F463526

General Info

Members Datasets Scaffolds Average Seq Length
559 359 1118 405

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1007129|Ga0055524_10071294
Length 452
Sequence LSETDGSGPFDQQDLNVGDLVRVGANQQFALPPVDKPVMRTAQRPYKNLINGSAGCAGLDVQMDTVQVLPGSVLRHPGYLNFAASRVLSSLSFQCIAIAMGWMIYDQTHSAFALALVGLCQFLPMVVLTFIVGHVADRYDRRRIGLVCQLIEAATSLSLAIATWQQWLTPAGILVAVTILGATAAFERPTMAALLPNIVPELMLQRAVATTTSMQQTAFIVGPSLGGLLYGVDPVAPFAVAAVFFAVASVNVISIRMQWRPAKREPVTLTSIFAGVSFIRSRPVVLGTISLDLFAVLLGGATALLPMFARDILHAGPWGLGLLRAAPAIGALAMSIVLARRPLRSSVGIKMLAAVAVFGAATVVFSLSTNIALSVCALLVVGASDTVSVVVRSSLVQLLTPDEMRGRVNAVNSLFIGTSNQLGEFEGVGTIAIVLMWTRLFPELAKVRTLKG

Samples

Sample ID Description Type Environment
1 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
54 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
119 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
194 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
203 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
204 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
207 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
208 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
209 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
210 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
211 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
212 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
213 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
214 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
215 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
216 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
217 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
218 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
219 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
220 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
221 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
222 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
223 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
224 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
225 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
226 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
227 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
228 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
229 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
230 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
231 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
232 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
233 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
234 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
235 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
236 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
237 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
238 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
239 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
240 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
241 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
242 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
243 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
244 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
245 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
246 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
247 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
248 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
249 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
250 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
251 2643221569 Achromobacter sp. Root565 Isolate Unclassified
252 2643221594 Achromobacter sp. Root170 Isolate Unclassified
253 2643221599 Rhizobium sp. Root708 Isolate Unclassified
254 2643221621 Achromobacter sp. Root83 Isolate Unclassified
255 2643221629 Devosia sp. Root105 Isolate Unclassified
256 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
257 2643221662 Devosia sp. Root413D1 Isolate Unclassified
258 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
259 2718217927 Rhizobium sp. N324 Isolate Nodule
260 2718218423 Rhizobium sp. N941 Isolate Nodule
261 2721755809 Rhizobium sp. N541 Isolate Nodule
262 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
263 2738541293 Rhizobium sp. GV031 Isolate Unclassified
264 2738541307 Variovorax sp. GV008 Isolate Unclassified
265 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
266 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
