
318 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
319 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
320 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
321 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
322 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
325 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
326 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
327 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
328 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
336 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
337 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
338 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
339 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
340 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
341 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
342 2643221583 Caulobacter sp. Root655 Isolate Unclassified
343 2643221584 Caulobacter sp. Root656 Isolate Unclassified
344 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
345 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
346 2643221640 Caulobacter sp. Root342 Isolate Unclassified
347 2643221642 Caulobacter sp. Root343 Isolate Unclassified
348 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
349 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
350 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
351 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
352 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
353 2818991435 Caulobacter henricii 536 Isolate Unclassified
354 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
355 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
356 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
357 2849560528 Caulobacter zeae 410 Isolate Unclassified
358 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
359 2851153111 Caulobacter radicis 736 Isolate Unclassified
360 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
361 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
362 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
363 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
364 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
365 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
366 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
367 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
368 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.27
Metatranscriptomes 4.65
Isolates 6.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.93
Nodule 0
Rhizoplane 3.04
Rhizosphere 66.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10020623 3300003215 Bacteria 2486
2 Ga0032354_1009883 3300003693 Bacteria 2257
3 Ga0032354_1036765 3300003693 Bacteria 2457
4 Ga0055537_1004503 3300003773 Bacteria 3972
5 Ga0055524_1019052 3300003775 Bacteria 2359
6 Ga0055528_1007701 3300003790 Bacteria 4722
7 Ga0055530_10004523 3300003791 Bacteria 7112
8 Ga0055530_10022053 3300003791 Bacteria 1861
9 Ga0055531_10023544 3300003794 Bacteria 2303
10 Ga0055531_10029209 3300003794 Bacteria 1882
11 Ga0065165_1002762 3300005262 Bacteria 13954
12 Ga0065165_1007044 3300005262 Bacteria 5660
13 Ga0070676_10327453 3300005328 Bacteria 1047
14 Ga0070683_100461961 3300005329 Bacteria 1212
15 Ga0070670_100000958 3300005331 Bacteria 22640
16 Ga0070670_100063759 3300005331 Bacteria 3162
17 Ga0070670_100528860 3300005331 Bacteria 1050
18 Ga0068869_100511504 3300005334 Bacteria 1004
19 Ga0070666_10288826 3300005335 Bacteria 1167
20 Ga0070666_10304828 3300005335 Bacteria 1135
21 Ga0070666_10323942 3300005335 Bacteria 1099
22 Ga0070660_100140471 3300005339 Bacteria 1937
23 Ga0070691_10004797 3300005341 Bacteria 6156
24 Ga0070668_100002473 3300005347 Bacteria 13591
25 Ga0070668_100018845 3300005347 Bacteria 5184
26 Ga0070669_100019075 3300005353 Bacteria 4902
27 Ga0070671_100001396 3300005355 Bacteria 18034
28 Ga0070671_100308137 3300005355 Bacteria 1348
29 Ga0070673_100051075 3300005364 Bacteria 3236
30 Ga0070659_100074275 3300005366 Bacteria 2708
31 Ga0070659_100174117 3300005366 Bacteria 1764
32 Ga0070667_100026034 3300005367 Bacteria 4864
33 Ga0070713_101138790 3300005436 Bacteria 754
34 Ga0070678_100198955 3300005456 Bacteria 1653
35 Ga0070662_100432256 3300005457 Bacteria 1090
36 Ga0070681_10068278 3300005458 Bacteria 3522
37 Ga0070681_10099585 3300005458 Bacteria 2852
38 Ga0068853_100233197 3300005539 Bacteria 1684
39 Ga0068853_100399888 3300005539 Bacteria 1285
40 Ga0070665_100055537 3300005548 Bacteria 3971
41 Ga0070665_100063485 3300005548 Bacteria 3703
42 Ga0070665_100076823 3300005548 Bacteria 3346
43 Ga0070665_100182043 3300005548 Bacteria 2102
44 Ga0068855_100722076 3300005563 Bacteria 1065
45 Ga0068855_100853769 3300005563 Bacteria 964
46 Ga0070664_100036245 3300005564 Bacteria 4144
47 Ga0068854_100283607 3300005578 Bacteria 1334
48 Ga0068854_100496692 3300005578 Bacteria 1027
49 Ga0068856_100221172 3300005614 Bacteria 1909
50 Ga0068856_100667723 3300005614 Bacteria 1060
51 Ga0068856_101011214 3300005614 Bacteria 849
52 Ga0068859_100268032 3300005617 Bacteria 1799
53 Ga0068864_100043582 3300005618 Bacteria 3842
54 Ga0068866_10385722 3300005718 Bacteria 900
55 Ga0068861_100060108 3300005719 Bacteria 2911
56 Ga0068851_10283195 3300005834 Bacteria 948
57 Ga0068863_100045890 3300005841 Bacteria 4147