267 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
268 2791355261 Rhizobium sp. J15 Isolate Nodule
269 2791355266 Rhizobium sp. L43 Isolate Nodule
270 2791355267 Rhizobium sp. L18 Isolate Nodule
271 2802429633 Rhizobium anhuiense J3 Isolate Nodule
272 2802429634 Rhizobium anhuiense S10 Isolate Nodule
273 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
274 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
275 2802429637 Rhizobium anhuiense C15 Isolate Nodule
276 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
277 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
278 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
279 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
280 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
281 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
282 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
283 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
284 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
285 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
286 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
287 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
288 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
289 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
290 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
291 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
292 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
293 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
294 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
295 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
296 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
297 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
298 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
299 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
300 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
301 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
302 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
303 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
304 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
305 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
306 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
307 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
308 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
309 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
310 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
311 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
312 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
313 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
314 2842733646 Variovorax sp. R-72446 Isolate Unclassified
315 2842747753 Variovorax sp. R-72060 Isolate Unclassified
316 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
317 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
318 2855730933 Achromobacter sp. HZ28 Isolate Nodule
319 2855767633 Achromobacter sp. HZ34 Isolate Nodule
320 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
321 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
322 2858950400 Achromobacter sp. K91 Isolate Unclassified
323 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
324 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
325 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
326 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
327 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
328 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
329 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
330 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
331 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
332 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
333 2936381700 Rhizobium chutanense C16 Isolate Unclassified
334 2941479691
335 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
336 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
337 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
338 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
339 8005275841 Rhizobium sp. N4311 Isolate Nodule
340 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
341 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
342 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
343 8005382845 Rhizobium sp. R634 Isolate Nodule
344 8005395548 Rhizobium sp. R339 Isolate Nodule
345 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
346 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