58 Ga0068863_100064635 3300005841 Bacteria 3460
59 Ga0068858_100050547 3300005842 Bacteria 3847
60 Ga0068858_100524477 3300005842 Bacteria 1146
61 Ga0068860_100001684 3300005843 Bacteria 23610
62 Ga0068860_100022119 3300005843 Bacteria 6155
63 Ga0068862_100028223 3300005844 Bacteria 4725
64 Ga0068862_100305543 3300005844 Bacteria 1464
65 Ga0075368_10008167 3300006042 Bacteria 3719
66 Ga0075363_100047678 3300006048 Bacteria 2276
67 Ga0075363_100103319 3300006048 Bacteria 1579
68 Ga0075363_100438543 3300006048 Bacteria 770
69 Ga0075364_10001038 3300006051 Bacteria 14772
70 Ga0075367_10001012 3300006178 Bacteria 11557
71 Ga0075369_10010071 3300006186 Bacteria 3692
72 Ga0075366_10059395 3300006195 Bacteria 2271
73 Ga0075366_10115902 3300006195 Bacteria 1613
74 Ga0075366_10127469 3300006195 Bacteria 1535
75 Ga0075366_10355356 3300006195 Bacteria 900
76 Ga0075366_10571149 3300006195 Bacteria 700
77 Ga0075370_10027150 3300006353 Bacteria 3175
78 Ga0075370_10202409 3300006353 Bacteria 1171
79 Ga0068865_100013511 3300006881 Bacteria 5161
80 Ga0097620_100268025 3300006931 Bacteria 1799
81 Ga0105240_10000798 3300009093 Bacteria 57073
82 Ga0105240_10230206 3300009093 Bacteria 2154
83 Ga0105240_10335083 3300009093 Bacteria 1720
84 Ga0105240_10386595 3300009093 Bacteria 1579
85 Ga0105240_10406436 3300009093 Bacteria 1532
86 Ga0105240_10524597 3300009093 Bacteria 1314
87 Ga0105245_10635073 3300009098 Bacteria 1097
88 Ga0105243_11099686 3300009148 Bacteria 803
89 Ga0105241_10051142 3300009174 Bacteria 3150
90 Ga0105242_10218000 3300009176 Bacteria 1704
91 Ga0105248_10008835 3300009177 Bacteria 11068
92 Ga0105248_10259890 3300009177 Bacteria 1955
93 Ga0105248_10382456 3300009177 Bacteria 1585
94 Ga0105248_11214471 3300009177 Bacteria 852
95 Ga0105238_10232374 3300009551 Bacteria 1820
96 Ga0105238_10593494 3300009551 Bacteria 1115
97 Ga0105249_10041843 3300009553 Bacteria 4166
98 Ga0105249_10257956 3300009553 Bacteria 1731
99 Ga0105239_10294484 3300010375 Bacteria 1827
100 Ga0105239_10652689 3300010375 Bacteria 1202
101 Ga0105246_10521316 3300011119 Bacteria 1013
102 Ga0157373_10136423 3300013100 Bacteria 1725
103 Ga0157370_10114023 3300013104 Bacteria 2525
104 Ga0157369_10018315 3300013105 Bacteria 7853
105 Ga0157369_10406132 3300013105 Bacteria 1413
106 Ga0157374_10493874 3300013296 Bacteria 1228
107 Ga0157374_10986379 3300013296 Bacteria 861
108 Ga0157378_10653213 3300013297 Bacteria 1067
109 Ga0163162_10080358 3300013306 Bacteria 3328
110 Ga0157372_10364270 3300013307 Bacteria 1684
111 Ga0157375_10429715 3300013308 Bacteria 1487
112 Ga0163163_10009581 3300014325 Bacteria 8656
113 Ga0163163_10439545 3300014325 Bacteria 1364
114 Ga0157380_10548407 3300014326 Bacteria 1134
115 Ga0182008_10084129 3300014497 Bacteria 1567
116 Ga0157379_10041021 3300014968 Bacteria 4131
117 Ga0157379_10898562 3300014968 Bacteria 840
118 Ga0182007_10037419 3300015262 Bacteria 1630
119 Ga0213872_10005913 3300021361 Bacteria 6209
120 Ga0213876_10000244 3300021384 Bacteria 51875
121 Ga0209673_1001876 3300025273 Bacteria 16959
122 Ga0209676_1022325 3300025292 Bacteria 2100
123 Ga0209564_1007568 3300025295 Bacteria 5584
124 Ga0209758_1002168 3300025297 Bacteria 20636
125 Ga0209758_1023594 3300025297 Bacteria 2776
126 Ga0209050_1000161 3300025298 Bacteria 155713
127 Ga0209050_1019693 3300025298 Bacteria 2548
128 Ga0209256_1003893 3300025299 Bacteria 9891
129 Ga0209051_1000877 3300025303 Bacteria 30359
130 Ga0209257_1000252 3300025304 Bacteria 123718
131 Ga0209257_1000976 3300025304 Bacteria 38920
132 Ga0209257_1008377 3300025304 Bacteria 5898
133 Ga0209257_1010622 3300025304 Bacteria 4615
134 Ga0207656_10099352 3300025321 Bacteria 1332
135 Ga0207680_10043744 3300025903 Bacteria 2629
136 Ga0207680_10057755 3300025903 Bacteria 2349
137 Ga0207645_10029047 3300025907 Bacteria 3565
138 Ga0207643_10064023 3300025908 Bacteria 2104
139 Ga0207705_10018153 3300025909 Bacteria 5029
140 Ga0207654_10077845 3300025911 Bacteria 1989
141 Ga0207707_10183495 3300025912 Bacteria 1826
142 Ga0207695_10000575 3300025913 Bacteria 74997
143 Ga0207695_10010884 3300025913 Bacteria 11075
144 Ga0207695_10273409 3300025913 Bacteria 1585
145 Ga0207695_10372193 3300025913 Bacteria 1315
146 Ga0207671_10217066 3300025914 Bacteria 1497
147 Ga0207660_10000537 3300025917 Bacteria 25426
148 Ga0207660_10193464 3300025917 Bacteria 1585
149 Ga0207649_10107742 3300025920 Bacteria 1856
150 Ga0207649_10355036 3300025920 Bacteria 1086
151 Ga0207652_10002134 3300025921 Bacteria 16964
152 Ga0207681_10164779 3300025923 Bacteria 1674
153 Ga0207694_10228390 3300025924 Bacteria 1519
154 Ga0207694_10244076 3300025924 Bacteria 1468
155 Ga0207650_10000883 3300025925 Bacteria 22684
156 Ga0207650_10051081 3300025925 Bacteria 3059
157 Ga0207700_10184548 3300025928 Bacteria 1749
158 Ga0207644_10019776 3300025931 Bacteria 4571
159 Ga0207644_10035600 3300025931 Bacteria 3489
160 Ga0207690_10018048 3300025932 Bacteria 4321
161 Ga0207690_10175415 3300025932 Bacteria 1609
162 Ga0207706_10019813 3300025933 Bacteria 6048
163 Ga0207706_10561516 3300025933 Bacteria 982
164 Ga0207711_10001469 3300025941 Bacteria 21980
165 Ga0207711_10112712 3300025941 Bacteria 2421
166 Ga0207711_10245260 3300025941 Bacteria 1643
167 Ga0207689_10604496 3300025942 Bacteria 922
168 Ga0207679_10207149 3300025945 Bacteria 1642
169 Ga0207667_10166618 3300025949 Bacteria 2265