347 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
348 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
349 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
350 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
351 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
352 8018176218 Rhizobium sp. N122 Isolate Nodule
353 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
354 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
355 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
356 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
357 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
358 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
359 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.45
Metatranscriptomes 0
Isolates 27.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.37
Nodule 16.99
Rhizoplane 2.33
Rhizosphere 33.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1007129 3300003775 Bacteria 4787
2 JGI24740J21852_10000010 3300001979 Bacteria 72485
3 JGI25155J39150_1000044 3300002704 Bacteria 86149
4 JGI25156J39149_1000058 3300002705 Bacteria 86233
5 JGI25162J39368_1000143 3300002737 Bacteria 77302
6 JGI25154J39366_1000174 3300002738 Bacteria 49957
7 JGI25158J39367_1000123 3300002739 Bacteria 18001
8 JGI25157J39369_1000078 3300002741 Bacteria 86233
9 JGI25152J39213_1000462 3300002773 Bacteria 23651
10 JGI25152J39213_1001551 3300002773 Bacteria 9751
11 JGI25152J39213_1001673 3300002773 Bacteria 9195
12 JGI25152J39213_1002597 3300002773 Bacteria 6735
13 JGI25152J39213_1002911 3300002773 Bacteria 6107
14 JGI25152J39213_1010426 3300002773 Bacteria 2126
15 JGI25152J39213_1011332 3300002773 Bacteria 1978
16 JGI25150J39212_1000047 3300002774 Bacteria 75103
17 JGI25150J39212_1000084 3300002774 Bacteria 55774
18 JGI25150J39212_1000085 3300002774 Bacteria 55053
19 JGI25159J45721_1000756 3300002987 Bacteria 14014
20 JGI25159J45721_1001008 3300002987 Bacteria 12127
21 JGI25151J46595_10000126 3300003187 Bacteria 103193
22 JGI25151J46595_10000190 3300003187 Bacteria 75765
23 JGI25151J46595_10002195 3300003187 Bacteria 12080
24 JGI25151J46595_10003188 3300003187 Bacteria 9195
25 JGI25151J46595_10014212 3300003187 Bacteria 3555
26 JGI25165J46597_1000356 3300003214 Bacteria 51368
27 JGI25165J46597_1000500 3300003214 Bacteria 37811
28 JGI25165J46597_1003573 3300003214 Bacteria 3782
29 JGI25153J46596_10001341 3300003215 Bacteria 14724
30 JGI25153J46596_10002046 3300003215 Bacteria 11886
31 JGI25153J46596_10003206 3300003215 Bacteria 9195
32 JGI25153J46596_10003219 3300003215 Bacteria 9174
33 JGI25153J46596_10027728 3300003215 Bacteria 1978
34 rootH1_10069601 3300003316 Bacteria 5388
35 rootH2_10059318 3300003320 Bacteria 5218
36 rootL2_10006456 3300003322 Bacteria 7179
37 JGI25160J50197_1000001 3300003354 Bacteria 782301
38 JGI25160J50197_1001364 3300003354 Bacteria 12298
39 JGI25160J50197_1002189 3300003354 Bacteria 9195
40 JGI25160J50197_1013198 3300003354 Bacteria 2828
41 JGI25161J50226_1000001 3300003374 Bacteria 655036
42 JGI25161J50226_1000118 3300003374 Bacteria 58587
43 JGI25161J50226_1004790 3300003374 Bacteria 2767
44 Ga0055526_1002019 3300003771 Bacteria 13965
45 Ga0055526_1003623 3300003771 Bacteria 9670
46 Ga0055526_1003912 3300003771 Bacteria 9195
47 Ga0055537_1001461 3300003773 Bacteria 9195
48 Ga0055524_1001714 3300003775 Bacteria 12172
49 Ga0055524_1002596 3300003775 Bacteria 9195
50 Ga0055524_1005388 3300003775 Bacteria 5719
51 Ga0055534_1000847 3300003784 Bacteria 14054
52 Ga0055528_1000193 3300003790 Bacteria 51831
53 Ga0055528_1001004 3300003790 Bacteria 18707
54 Ga0055528_1002403 3300003790 Bacteria 10073
55 Ga0055528_1002762 3300003790 Bacteria 9195
56 Ga0055528_1007962 3300003790 Bacteria 4615
57 Ga0055528_1011260 3300003790 Bacteria 3570
58 Ga0055540_1000293 3300003792 Bacteria 44565
59 Ga0055540_1002969 3300003792 Bacteria 8507
60 Ga0055540_1013080 3300003792 Bacteria 2558
61 Ga0055531_10002692 3300003794 Bacteria 11701
62 Ga0055543_1000003 3300004625 Bacteria 358656
63 Ga0055543_1000304 3300004625 Bacteria 34441
64 Ga0055543_1006850 3300004625 Bacteria 2705
65 Ga0065165_1000469 3300005262 Bacteria 63164
66 Ga0065165_1002090 3300005262 Bacteria 18298
67 Ga0065165_1002753 3300005262 Bacteria 13999
68 Ga0065165_1010109 3300005262 Bacteria 4134
69 Ga0070658_10038326 3300005327 Bacteria 3865
70 Ga0070658_10039494 3300005327 Bacteria 3808
71 Ga0070670_100005707 3300005331 Bacteria 10518
72 Ga0070660_100033806 3300005339 Bacteria 3858
73 Ga0070660_100173045 3300005339 Bacteria 1745
74 Ga0070661_100092590 3300005344 Bacteria 2239
75 Ga0070669_100067798 3300005353 Bacteria 2633
76 Ga0070674_100051440 3300005356 Bacteria 2839
77 Ga0070673_100025932 3300005364 Bacteria 4322
78 Ga0068867_100120701 3300005459 Bacteria 2026
79 Ga0070665_100074211 3300005548 Bacteria 3407
80 Ga0068855_100257852 3300005563 Bacteria 1943
81 Ga0070664_100125069 3300005564 Bacteria 2254
82 Ga0068857_100008613 3300005577 Bacteria 8827
83 Ga0068854_100046271 3300005578 Bacteria 3097
84 Ga0068856_100078254 3300005614 Bacteria 3278
85 Ga0068852_100002986 3300005616 Bacteria 11756
86 Ga0068852_100114985 3300005616 Bacteria 2452
87 Ga0068851_10075727 3300005834 Bacteria 1749
88 Ga0068862_100053481 3300005844 Bacteria 3457
89 Ga0075365_10016689 3300006038 Bacteria 4474
90 Ga0075367_10018190 3300006178 Bacteria 3873
91 Ga0075366_10016151 3300006195 Bacteria 4287
92 Ga0068871_100185446 3300006358 Bacteria 1790
93 Ga0068865_100030805 3300006881 Bacteria 3571
94 Ga0105240_10000014 3300009093 Bacteria 482033
95 Ga0105241_10049730 3300009174 Bacteria 3194
96 Ga0105237_10001389 3300009545 Bacteria 31975
97 Ga0105237_10012821 3300009545 Bacteria 8816
98 Ga0123341_1007449 3300009765 Bacteria 9975
99 Ga0123342_1022778 3300009766 Bacteria 4184
100 Ga0105239_10001103 3300010375 Bacteria 37309
101 Ga0105239_10004698 3300010375 Bacteria 16222
102 Ga0105239_10097287 3300010375 Bacteria 3253
103 Ga0105239_10212986 3300010375 Bacteria 2166
104 Ga0157370_10001013 3300013104 Bacteria 35493
105 Ga0157370_10006535 3300013104 Bacteria 12836
106 Ga0157370_10053112 3300013104 Bacteria 3865
107 Ga0157375_10233559 3300013308 Bacteria 1998
108 Ga0182007_10004389 3300015262 Bacteria 6402
109 Ga0182005_1002036 3300015265 Bacteria 7584
110 Ga0163161_10000171 3300017792 Bacteria 59497
111 Ga0209435_100054 3300025206 Bacteria 86285
112 Ga0209436_100198 3300025208 Bacteria 27841
113 Ga0209437_100098 3300025233 Bacteria 229766
114 Ga0207425_1000010 3300025245 Bacteria 572898
115 Ga0207425_1000909 3300025245 Bacteria 14211
116 Ga0207425_1003761 3300025245 Bacteria 4743
117 Ga0207425_1012401 3300025245 Bacteria 2001
118 Ga0209646_1000170 3300025246 Bacteria 86285
119 Ga0209646_1003191 3300025246 Bacteria 3297
120 Ga0209026_1000193 3300025250 Bacteria 86285
121 Ga0209677_106413 3300025253 Bacteria 2785
122 Ga0209759_1000222 3300025256 Bacteria 86285
123 Ga0209129_1000013 3300025258 Bacteria 524874
124 Ga0209129_1000034 3300025258 Bacteria 330950
125 Ga0209129_1000348 3300025258 Bacteria 39224
126 Ga0209129_1001467 3300025258 Bacteria 13113
127 Ga0209129_1005104 3300025258 Bacteria 4810
128 Ga0209233_1000095 3300025261 Bacteria 303783
129 Ga0209233_1000148 3300025261 Bacteria 185135
130 Ga0209233_1000913 3300025261 Bacteria 12872
131 Ga0209565_1000228 3300025263 Bacteria 61687
132 Ga0209673_1000010 3300025273 Bacteria 596656
133 Ga0209673_1000025 3300025273 Bacteria 404572
134 Ga0209673_1000309 3300025273 Bacteria 90058
135 Ga0209673_1001435 3300025273 Bacteria 22697
136 Ga0209673_1001488 3300025273 Bacteria 21842
137 Ga0209673_1002597 3300025273 Bacteria 12182
138 Ga0209673_1002930 3300025273 Bacteria 10739
139 Ga0209130_1000003 3300025284 Bacteria 677988
140 Ga0209130_1000020 3300025284 Bacteria 379297
141 Ga0209130_1000284 3300025284 Bacteria 62277
142 Ga0209675_1000238 3300025291 Bacteria 54807
143 Ga0209676_1002911 3300025292 Bacteria 11198
144 Ga0209025_1000022 3300025294 Bacteria 574487
145 Ga0209025_1000026 3300025294 Bacteria 519850
146 Ga0209025_1000393 3300025294 Bacteria 90571
147 Ga0209025_1002036 3300025294 Bacteria 23065
148 Ga0209025_1002049 3300025294 Bacteria 22963
149 Ga0209025_1015702 3300025294 Bacteria 4539
150 Ga0209025_1017623 3300025294 Bacteria 4106
151 Ga0209025_1043431 3300025294 Bacteria 1894
152 Ga0209564_1000222 3300025295 Bacteria 129405
153 Ga0209564_1000618 3300025295 Bacteria 54453
154 Ga0209564_1000628 3300025295 Bacteria 53862
155 Ga0209564_1001430 3300025295 Bacteria 24490
156 Ga0209564_1006170 3300025295 Bacteria 6565
157 Ga0209564_1019076 3300025295 Bacteria 2580
158 Ga0209758_1000080 3300025297 Bacteria 261472
159 Ga0209758_1000134 3300025297 Bacteria 178294
160 Ga0209758_1001930 3300025297 Bacteria 22532
161 Ga0209758_1002077 3300025297 Bacteria 21309
162 Ga0209758_1002703 3300025297 Bacteria 17489
163 Ga0209758_1003551 3300025297 Bacteria 14026
164 Ga0209050_1006344 3300025298 Bacteria 7033
165 Ga0209256_1000060 3300025299 Bacteria 262342
166 Ga0209256_1000561 3300025299 Bacteria 53094
167 Ga0209256_1002014 3300025299 Bacteria 18121