170 Ga0207667_10259986 3300025949 Bacteria 1775
171 Ga0207667_10906985 3300025949 Bacteria 873
172 Ga0207651_10395513 3300025960 Bacteria 1174
173 Ga0207712_10002131 3300025961 Bacteria 12933
174 Ga0207668_10000363 3300025972 Bacteria 28976
175 Ga0207668_10000571 3300025972 Bacteria 23129
176 Ga0207668_10037129 3300025972 Bacteria 3258
177 Ga0207668_10037130 3300025972 Bacteria 3258
178 Ga0207640_10178996 3300025981 Bacteria 1588
179 Ga0207640_10410162 3300025981 Bacteria 1106
180 Ga0207658_10001253 3300025986 Bacteria 20099
181 Ga0207658_10012581 3300025986 Bacteria 5776
182 Ga0207677_10475628 3300026023 Bacteria 1075
183 Ga0207703_10013988 3300026035 Bacteria 6256
184 Ga0207703_10086143 3300026035 Bacteria 2631
185 Ga0207703_10464885 3300026035 Bacteria 1184
186 Ga0207639_10053240 3300026041 Bacteria 3087
187 Ga0207678_10183294 3300026067 Bacteria 1788
188 Ga0207702_10266138 3300026078 Bacteria 1616
189 Ga0207702_10348651 3300026078 Bacteria 1416
190 Ga0207648_10273356 3300026089 Bacteria 1510
191 Ga0207676_10010270 3300026095 Bacteria 6663
192 Ga0207674_10336853 3300026116 Bacteria 1458
193 Ga0207675_100039241 3300026118 Bacteria 4420
194 Ga0209981_1000276 3300027378 Bacteria 6562
195 Ga0210000_1022595 3300027462 Bacteria 966
196 Ga0209999_1001058 3300027543 Bacteria 4681
197 Ga0209983_1005860 3300027665 Bacteria 2538
198 Ga0209813_10061568 3300027866 Bacteria 1199
199 Ga0268266_10000311 3300028379 Bacteria 77262
200 Ga0268266_10023680 3300028379 Bacteria 5226
201 Ga0268266_10040775 3300028379 Bacteria 3959
202 Ga0268266_10053859 3300028379 Bacteria 3457
203 Ga0268266_10077149 3300028379 Bacteria 2896
204 Ga0268265_10004022 3300028380 Bacteria 10354
205 Ga0268265_10695882 3300028380 Bacteria 981
206 Ga0268264_10000383 3300028381 Bacteria 63883
207 Ga0268264_10002325 3300028381 Bacteria 16817
208 Ga0268264_10072664 3300028381 Bacteria 2917
209 Ga0265326_10027785 3300028558 Bacteria 1613
210 Ga0265334_10006043 3300028573 Bacteria 5256
211 Ga0307517_10130623 3300028786 Bacteria 1810
212 Ga0265338_10019380 3300028800 Bacteria 7219
213 Ga0265338_10048593 3300028800 Bacteria 3858
214 Ga0265338_10442167 3300028800 Bacteria 921
215 Ga0265324_10119872 3300029957 Bacteria 894
216 Ga0307511_10006537 3300030521 Bacteria 11736
217 Ga0307512_10169625 3300030522 Bacteria 1255
218 Ga0265327_10000381 3300031251 Bacteria 83617
219 Ga0265327_10007046 3300031251 Bacteria 8808
220 Ga0265327_10042304 3300031251 Bacteria 2447
221 Ga0265327_10055621 3300031251 Bacteria 2042
222 Ga0307513_10000162 3300031456 Bacteria 96000
223 Ga0307513_10010515 3300031456 Bacteria 11583
224 Ga0307513_10016219 3300031456 Bacteria 8997
225 Ga0307513_10198590 3300031456 Bacteria 1849
226 Ga0265314_10053314 3300031711 Bacteria 2806
227 Ga0265314_10083091 3300031711 Bacteria 2106
228 Ga0265314_10183534 3300031711 Bacteria 1251
229 Ga0307516_10001565 3300031730 Bacteria 31484
230 Ga0307413_10002271 3300031824 Bacteria 7767
231 Ga0307406_10115754 3300031901 Bacteria 1854
232 Ga0307416_100235587 3300032002 Bacteria 1769
233 Ga0307411_10055871 3300032005 Bacteria 2599
234 Ga0316583_10029332 3300032133 Bacteria 1962
235 Ga0316593_10019819 3300032168 Bacteria 2082
236 Ga0316593_10029449 3300032168 Bacteria 1776
237 Ga0307510_10078548 3300033180 Bacteria 3227
238 Ga0316596_1076669 3300033541 Bacteria 897
239 Ga0373926_0062463 3300035083 Bacteria 1360
240 Ga0373923_0172448 3300035111 Bacteria 991
241 Ga0373946_0016115 3300035171 Bacteria 2844
242 Ga0373931_0114957 3300035691 Bacteria 1531
243 Ga0373927_0000479 3300035695 Bacteria 30749
244 Ga0373927_0165324 3300035695 Bacteria 1450
245 Ga0373947_0084504 3300035725 Bacteria 1970
246 Ga0373937_0407622 3300036401 Bacteria 1290
247 Ga0373925_0000023 3300037068 Bacteria 158881
248 Ga0373925_0175832 3300037068 Bacteria 1692
249 Ga0395899_0001195 3300037312 Bacteria 22830
250 Ga0395899_0322286 3300037312 Bacteria 1040
251 Ga0395900_0006999 3300037418 Bacteria 11682
252 Ga0395900_0130918 3300037418 Bacteria 2571
253 Ga0395900_0250561 3300037418 Bacteria 1772
254 Ga0395898_0004322 3300037466 Bacteria 15569
255 Ga0395898_0071967 3300037466 Bacteria 3340
256 Ga0395898_0118241 3300037466 Bacteria 2539
257 Ga0395905_0006270 3300037471 Bacteria 12003
258 Ga0395905_0012867 3300037471 Bacteria 8042
259 Ga0395905_0055624 3300037471 Bacteria 3703
260 Ga0395905_0079876 3300037471 Bacteria 3065
261 Ga0395905_0096583 3300037471 Bacteria 2774
262 Ga0436364_0059029 3300037853 Bacteria 977
263 Ga0436364_0151535 3300037853 Bacteria 784
264 Ga0395901_0000342 3300038443 Bacteria 56754
265 Ga0395901_0140376 3300038443 Bacteria 2539
266 Ga0400483_014056 3300039062 Bacteria 3378
267 Ga0400483_052325 3300039062 Bacteria 1621
268 Ga0400483_169471 3300039062 Bacteria 1831
269 Ga0400483_187305 3300039062 Bacteria 5029
270 Ga0436365_0376847 3300039437 Bacteria 89580
271 Ga0436365_1891356 3300039437 Bacteria 3332
272 Ga0436365_1905157 3300039437 Bacteria 743
273 Ga0436360_0164499 3300039438 Bacteria 899
274 Ga0436360_0409977 3300039438 Bacteria 1230
275 Ga0436360_0551958 3300039438 Bacteria 2586
276 Ga0436360_0905641 3300039438 Bacteria 1954
277 Ga0436361_0100802 3300039447 Bacteria 1286
278 Ga0436361_0953537 3300039447 Bacteria 44604
279 Ga0436363_0347296 3300039450 Bacteria 1418
280 Ga0436363_0411020 3300039450 Bacteria 729
281 Ga0436363_0944849 3300039450 Bacteria 942
282 Ga0436363_1544180 3300039450 Bacteria 1156
283 Ga0436362_0858043 3300039453 Bacteria 1583
284 Ga0439461_0048469 3300041410 Bacteria 936
285 Ga0451793_0183211 3300041452 Bacteria 1055
286 Ga0451843_1158826 3300041509 Bacteria 1295
287 Ga0439437_004749 3300042000 Bacteria 1487
288 Ga0439442_014552 3300042002 Bacteria 1620
289 Ga0439445_0007571 3300042004 Bacteria 2523
290 Ga0439432_034018 3300042006 Bacteria 1638
291 Ga0439449_0064267 3300042007 Bacteria 1354
292 Ga0450890_010332 3300042127 Bacteria 1201
293 Ga0439446_0066307 3300042156 Bacteria 1098
294 Ga0439446_0110932 3300042156 Bacteria 875
295 Ga0439459_0000576 3300042438 Bacteria 4885
296 Ga0450916_000234 3300042530 Bacteria 4330
297 Ga0450893_0006119 3300042532 Bacteria 1943
298 Ga0466961_0106082 3300044693 Bacteria 1769
299 Ga0453684_0534082 3300044712 Bacteria 1294
300 Ga0466970_0057669 3300044765 Bacteria 2077
301 Ga0451576_0043660 3300045051 Bacteria 4729
302 Ga0451576_0628970 3300045051 Bacteria 1128
303 Ga0495627_000399 3300046453 Bacteria 38947
304 Ga0495592_0250504 3300046454 Bacteria 1171
305 Ga0495590_0000851 3300046457 Bacteria 13774
306 Ga0495629_0018598 3300046459 Bacteria 4968
307 Ga0495650_0001571 3300046471 Bacteria 21474
308 Ga0495584_0192109 3300046491 Bacteria 1038
309 Ga0495585_0057569 3300046492 Bacteria 2145
310 Ga0495585_0205759 3300046492 Bacteria 1000
311 Ga0495607_0207421 3300046501 Bacteria 966
312 Ga0495583_0000650 3300046506 Bacteria 45814
313 Ga0495606_0013477 3300046507 Bacteria 6451
314 Ga0495606_0067825 3300046507 Bacteria 2258
315 Ga0495606_0137467 3300046507 Bacteria 1445
316 Ga0495606_0151705 3300046507 Bacteria 1359
317 Ga0495610_0013510 3300046512 Bacteria 4850
318 Ga0495610_0026700 3300046512 Bacteria 3079
319 Ga0495616_0069112 3300046513 Bacteria 1713
320 Ga0495620_0013485 3300046515 Bacteria 4181
321 Ga0495631_0019391 3300046518 Bacteria 3189
322 Ga0495632_0004552 3300046519 Bacteria 9398
323 Ga0495637_0016956 3300046520 Bacteria 3401
324 Ga0495643_0002864 3300046522 Bacteria 13105
325 Ga0495643_0206625 3300046522 Bacteria 939
326 Ga0495644_0147466 3300046523 Bacteria 900
327 Ga0495648_0002288 3300046524 Bacteria 17871
328 Ga0495648_0137128 3300046524 Bacteria 1292
329 Ga0495663_0065355 3300046525 Bacteria 1149
330 Ga0495663_0071665 3300046525 Bacteria 1104
331 Ga0495642_0013507 3300046528 Bacteria 3159
332 Ga0495654_0006712 3300046530 Bacteria 6511
333 Ga0495609_0030354 3300046538 Bacteria 2460
334 Ga0495597_0013809 3300046542 Bacteria 3860
335 Ga0495597_0033708 3300046542 Bacteria 2317
336 Ga0495597_0043806 3300046542 Bacteria 1991
337 Ga0495622_0002985 3300046557 Bacteria 8042
338 Ga0495633_0080184 3300046558 Bacteria 1519
339 Ga0495668_0001818 3300046616 Bacteria 19364
340 Ga0495668_0019185 3300046616 Bacteria 3945
341 Ga0495668_0050196 3300046616 Bacteria 2312
342 Ga0495668_0098794 3300046616 Bacteria 1597
343 Ga0495668_0213466 3300046616 Bacteria 1056
344 Ga0495611_0077613 3300046648 Bacteria 1523
345 Ga0495625_0001925 3300046660 Bacteria 23466
346 Ga0495625_0058314 3300046660 Bacteria 2743
347 Ga0495625_0083154 3300046660 Bacteria 2225
348 Ga0495625_0210534 3300046660 Bacteria 1278
349 Ga0495661_0138934 3300046665 Bacteria 1324
350 Ga0495669_0000044 3300046684 Bacteria 85633
351 Ga0495669_0000371 3300046684 Bacteria 22866
352 Ga0495669_0021716 3300046684 Bacteria 2789
353 Ga0495669_0036871 3300046684 Bacteria 2162
354 Ga0495613_0000576 3300046689 Bacteria 29823
355 Ga0495670_0117572 3300046691 Bacteria 1380
356 Ga0495670_0168018 3300046691 Bacteria 1154
357 Ga0495649_0131040 3300046694 Bacteria 1323
358 Ga0495589_0034715 3300046794 Bacteria 2530
359 Ga0495636_0026912 3300047318 Bacteria 2341
360 Ga0495672_0000439 3300047320 Bacteria 49666
361 Ga0495672_0094949 3300047320 Bacteria 1629
362 Ga0495683_0011199 3300047323 Bacteria 4727
363 Ga0495687_080693 3300047443 Bacteria 1275
364 Ga0495677_0023144 3300047445 Bacteria 2255
365 Ga0495677_0041039 3300047445 Bacteria 1692
366 Ga0495679_006048 3300047446 Bacteria 5288
367 Ga0495673_0000189 3300047469 Bacteria 99018
368 Ga0495673_0155445 3300047469 Bacteria 881
369 Ga0495681_0064653 3300047470 Bacteria 1674
370 Ga0495686_0007469 3300047472 Bacteria 8189
371 Ga0495686_0026646 3300047472 Bacteria 3781
372 Ga0495686_0070592 3300047472 Bacteria 2152
373 Ga0495686_0184807 3300047472 Bacteria 1205
374 Ga0495593_0029058 3300047673 Bacteria 3034
375 Ga0496103_0131457 3300048906 Bacteria 1598
376 Ga0496103_0177218 3300048906 Bacteria 1370
377 Ga0496105_0090149 3300048908 Bacteria 2533
378 Ga0496106_0006912 3300048909 Bacteria 8394
379 Ga0496106_0180175 3300048909 Bacteria 1677
380 Ga0496107_0000073 3300048910 Bacteria 48489
381 Ga0496107_0146752 3300048910 Bacteria 1745
382 Ga0496109_0134272 3300048912 Bacteria 2311
383 Ga0496112_0020616 3300048915 Bacteria 6250
384 Ga0496112_0037337 3300048915 Bacteria 4742
385 Ga0496113_0515605 3300048916 Bacteria 960
386 Ga0496114_0245251 3300048917 Bacteria 1576
387 Ga0496115_0021048 3300048918 Bacteria 5033
388 Ga0496115_0049703 3300048918 Bacteria 3357
389 Ga0496115_0354921 3300048918 Bacteria 1195
390 Ga0496115_0614869 3300048918 Bacteria 862
391 Ga0496116_0134067 3300048919 Bacteria 1406
392 Ga0496117_0020336 3300048920 Bacteria 5413
393 Ga0496118_0014068 3300048921 Bacteria 7511
394 Ga0496118_0293978 3300048921 Bacteria 896
395 Ga0496119_0041993 3300048922 Bacteria 2905