168 Ga0209256_1002755 3300025299 Bacteria 13571
169 Ga0209256_1006638 3300025299 Bacteria 6035
170 Ga0207426_1000008 3300025302 Bacteria 848730
171 Ga0207426_1000011 3300025302 Bacteria 791203
172 Ga0207426_1000100 3300025302 Bacteria 262342
173 Ga0207426_1000218 3300025302 Bacteria 135865
174 Ga0209051_1000097 3300025303 Bacteria 167378
175 Ga0209051_1000245 3300025303 Bacteria 91350
176 Ga0209051_1023997 3300025303 Bacteria 2522
177 Ga0209257_1001946 3300025304 Bacteria 22293
178 Ga0209257_1007470 3300025304 Bacteria 6587
179 Ga0207645_10055364 3300025907 Bacteria 2532
180 Ga0207705_10023332 3300025909 Bacteria 4413
181 Ga0207705_10068794 3300025909 Bacteria 2564
182 Ga0207695_10000037 3300025913 Bacteria 476303
183 Ga0207671_10000168 3300025914 Bacteria 100117
184 Ga0207671_10003788 3300025914 Bacteria 14849
185 Ga0207657_10002856 3300025919 Bacteria 18574
186 Ga0207657_10044996 3300025919 Bacteria 3877
187 Ga0207657_10053820 3300025919 Bacteria 3484
188 Ga0207649_10020952 3300025920 Bacteria 3754
189 Ga0207681_10107524 3300025923 Bacteria 2023
190 Ga0207650_10000822 3300025925 Bacteria 23833
191 Ga0207704_10044550 3300025938 Bacteria 2629
192 Ga0207679_10186270 3300025945 Bacteria 1721
193 Ga0207667_10002485 3300025949 Bacteria 22977
194 Ga0207667_10165326 3300025949 Bacteria 2275
195 Ga0207651_10071975 3300025960 Bacteria 2453
196 Ga0207640_10028391 3300025981 Bacteria 3420
197 Ga0207640_10068670 3300025981 Bacteria 2376
198 Ga0207639_10102776 3300026041 Bacteria 2314
199 Ga0207678_10064369 3300026067 Bacteria 3150
200 Ga0207702_10058095 3300026078 Bacteria 3291
201 Ga0207702_10214095 3300026078 Bacteria 1793
202 Ga0207674_10036468 3300026116 Bacteria 5122
203 Ga0207683_10051785 3300026121 Bacteria 3597
204 Ga0207698_10092789 3300026142 Bacteria 2476
205 Ga0268266_10000974 3300028379 Bacteria 36355
206 Ga0268265_10009258 3300028380 Bacteria 6657
207 Ga0265319_1003170 3300028563 Bacteria 8663
208 Ga0307515_10023717 3300028794 Bacteria 10734
209 Ga0265338_10037801 3300028800 Bacteria 4585
210 Ga0265320_10020660 3300031240 Bacteria 3562
211 Ga0265325_10001162 3300031241 Bacteria 18825
212 Ga0265339_10000239 3300031249 Bacteria 44164
213 Ga0265316_10012591 3300031344 Bacteria 7576
214 Ga0265313_10001393 3300031595 Bacteria 22670
215 Ga0265313_10055472 3300031595 Bacteria 1877
216 Ga0265314_10103306 3300031711 Bacteria 1827
217 Ga0307412_10000061 3300031911 Bacteria 126274
218 Ga0307412_10023912 3300031911 Bacteria 3766
219 Ga0307416_100101946 3300032002 Bacteria 2501
220 Ga0451833_1329452 3300041491 Bacteria 2166
221 Ga0451837_1567322 3300041494 Bacteria 1461
222 Ga0451839_0012095 3300041496 Bacteria 4923
223 Ga0451845_0746327 3300041501 Bacteria 1765
224 Ga0466970_0000072 3300044765 Bacteria 40522
225 Ga0466959_0059387 3300045049 Bacteria 2785
226 Ga0495651_0171943 3300046462 Bacteria 1542
227 Ga0495650_0019875 3300046471 Bacteria 3290
228 Ga0495585_0034473 3300046492 Bacteria 2861
229 Ga0495585_0054958 3300046492 Bacteria 2201
230 Ga0495606_0006398 3300046507 Bacteria 10870
231 Ga0495606_0033436 3300046507 Bacteria 3546
232 Ga0495606_0098432 3300046507 Bacteria 1785
233 Ga0495610_0000861 3300046512 Bacteria 28368
234 Ga0495616_0055331 3300046513 Bacteria 1965
235 Ga0495616_0056083 3300046513 Bacteria 1947
236 Ga0495620_0009674 3300046515 Bacteria 5117
237 Ga0495632_0002455 3300046519 Bacteria 14104
238 Ga0495632_0041379 3300046519 Bacteria 2316
239 Ga0495632_0097918 3300046519 Bacteria 1384
240 Ga0495643_0007759 3300046522 Bacteria 6869
241 Ga0495643_0022638 3300046522 Bacteria 3583
242 Ga0495643_0025270 3300046522 Bacteria 3362
243 Ga0495643_0065430 3300046522 Bacteria 1919
244 Ga0495648_0028001 3300046524 Bacteria 3762
245 Ga0495654_0040337 3300046530 Bacteria 2327
246 Ga0495587_0076772 3300046536 Bacteria 1940
247 Ga0495609_0026716 3300046538 Bacteria 2642
248 Ga0495622_0094700 3300046557 Bacteria 1371
249 Ga0495633_0017445 3300046558 Bacteria 3670
250 Ga0495633_0060582 3300046558 Bacteria 1773
251 Ga0495668_0038967 3300046616 Bacteria 2654
252 Ga0495611_0058197 3300046648 Bacteria 1753
253 Ga0495625_0020565 3300046660 Bacteria 5093
254 Ga0495625_0057463 3300046660 Bacteria 2766
255 Ga0495625_0109714 3300046660 Bacteria 1887
256 Ga0495661_0022219 3300046665 Bacteria 4128
257 Ga0495657_0073137 3300046675 Bacteria 2234
258 Ga0495670_0057835 3300046691 Bacteria 1947
259 Ga0495671_0029811 3300046692 Bacteria 2799
260 Ga0495649_0067372 3300046694 Bacteria 1920
261 Ga0495604_0008505 3300047317 Bacteria 8103
262 Ga0495672_0014047 3300047320 Bacteria 5499