396 Ga0496121_0000946 3300048924 Bacteria 52586
397 Ga0496121_0025980 3300048924 Bacteria 5537
398 Ga0496121_0242092 3300048924 Bacteria 1256
399 Ga0496125_0023733 3300048928 Bacteria 5655
400 Ga0496125_0059294 3300048928 Bacteria 3085
401 Ga0501341_02423 3300049131 Bacteria 1008
402 Ga0495678_001705 3300049459 Bacteria 16503
403 Ga0495682_0062724 3300049460 Bacteria 1341
404 Ga0501311_018176 3300049527 Bacteria 932
405 Ga0501312_008613 3300049528 Bacteria 1328
406 Ga0501313_015433 3300049529 Bacteria 911
407 Ga0501313_024125 3300049529 Bacteria 765
408 Ga0501316_018267 3300049532 Bacteria 865
409 Ga0501319_000756 3300049535 Bacteria 1660
410 Ga0501319_005224 3300049535 Bacteria 926
411 Ga0501320_011731 3300049536 Bacteria 912
412 Ga0501321_006939 3300049537 Bacteria 1165
413 Ga0501323_002237 3300049539 Bacteria 1852
414 Ga0501324_002768 3300049540 Bacteria 1297
415 Ga0501325_003636 3300049541 Bacteria 1136
416 Ga0501032_0097203 3300049569 Bacteria 1952
417 Ga0501032_0316542 3300049569 Bacteria 1008
418 Ga0501033_0109003 3300049570 Bacteria 2017
419 Ga0501033_0121202 3300049570 Bacteria 1898
420 Ga0501034_0000482 3300049571 Bacteria 65380
421 Ga0501034_0077264 3300049571 Bacteria 3335
422 Ga0501037_0132584 3300049573 Bacteria 1786
423 Ga0501039_0195868 3300049575 Bacteria 1589
424 Ga0501041_0093540 3300049577 Bacteria 1857
425 Ga0501043_0233205 3300049579 Bacteria 1421
426 Ga0501047_0021902 3300049581 Bacteria 6136
427 Ga0501047_0199368 3300049581 Bacteria 1863
428 Ga0501047_0569577 3300049581 Bacteria 956
429 Ga0501070_0063354 3300049586 Bacteria 3063
430 Ga0501071_0320492 3300049587 Bacteria 1177
431 Ga0501238_000524 3300049671 Bacteria 4389
432 Ga0501257_016026 3300049686 Bacteria 1735
433 Ga0501083_0314903 3300049744 Bacteria 1018
434 Ga0501280_046869 3300049776 Bacteria 716
435 Ga0501044_0032239 3300049823 Bacteria 5509
436 Ga0501045_0324855 3300049824 Bacteria 1145
437 nmdc:mga03n38_123713_c1 3300050490 Bacteria 1274
438 nmdc:mga00v17_4550_c1 3300050491 Bacteria 7225
439 nmdc:mga0k408_174832_c1 3300050493 Bacteria 1280
440 nmdc:mga0k408_62374_c1 3300050493 Bacteria 2168
441 nmdc:mga06z11_319018_c1 3300050494 Bacteria 926
442 nmdc:mga06z11_6498_c1 3300050494 Bacteria 4762
443 nmdc:mga04h51_7138_c1 3300050495 Bacteria 2935
444 nmdc:mga07m45_250452_c1 3300050496 Bacteria 1031
445 nmdc:mga07m45_45178_c1 3300050496 Bacteria 2473
446 nmdc:mga07m45_57184_c1 3300050496 Bacteria 2205
447 nmdc:mga07m45_60756_c1 3300050496 Bacteria 2140
448 Ga0495601_0153663 3300053077 Bacteria 1503
449 Ga0495612_0033758 3300053078 Bacteria 2071
450 Ga0500635_0000205 3300053080 Bacteria 29287
451 Ga0500578_0000459 3300053086 Bacteria 49572
452 Ga0500643_003760 3300053087 Bacteria 7124
453 Ga0500643_013812 3300053087 Bacteria 2832
454 Ga0500643_022575 3300053087 Bacteria 2023
455 Ga0500643_029867 3300053087 Bacteria 1673
456 Ga0500644_0000193 3300053088 Bacteria 37831
457 Ga0500646_0077311 3300053090 Bacteria 1009
458 Ga0500647_0049633 3300053091 Bacteria 2018
459 Ga0500583_0061517 3300053092 Bacteria 1773
460 Ga0500651_0003210 3300053093 Bacteria 8883
461 Ga0500566_0015189 3300053094 Bacteria 4518
462 Ga0500566_0198852 3300053094 Bacteria 1014
463 Ga0500641_0002284 3300053096 Bacteria 6803
464 Ga0500641_0002384 3300053096 Bacteria 6663
465 Ga0500641_0003388 3300053096 Bacteria 5637
466 Ga0500641_0046486 3300053096 Bacteria 1772
467 Ga0500650_0035877 3300053098 Bacteria 2274
468 Ga0500554_000324 3300053102 Bacteria 10286
469 Ga0500555_001699 3300053103 Bacteria 6625
470 Ga0500556_0001068 3300053104 Bacteria 14047
471 Ga0500556_0027981 3300053104 Bacteria 1888
472 Ga0500556_0083999 3300053104 Bacteria 1207
473 Ga0500562_000644 3300053108 Bacteria 8433
474 Ga0500562_004084 3300053108 Bacteria 3679
475 Ga0500569_000322 3300053109 Bacteria 7683
476 Ga0500572_066175 3300053111 Bacteria 1108
477 Ga0500593_106042 3300053117 Bacteria 1164
478 Ga0500594_0000153 3300053118 Bacteria 18197
479 Ga0500595_001651 3300053119 Bacteria 11721
480 Ga0500595_007692 3300053119 Bacteria 4456
481 Ga0500607_051245 3300053121 Bacteria 2195
482 Ga0500608_000165 3300053122 Bacteria 27378
483 Ga0500608_004302 3300053122 Bacteria 5487
484 Ga0500608_117892 3300053122 Bacteria 1208
485 Ga0500614_000617 3300053123 Bacteria 9057
486 Ga0500614_054013 3300053123 Bacteria 1063
487 Ga0500618_000703 3300053125 Bacteria 19670
488 Ga0500628_108157 3300053129 Bacteria 743
489 Ga0500652_102870 3300053131 Bacteria 1194
490 Ga0500655_020777 3300053133 Bacteria 1228
491 Ga0500658_0001787 3300053134 Bacteria 8487
492 Ga0500559_0000113 3300053136 Bacteria 63512
493 Ga0500559_0001398 3300053136 Bacteria 13721
494 Ga0500559_0016148 3300053136 Bacteria 3152
495 Ga0500564_000145 3300053138 Bacteria 18335
496 Ga0500568_0044246 3300053139 Bacteria 1777
497 Ga0500590_085514 3300053148 Bacteria 1540
498 Ga0500603_003920 3300053150 Bacteria 3184
499 Ga0500616_0081933 3300053153 Bacteria 1619
500 Ga0500620_060729 3300053155 Bacteria 1286
501 Ga0500622_0000771 3300053156 Bacteria 27846
502 Ga0500622_0002771 3300053156 Bacteria 12332
503 Ga0500622_0003985 3300053156 Bacteria 9528
504 Ga0500624_001098 3300053157 Bacteria 5109
505 Ga0500627_0046520 3300053158 Bacteria 1880
506 Ga0500636_0123722 3300053177 Bacteria 1448
507 Ga0500637_0061953 3300053178 Bacteria 2143
508 Ga0500576_091809 3300053725 Bacteria 1259
509 Ga0500625_102172 3300053729 Bacteria 1199
510 Ga0500645_005399 3300053730 Bacteria 4711
511 Ga0500645_009863 3300053730 Bacteria 3189
512 Ga0500645_030083 3300053730 Bacteria 1636
513 Ga0500645_038787 3300053730 Bacteria 1412
514 Ga0500609_000093 3300053731 Bacteria 11592
515 Ga0500596_000363 3300053735 Bacteria 8223
516 Ga0500601_003237 3300053737 Bacteria 1765
517 Ga0500661_020169 3300055283 Bacteria 1185
518 Ga0587070_002120 3300059491 Bacteria 2195
519 Ga0587070_072604 3300059491 Bacteria 737
520 Ga0587082_018665 3300059504 Bacteria 1106
521 Ga0587090_001712 3300059510 Bacteria 2275
522 Ga0587092_012557 3300059512 Bacteria 1197
523 Ga0587101_008635 3300059623 Bacteria 1237
524 Ga0587076_030912 3300059645 Bacteria 948
525 Ga0587079_005405 3300059647 Bacteria 1805
526 2511120810 2510917020 Bacteria 5657507
527 2585150050 2582581279 Bacteria 4980720
528 2585155427 2582581280 Bacteria 5994497
529 2585199211 2582581293 Bacteria 5907401
530 2587919505 2585428106 Bacteria 5179711
531 2643747995 2643221545 Bacteria 5083237
532 2643781708 2643221552 Bacteria 5708754
533 2643926357 2643221583 Bacteria 5218014
534 2643931648 2643221584 Bacteria 5511711
535 2643997884 2643221598 Bacteria 4578346
536 2644088878 2643221614 Bacteria 4260023
537 2644226564 2643221640 Bacteria 5258820
538 2644236052 2643221642 Bacteria 5357871
539 2644342240 2643221661 Bacteria 4267604
540 2644369623 2643221666 Bacteria 4265935
541 2644507902 2643221691 Bacteria 5093099
542 2739792097 2739367756 Bacteria 4553612
543 2792463711 2791355048 Bacteria 5832535
544 2819536864 2818991435 Bacteria 5433759
545 2819646025 2818991454 Bacteria 5563326
546 2840883971 2840878972 Bacteria 5483153
547 2843747085 2843744320 Bacteria 5659202
548 2849560624 2849560528 Bacteria 5393480
549 2849578465 2849573788 Bacteria 5421256
550 2851154292 2851153111 Bacteria 5542585
551 2854685319 2854681122 Bacteria 4548679
552 2857509517 2857504554 Bacteria 5369913
553 2884961095 2884960567 Bacteria 5437054
554 2898331304 2898329390 Bacteria 5168154
555 2898796997 2898795034 Bacteria 4294459
556 2899262500 2899259804 Bacteria 3320927
557 2928535754 2928531327 Bacteria 5101314
558 2941486936 2941485952 Bacteria 3591484
559 3000019217 3000017691 Bacteria 3772574
560 JGI25153J46596_10020623
561 Ga0032354_1009883
562 Ga0032354_1036765
563 Ga0055537_1004503
564 Ga0055524_1019052
565 Ga0055528_1007701
566 Ga0055530_10004523
567 Ga0055530_10022053
568 Ga0055531_10023544
569 Ga0055531_10029209
570 Ga0065165_1002762
571 Ga0065165_1007044
572 Ga0070676_10327453
573 Ga0070683_100461961
574 Ga0070670_100000958
575 Ga0070670_100063759
576 Ga0070670_100528860
577 Ga0068869_100511504
578 Ga0070666_10288826
579 Ga0070666_10304828
580 Ga0070666_10323942
581 Ga0070660_100140471
582 Ga0070691_10004797
583 Ga0070668_100002473
584 Ga0070668_100018845
585 Ga0070669_100019075
586 Ga0070671_100001396
587 Ga0070671_100308137
588 Ga0070673_100051075
589 Ga0070659_100074275
590 Ga0070659_100174117
591 Ga0070667_100026034
592 Ga0070713_101138790
593 Ga0070678_100198955
594 Ga0070662_100432256
595 Ga0070681_10068278
596 Ga0070681_10099585
597 Ga0068853_100233197
598 Ga0068853_100399888
599 Ga0070665_100055537
600 Ga0070665_100063485
601 Ga0070665_100076823
602 Ga0070665_100182043
603 Ga0068855_100722076
604 Ga0068855_100853769
605 Ga0070664_100036245
606 Ga0068854_100283607
607 Ga0068854_100496692
608 Ga0068856_100221172
609 Ga0068856_100667723
610 Ga0068856_101011214
611 Ga0068859_100268032
612 Ga0068864_100043582
613 Ga0068866_10385722
614 Ga0068861_100060108
615 Ga0068851_10283195
616 Ga0068863_100045890
617 Ga0068863_100064635
618 Ga0068858_100050547
619 Ga0068858_100524477
620 Ga0068860_100001684
621 Ga0068860_100022119
622 Ga0068862_100028223
623 Ga0068862_100305543
624 Ga0075368_10008167
625 Ga0075363_100047678
626 Ga0075363_100103319
627 Ga0075363_100438543
628 Ga0075364_10001038
629 Ga0075367_10001012
630 Ga0075369_10010071
631 Ga0075366_10059395
632 Ga0075366_10115902
633 Ga0075366_10127469
634 Ga0075366_10355356
635 Ga0075366_10571149
636 Ga0075370_10027150
637 Ga0075370_10202409
638 Ga0068865_100013511
639 Ga0097620_100268025
640 Ga0105240_10000798
641 Ga0105240_10230206
642 Ga0105240_10335083
643 Ga0105240_10386595
644 Ga0105240_10406436
645 Ga0105240_10524597
646 Ga0105245_10635073
647 Ga0105243_11099686
648 Ga0105241_10051142
649 Ga0105242_10218000
650 Ga0105248_10008835
651 Ga0105248_10259890
652 Ga0105248_10382456
653 Ga0105248_11214471
654 Ga0105238_10232374
655 Ga0105238_10593494
656 Ga0105249_10041843
657 Ga0105249_10257956
658 Ga0105239_10294484
659 Ga0105239_10652689
660 Ga0105246_10521316
661 Ga0157373_10136423
662 Ga0157370_10114023
663 Ga0157369_10018315
664 Ga0157369_10406132
665 Ga0157374_10493874
666 Ga0157374_10986379
667 Ga0157378_10653213
668 Ga0163162_10080358
669 Ga0157372_10364270
670 Ga0157375_10429715
671 Ga0163163_10009581
672 Ga0163163_10439545
673 Ga0157380_10548407
674 Ga0182008_10084129
675 Ga0157379_10041021
676 Ga0157379_10898562
677 Ga0182007_10037419
678 Ga0213872_10005913
679 Ga0213876_10000244
680 Ga0209673_1001876
681 Ga0209676_1022325
682 Ga0209564_1007568
683 Ga0209758_1002168
684 Ga0209758_1023594
685 Ga0209050_1000161
686 Ga0209050_1019693
687 Ga0209256_1003893
688 Ga0209051_1000877
689 Ga0209257_1000252
690 Ga0209257_1000976
691 Ga0209257_1008377
692 Ga0209257_1010622
693 Ga0207656_10099352