263 Ga0495683_0073442 3300047323 Bacteria 1677
264 Ga0495687_043788 3300047443 Bacteria 1948
265 Ga0495673_0052229 3300047469 Bacteria 1787
266 Ga0495686_0002146 3300047472 Bacteria 19287
267 Ga0495686_0005448 3300047472 Bacteria 10038
268 Ga0495686_0007219 3300047472 Bacteria 8366
269 Ga0495626_0073036 3300048091 Bacteria 1537
270 Ga0496100_0003636 3300048903 Bacteria 8058
271 Ga0496102_0003723 3300048905 Bacteria 12887
272 Ga0496102_0028351 3300048905 Bacteria 5000
273 Ga0496104_0007056 3300048907 Bacteria 9909
274 Ga0496105_0009886 3300048908 Bacteria 7479
275 Ga0496106_0000601 3300048909 Bacteria 25684
276 Ga0496106_0262855 3300048909 Bacteria 1381
277 Ga0496110_0009016 3300048913 Bacteria 8049
278 Ga0496111_0032193 3300048914 Bacteria 3738
279 Ga0496113_0008924 3300048916 Bacteria 6561
280 Ga0496113_0302194 3300048916 Bacteria 1281
281 Ga0496116_0001927 3300048919 Bacteria 22365
282 Ga0496116_0004742 3300048919 Bacteria 12840
283 Ga0496116_0008405 3300048919 Bacteria 8961
284 Ga0496116_0010833 3300048919 Bacteria 7605
285 Ga0496116_0018333 3300048919 Bacteria 5399
286 Ga0496116_0044368 3300048919 Bacteria 3020
287 Ga0496116_0044807 3300048919 Bacteria 3000
288 Ga0496116_0058861 3300048919 Bacteria 2502
289 Ga0496117_0001336 3300048920 Bacteria 36255
290 Ga0496117_0005284 3300048920 Bacteria 13681
291 Ga0496117_0012823 3300048920 Bacteria 7350
292 Ga0496117_0022676 3300048920 Bacteria 5029
293 Ga0496118_0003734 3300048921 Bacteria 18843
294 Ga0496118_0004095 3300048921 Bacteria 17672
295 Ga0496118_0007446 3300048921 Bacteria 11597
296 Ga0496118_0011741 3300048921 Bacteria 8513
297 Ga0496118_0019985 3300048921 Bacteria 5959
298 Ga0496118_0044626 3300048921 Bacteria 3469
299 Ga0496118_0053994 3300048921 Bacteria 3048
300 Ga0496118_0137912 3300048921 Bacteria 1553
301 Ga0496119_0005806 3300048922 Bacteria 11672
302 Ga0496120_0002450 3300048923 Bacteria 18765
303 Ga0496120_0028818 3300048923 Bacteria 3397
304 Ga0496121_0001365 3300048924 Bacteria 41600
305 Ga0496121_0001813 3300048924 Bacteria 34507
306 Ga0496121_0005187 3300048924 Bacteria 16886
307 Ga0496121_0006687 3300048924 Bacteria 14175
308 Ga0496121_0025023 3300048924 Bacteria 5684
309 Ga0496121_0063397 3300048924 Bacteria 3020
310 Ga0496121_0072256 3300048924 Bacteria 2770
311 Ga0496121_0086885 3300048924 Bacteria 2456
312 Ga0496121_0120142 3300048924 Bacteria 1986
313 Ga0496121_0140634 3300048924 Bacteria 1791
314 Ga0496121_0208622 3300048924 Bacteria 1386
315 Ga0496122_0000449 3300048925 Bacteria 85961
316 Ga0496122_0000669 3300048925 Bacteria 68904
317 Ga0496122_0006435 3300048925 Bacteria 13487
318 Ga0496122_0023514 3300048925 Bacteria 5429
319 Ga0496122_0059613 3300048925 Bacteria 2816
320 Ga0496122_0060433 3300048925 Bacteria 2790
321 Ga0496122_0103274 3300048925 Bacteria 1897
322 Ga0496122_0108561 3300048925 Bacteria 1830
323 Ga0496123_0000263 3300048926 Bacteria 105886
324 Ga0496123_0000977 3300048926 Bacteria 44079
325 Ga0496123_0001831 3300048926 Bacteria 27939
326 Ga0496123_0005654 3300048926 Bacteria 12483
327 Ga0496123_0029276 3300048926 Bacteria 4059
328 Ga0496123_0044405 3300048926 Bacteria 3039
329 Ga0496123_0051239 3300048926 Bacteria 2750
330 Ga0496124_0000103 3300048927 Bacteria 179162
331 Ga0496124_0002086 3300048927 Bacteria 26982
332 Ga0496124_0005915 3300048927 Bacteria 13538
333 Ga0496124_0005932 3300048927 Bacteria 13515
334 Ga0496124_0045318 3300048927 Bacteria 3770
335 Ga0496124_0132692 3300048927 Bacteria 1976
336 Ga0496125_0000051 3300048928 Bacteria 285754
337 Ga0496125_0010744 3300048928 Bacteria 9222
338 Ga0496125_0011052 3300048928 Bacteria 9060
339 Ga0496125_0013656 3300048928 Bacteria 7972
340 Ga0496125_0037025 3300048928 Bacteria 4248
341 Ga0496125_0125673 3300048928 Bacteria 1818
342 Ga0496126_0014121 3300048929 Bacteria 8088
343 Ga0496126_0023441 3300048929 Bacteria 5982
344 Ga0496126_0030206 3300048929 Bacteria 5136
345 Ga0496126_0120138 3300048929 Bacteria 2280
346 Ga0501032_0029098 3300049569 Bacteria 3794
347 Ga0501032_0050406 3300049569 Bacteria 2807
348 Ga0501033_0022120 3300049570 Bacteria 4797
349 Ga0501033_0025970 3300049570 Bacteria 4409
350 Ga0501034_0088750 3300049571 Bacteria 3090
351 Ga0501034_0094210 3300049571 Bacteria 2991
352 Ga0501034_0333873 3300049571 Bacteria 1447
353 Ga0501036_0028311 3300049572 Bacteria 4735
354 Ga0501036_0052321 3300049572 Bacteria 3458
355 Ga0501036_0230401 3300049572 Bacteria 1555
356 Ga0501037_0036402 3300049573 Bacteria 3627
357 Ga0501038_0025719 3300049574 Bacteria 5244
358 Ga0501038_0125881 3300049574 Bacteria 2109