694 Ga0207680_10043744
695 Ga0207680_10057755
696 Ga0207645_10029047
697 Ga0207643_10064023
698 Ga0207705_10018153
699 Ga0207654_10077845
700 Ga0207707_10183495
701 Ga0207695_10000575
702 Ga0207695_10010884
703 Ga0207695_10273409
704 Ga0207695_10372193
705 Ga0207671_10217066
706 Ga0207660_10000537
707 Ga0207660_10193464
708 Ga0207649_10107742
709 Ga0207649_10355036
710 Ga0207652_10002134
711 Ga0207681_10164779
712 Ga0207694_10228390
713 Ga0207694_10244076
714 Ga0207650_10000883
715 Ga0207650_10051081
716 Ga0207700_10184548
717 Ga0207644_10019776
718 Ga0207644_10035600
719 Ga0207690_10018048
720 Ga0207690_10175415
721 Ga0207706_10019813
722 Ga0207706_10561516
723 Ga0207711_10001469
724 Ga0207711_10112712
725 Ga0207711_10245260
726 Ga0207689_10604496
727 Ga0207679_10207149
728 Ga0207667_10166618
729 Ga0207667_10259986
730 Ga0207667_10906985
731 Ga0207651_10395513
732 Ga0207712_10002131
733 Ga0207668_10000363
734 Ga0207668_10000571
735 Ga0207668_10037129
736 Ga0207668_10037130
737 Ga0207640_10178996
738 Ga0207640_10410162
739 Ga0207658_10001253
740 Ga0207658_10012581
741 Ga0207677_10475628
742 Ga0207703_10013988
743 Ga0207703_10086143
744 Ga0207703_10464885
745 Ga0207639_10053240
746 Ga0207678_10183294
747 Ga0207702_10266138
748 Ga0207702_10348651
749 Ga0207648_10273356
750 Ga0207676_10010270
751 Ga0207674_10336853
752 Ga0207675_100039241
753 Ga0209981_1000276
754 Ga0210000_1022595
755 Ga0209999_1001058
756 Ga0209983_1005860
757 Ga0209813_10061568
758 Ga0268266_10000311
759 Ga0268266_10023680
760 Ga0268266_10040775
761 Ga0268266_10053859
762 Ga0268266_10077149
763 Ga0268265_10004022
764 Ga0268265_10695882
765 Ga0268264_10000383
766 Ga0268264_10002325
767 Ga0268264_10072664
768 Ga0265326_10027785
769 Ga0265334_10006043
770 Ga0307517_10130623
771 Ga0265338_10019380
772 Ga0265338_10048593
773 Ga0265338_10442167
774 Ga0265324_10119872
775 Ga0307511_10006537
776 Ga0307512_10169625
777 Ga0265327_10000381
778 Ga0265327_10007046
779 Ga0265327_10042304
780 Ga0265327_10055621
781 Ga0307513_10000162
782 Ga0307513_10010515
783 Ga0307513_10016219
784 Ga0307513_10198590
785 Ga0265314_10053314
786 Ga0265314_10083091
787 Ga0265314_10183534
788 Ga0307516_10001565
789 Ga0307413_10002271
790 Ga0307406_10115754
791 Ga0307416_100235587
792 Ga0307411_10055871
793 Ga0316583_10029332
794 Ga0316593_10019819
795 Ga0316593_10029449
796 Ga0307510_10078548
797 Ga0316596_1076669
798 Ga0373926_0062463
799 Ga0373923_0172448
800 Ga0373946_0016115
801 Ga0373931_0114957
802 Ga0373927_0000479
803 Ga0373927_0165324
804 Ga0373947_0084504
805 Ga0373937_0407622
806 Ga0373925_0000023
807 Ga0373925_0175832
808 Ga0395899_0001195
809 Ga0395899_0322286
810 Ga0395900_0006999
811 Ga0395900_0130918
812 Ga0395900_0250561
813 Ga0395898_0004322
814 Ga0395898_0071967
815 Ga0395898_0118241
816 Ga0395905_0006270
817 Ga0395905_0012867
818 Ga0395905_0055624
819 Ga0395905_0079876
820 Ga0395905_0096583
821 Ga0436364_0059029
822 Ga0436364_0151535
823 Ga0395901_0000342
824 Ga0395901_0140376
825 Ga0400483_014056
826 Ga0400483_052325
827 Ga0400483_169471
828 Ga0400483_187305
829 Ga0436365_0376847
830 Ga0436365_1891356
831 Ga0436365_1905157
832 Ga0436360_0164499
833 Ga0436360_0409977
834 Ga0436360_0551958
835 Ga0436360_0905641
836 Ga0436361_0100802
837 Ga0436361_0953537
838 Ga0436363_0347296
839 Ga0436363_0411020
840 Ga0436363_0944849
841 Ga0436363_1544180
842 Ga0436362_0858043
843 Ga0439461_0048469
844 Ga0451793_0183211
845 Ga0451843_1158826
846 Ga0439437_004749
847 Ga0439442_014552
848 Ga0439445_0007571
849 Ga0439432_034018
850 Ga0439449_0064267
851 Ga0450890_010332
852 Ga0439446_0066307
853 Ga0439446_0110932
854 Ga0439459_0000576
855 Ga0450916_000234
856 Ga0450893_0006119
857 Ga0466961_0106082
858 Ga0453684_0534082
859 Ga0466970_0057669
860 Ga0451576_0043660
861 Ga0451576_0628970
862 Ga0495627_000399
863 Ga0495592_0250504
864 Ga0495590_0000851
865 Ga0495629_0018598
866 Ga0495650_0001571
867 Ga0495584_0192109
868 Ga0495585_0057569
869 Ga0495585_0205759
870 Ga0495607_0207421
871 Ga0495583_0000650
872 Ga0495606_0013477
873 Ga0495606_0067825
874 Ga0495606_0137467
875 Ga0495606_0151705
876 Ga0495610_0013510
877 Ga0495610_0026700
878 Ga0495616_0069112
879 Ga0495620_0013485
880 Ga0495631_0019391
881 Ga0495632_0004552
882 Ga0495637_0016956
883 Ga0495643_0002864
884 Ga0495643_0206625
885 Ga0495644_0147466
886 Ga0495648_0002288
887 Ga0495648_0137128
888 Ga0495663_0065355
889 Ga0495663_0071665
890 Ga0495642_0013507
891 Ga0495654_0006712
892 Ga0495609_0030354
893 Ga0495597_0013809
894 Ga0495597_0033708
895 Ga0495597_0043806
896 Ga0495622_0002985
897 Ga0495633_0080184
898 Ga0495668_0001818
899 Ga0495668_0019185
900 Ga0495668_0050196
901 Ga0495668_0098794
902 Ga0495668_0213466
903 Ga0495611_0077613
904 Ga0495625_0001925
905 Ga0495625_0058314
906 Ga0495625_0083154
907 Ga0495625_0210534
908 Ga0495661_0138934
909 Ga0495669_0000044
910 Ga0495669_0000371
911 Ga0495669_0021716
912 Ga0495669_0036871
913 Ga0495613_0000576
914 Ga0495670_0117572
915 Ga0495670_0168018
916 Ga0495649_0131040
917 Ga0495589_0034715
918 Ga0495636_0026912
919 Ga0495672_0000439
920 Ga0495672_0094949
921 Ga0495683_0011199
922 Ga0495687_080693
923 Ga0495677_0023144
924 Ga0495677_0041039
925 Ga0495679_006048
926 Ga0495673_0000189
927 Ga0495673_0155445
928 Ga0495681_0064653
929 Ga0495686_0007469
930 Ga0495686_0026646
931 Ga0495686_0070592
932 Ga0495686_0184807
933 Ga0495593_0029058
934 Ga0496103_0131457
935 Ga0496103_0177218
936 Ga0496105_0090149
937 Ga0496106_0006912
938 Ga0496106_0180175
939 Ga0496107_0000073
940 Ga0496107_0146752
941 Ga0496109_0134272
942 Ga0496112_0020616
943 Ga0496112_0037337
944 Ga0496113_0515605
945 Ga0496114_0245251
946 Ga0496115_0021048
947 Ga0496115_0049703
948 Ga0496115_0354921
949 Ga0496115_0614869
950 Ga0496116_0134067
951 Ga0496117_0020336
952 Ga0496118_0014068
953 Ga0496118_0293978
954 Ga0496119_0041993
955 Ga0496121_0000946
956 Ga0496121_0025980
957 Ga0496121_0242092
958 Ga0496125_0023733
959 Ga0496125_0059294
960 Ga0501341_02423
961 Ga0495678_001705
962 Ga0495682_0062724
963 Ga0501311_018176
964 Ga0501312_008613
965 Ga0501313_015433
966 Ga0501313_024125
967 Ga0501316_018267
968 Ga0501319_000756
969 Ga0501319_005224
970 Ga0501320_011731
971 Ga0501321_006939
972 Ga0501323_002237
973 Ga0501324_002768
974 Ga0501325_003636
975 Ga0501032_0097203
976 Ga0501032_0316542
977 Ga0501033_0109003
978 Ga0501033_0121202
979 Ga0501034_0000482
980 Ga0501034_0077264
981 Ga0501037_0132584
982 Ga0501039_0195868
983 Ga0501041_0093540
984 Ga0501043_0233205
985 Ga0501047_0021902
986 Ga0501047_0199368
987 Ga0501047_0569577
988 Ga0501070_0063354
989 Ga0501071_0320492
990 Ga0501238_000524
991 Ga0501257_016026
992 Ga0501083_0314903
993 Ga0501280_046869
994 Ga0501044_0032239
995 Ga0501045_0324855
996 nmdc:mga03n38_123713_c1
997 nmdc:mga00v17_4550_c1
998 nmdc:mga0k408_174832_c1
999 nmdc:mga0k408_62374_c1
1000 nmdc:mga06z11_319018_c1
1001 nmdc:mga06z11_6498_c1
1002 nmdc:mga04h51_7138_c1
1003 nmdc:mga07m45_250452_c1
1004 nmdc:mga07m45_45178_c1
1005 nmdc:mga07m45_57184_c1
1006 nmdc:mga07m45_60756_c1
1007 Ga0495601_0153663
1008 Ga0495612_0033758
1009 Ga0500635_0000205
1010 Ga0500578_0000459
1011 Ga0500643_003760
1012 Ga0500643_013812
1013 Ga0500643_022575
1014 Ga0500643_029867
1015 Ga0500644_0000193
1016 Ga0500646_0077311
1017 Ga0500647_0049633
1018 Ga0500583_0061517
1019 Ga0500651_0003210
1020 Ga0500566_0015189
1021 Ga0500566_0198852
1022 Ga0500641_0002284
1023 Ga0500641_0002384
1024 Ga0500641_0003388
1025 Ga0500641_0046486
1026 Ga0500650_0035877
1027 Ga0500554_000324
1028 Ga0500555_001699
1029 Ga0500556_0001068
1030 Ga0500556_0027981
1031 Ga0500556_0083999
1032 Ga0500562_000644
1033 Ga0500562_004084
1034 Ga0500569_000322
1035 Ga0500572_066175
1036 Ga0500593_106042
1037 Ga0500594_0000153
1038 Ga0500595_001651
1039 Ga0500595_007692
1040 Ga0500607_051245
1041 Ga0500608_000165
1042 Ga0500608_004302
1043 Ga0500608_117892
1044 Ga0500614_000617
1045 Ga0500614_054013
1046 Ga0500618_000703
1047 Ga0500628_108157
1048 Ga0500652_102870
1049 Ga0500655_020777
1050 Ga0500658_0001787
1051 Ga0500559_0000113
1052 Ga0500559_0001398
1053 Ga0500559_0016148
1054 Ga0500564_000145
1055 Ga0500568_0044246
1056 Ga0500590_085514
1057 Ga0500603_003920
1058 Ga0500616_0081933
1059 Ga0500620_060729
1060 Ga0500622_0000771
1061 Ga0500622_0002771
1062 Ga0500622_0003985
1063 Ga0500624_001098
1064 Ga0500627_0046520
1065 Ga0500636_0123722
1066 Ga0500637_0061953
1067 Ga0500576_091809
1068 Ga0500625_102172
1069 Ga0500645_005399
1070 Ga0500645_009863
1071 Ga0500645_030083
1072 Ga0500645_038787
1073 Ga0500609_000093
1074 Ga0500596_000363
1075 Ga0500601_003237
1076 Ga0500661_020169
1077 Ga0587070_002120
1078 Ga0587070_072604
1079 Ga0587082_018665
1080 Ga0587090_001712
1081 Ga0587092_012557
1082 Ga0587101_008635
1083 Ga0587076_030912
1084 Ga0587079_005405
1085 2511120810
1086 2585150050
1087 2585155427
1088 2585199211
1089 2587919505
1090 2643747995
1091 2643781708
1092 2643926357
1093 2643931648
1094 2643997884
1095 2644088878
1096 2644226564
1097 2644236052
1098 2644342240
1099 2644369623
1100 2644507902
1101 2739792097
1102 2792463711
1103 2819536864
1104 2819646025
1105 2840883971
1106 2843747085
1107 2849560624
1108 2849578465
1109 2851154292
1110 2854685319
1111 2857509517
1112 2884961095
1113 2898331304
1114 2898796997
1115 2899262500
1116 2928535754
1117 2941486936
1118 3000019217

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

16

205

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8907 13 203
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8783 3 203
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8626 3 203
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8616 3 203
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8464 3 203
ID Description Score Start End Superfamily
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7883 1 203 3.40.1370.10
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7753 1 203 3.40.1370.10
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7497 1 203 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7493 1 203 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7392 1 203 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A434FBH1-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9843 108 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A258B788-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9764 127 205 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A537R4I8-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9646 108 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A529VK89-F1-model_v4 deleted 0.9551 90 203
AF-A0A356NL58-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9471 98 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map