359 Ga0501039_0011916 3300049575 Bacteria 6627
360 Ga0501039_0192647 3300049575 Bacteria 1603
361 Ga0501043_0038729 3300049579 Bacteria 3749
362 Ga0501043_0137821 3300049579 Bacteria 1911
363 Ga0501046_0004753 3300049580 Bacteria 12253
364 Ga0501046_0057349 3300049580 Bacteria 3055
365 Ga0501047_0015902 3300049581 Bacteria 7172
366 Ga0501068_0078033 3300049584 Bacteria 2029
367 Ga0501070_0016437 3300049586 Bacteria 6218
368 Ga0501070_0078893 3300049586 Bacteria 2724
369 Ga0501073_0100322 3300049589 Bacteria 2010
370 Ga0501238_006963 3300049671 Bacteria 1464
371 Ga0501080_0055270 3300049742 Bacteria 3698
372 Ga0501083_0015489 3300049744 Bacteria 5341
373 Ga0501035_0010430 3300049822 Bacteria 8612
374 Ga0501035_0024966 3300049822 Bacteria 5480
375 Ga0501035_0080027 3300049822 Bacteria 2885
376 Ga0501035_0268149 3300049822 Bacteria 1446
377 Ga0501044_0012345 3300049823 Bacteria 9247
378 Ga0501044_0019592 3300049823 Bacteria 7233
379 nmdc:mga07m45_292_c1 3300050496 Bacteria 20234
380 nmdc:mga0sz30_5581_c1 3300050516 Bacteria 4623
381 Ga0500610_0000748 3300053079 Bacteria 10188
382 Ga0500610_0059484 3300053079 Bacteria 1993
383 Ga0500610_0093992 3300053079 Bacteria 1556
384 Ga0500578_0006427 3300053086 Bacteria 7846
385 Ga0500593_002920 3300053117 Bacteria 6356
386 Ga0500618_000356 3300053125 Bacteria 31771
387 Ga0500618_000866 3300053125 Bacteria 16181
388 Ga0500658_0005523 3300053134 Bacteria 4706
389 Ga0500658_0084119 3300053134 Bacteria 1366
390 Ga0500559_0008594 3300053136 Bacteria 4467
391 Ga0500568_0000509 3300053139 Bacteria 28652
392 Ga0500568_0001937 3300053139 Bacteria 12678
393 Ga0500573_0003486 3300053140 Bacteria 8146
394 Ga0500573_0142096 3300053140 Bacteria 1321
395 Ga0500604_0003671 3300053151 Bacteria 4123
396 Ga0500616_0000421 3300053153 Bacteria 56739
397 Ga0500616_0003563 3300053153 Bacteria 11794
398 Ga0500616_0005619 3300053153 Bacteria 8467
399 Ga0500616_0006556 3300053153 Bacteria 7597
400 Ga0500622_0000210 3300053156 Bacteria 61827
401 Ga0500627_0005312 3300053158 Bacteria 4269
402 Ga0500627_0005636 3300053158 Bacteria 4177
403 Ga0500633_0000143 3300053160 Bacteria 9436
404 Ga0500634_0020975 3300053161 Bacteria 3536
405 Ga0500636_0069729 3300053177 Bacteria 2040
406 2509391946 2509276021 Bacteria 7634384
407 2509447202 2509276033 Bacteria 7180565
408 2510134039 2510065019 Bacteria 6903379
409 2510895459 2510461076 Bacteria 8618824
410 2511174111 2510917026 Bacteria 7046020
411 2511199114 2510917030 Bacteria 7460662
412 2513577031 2513237085 Bacteria 7695351
413 2513593313 2513237087 Bacteria 5817514
414 2513633297 2513237093 Bacteria 7545552
415 2513707697 2513237103 Bacteria 7647401
416 2514018227 2513237162 Bacteria 7468464
417 2515639096 2515154113 Bacteria 7807172
418 2515645742 2515154114 Bacteria 7848616
419 2515655269 2515154116 Bacteria 7552979
420 2515739567 2515154134 Bacteria 7220242
421 2517036804 2516653077 Bacteria 7555578
422 2517095915 2517093000 Bacteria 7412387
423 2517407487 2517287029 Bacteria 6905599
424 2524463258 2524023209 Bacteria 6679728
425 2530645870 2529292951 Bacteria 6916614
426 2585205727 2582581294 Bacteria 6626667
427 2585222943 2582581298 Bacteria 7315509
428 2585232527 2582581299 Bacteria 6518058
429 2585255199 2582581304 Bacteria 5831370
430 2585271224 2582581307 Bacteria 6597605
431 2585279157 2582581308 Bacteria 7413247
432 2585323238 2582581315 Bacteria 7318924
433 2585331343 2582581316 Bacteria 7774528
434 2585404435 2582581867 Bacteria 7184437
435 2585524585 2585427526 Bacteria 7258840
436 2585531358 2585427527 Bacteria 7273426
437 2585538283 2585427528 Bacteria 6842387
438 2585545526 2585427529 Bacteria 7395659
439 2585552719 2585427530 Bacteria 7383882
440 2585558969 2585427531 Bacteria 6992870
441 2585824757 2585427590 Bacteria 6824633
442 2585836236 2585427593 Bacteria 7141551
443 2585845709 2585427594 Bacteria 6180594
444 2585898351 2585427608 Bacteria 6544331
445 2585904084 2585427609 Bacteria 6667127
446 2586001069 2585427634 Bacteria 6455027
447 2587980799 2585428125 Bacteria 6662905
448 2599902864 2599185292 Bacteria 6290804
449 2616312809 2615840626 Bacteria 7921970
450 2616554342 2615840698 Bacteria 7319877
451 2643861699 2643221569 Bacteria 6064337
452 2643983271 2643221594 Bacteria 5811388
453 2644005349 2643221599 Bacteria 6292121
454 2644123535 2643221621 Bacteria 6212786
455 2644165234 2643221629 Bacteria 5850260
456 2644193295 2643221634 Bacteria 6705461
457 2644350964 2643221662 Bacteria 5851492
458 2671111340 2667528174 Bacteria 6435400
459 2719386495 2718217927 Bacteria 6972593
460 2721400199 2718218423 Bacteria 6438183
461 2724039012 2721755809 Bacteria 6438790
462 2725952454 2724679232 Bacteria 7646494
463 2738799439 2738541293 Bacteria 7065685
464 2738884732 2738541307 Bacteria 8606193
465 2739032923 2738541333 Bacteria 7106503
466 2766065958 2765235942 Bacteria 7445910
467 2793316004 2791355259 Bacteria 7254731
468 2793330863 2791355261 Bacteria 6661293
469 2793362053 2791355266 Bacteria 7116587
470 2793368777 2791355267 Bacteria 7222458
471 2806045061 2802429633 Bacteria 7341974
472 2806050144 2802429634 Bacteria 7083200
473 2806056982 2802429635 Bacteria 7650140
474 2806064363 2802429636 Bacteria 7597525
475 2806071630 2802429637 Bacteria 7067217
476 2809033203 2808606395 Bacteria 6020352
477 2819609228 2818991448 Bacteria 6772224
478 2819641463 2818991453 Bacteria 7181617
479 2838033642 2838029111 Bacteria 6603031
480 2838045049 2838042994 Bacteria 6046894
481 2838683373 2838680041 Bacteria 6545511
482 2838686966 2838686498 Bacteria 7807632
483 2838697683 2838694306 Bacteria 6853137
484 2838710799 2838707686 Bacteria 6619912
485 2838730077 2838729681 Bacteria 7400765
486 2838742908 2838742623 Bacteria 7396178
487 2841852410 2841851746 Bacteria 7532261
488 2841867039 2841864319 Bacteria 6742987
489 2842078972 2842077413 Bacteria 6508645
490 2842113180 2842110456 Bacteria 7656360
491 2842118518 2842118031 Bacteria 7033875
492 2842158132 2842156927 Bacteria 6894975
493 2842168709 2842163707 Bacteria 6916235
494 2842181751 2842180545 Bacteria 6888678
495 2842218025 2842217011 Bacteria 7497767
496 2842230199 2842229732 Bacteria 7475766
497 2842240429 2842237096 Bacteria 6620661
498 2842244086 2842243621 Bacteria 7421798
499 2842257828 2842257432 Bacteria 7401195
500 2842271496 2842271015 Bacteria 7807131
501 2842292634 2842291075 Bacteria 7076806
502 2842303966 2842298080 Bacteria 6123127
503 2842305128 2842304105 Bacteria 7023636
504 2842347437 2842341865 Bacteria 7003929
505 2842363576 2842357229 Bacteria 6485165
506 2842368872 2842363717 Bacteria 6844742
507 2842374004 2842370503 Bacteria 7038661
508 2842379032 2842377471 Bacteria 7140707
509 2842385028 2842384541 Bacteria 7057858
510 2842400263 2842395702 Bacteria 6780583
511 2842480389 2842475841 Bacteria 6603183
512 2842505390 2842502639 Bacteria 6604161
513 2842511013 2842509118 Bacteria 6850950
514 2842735707 2842733646 Bacteria 5716726
515 2842749105 2842747753 Bacteria 5578255
516 2844458262 2844454524 Bacteria 7952546
517 2852390339 2852387548 Bacteria 8025568
518 2855732081 2855730933 Bacteria 7047938
519 2855768788 2855767633 Bacteria 7049357
520 2857517343 2857516855 Bacteria 7787325
521 2857543416 2857542790 Bacteria 5326616
522 2858952122 2858950400 Bacteria 6783797
523 2881415260 2881412998 Bacteria 6492157
524 2919106377 2919100787 Bacteria 7710546
525 2919410092 2919408235 Bacteria 6149349
526 2928117825 2928115317 Bacteria 6477646
527 2933570935 2933570622 Bacteria 7023390
528 2933588763 2933586486 Bacteria 7667493
529 2935896931 2935894831 Bacteria 6620579
530 2935901873 2935901341 Bacteria 7341747
531 2936371953 2936367885 Bacteria 7324495
532 2936379788 2936375103 Bacteria 6652732
533 2936388307 2936381700 Bacteria 7006523
534 2941482549
535 2945910732 2945909444 Bacteria 7065066
536 3005417459 3005416602 Bacteria 7064308
537 3005448535 3005445848 Bacteria 6906074
538 639649264 639633055 Bacteria 7751309
539 8005281296 8005275841 Bacteria 6929066
540 8005312916 8005307578 Bacteria 7395396
541 8005315752 8005314921 Bacteria 7072929
542 8005381011 8005376324 Bacteria 6590079
543 8005389036 8005382845 Bacteria 6732062
544 8005396019 8005395548 Bacteria 6806915
545 8005489103 8005484373 Bacteria 6297373
546 8005556934 8005556819 Bacteria 6908598
547 8005573376 8005570704 Bacteria 6957481
548 8005650086 8005645114 Bacteria 6950293
549 8005682798 8005682033 Bacteria 6726518
550 8005697492 8005695170 Bacteria 6912330
551 8018164488 8018163183 Bacteria 7277977
552 8018176967 8018176218 Bacteria 6896178
553 8023683084 8023680758 Bacteria 7729763
554 8024482781 8024479707 Bacteria 6954785
555 8024488120 8024486573 Bacteria 6540512
556 8046771853 8046767195 Bacteria 7547379
557 8056376017 8056375014 Bacteria 7006639
558 8057575616 8057575449 Bacteria 7367519
559 8057877594 8057874678 Bacteria 7494653
560 Ga0055524_1007129
561 JGI24740J21852_10000010
562 JGI25155J39150_1000044
563 JGI25156J39149_1000058
564 JGI25162J39368_1000143
565 JGI25154J39366_1000174
566 JGI25158J39367_1000123
567 JGI25157J39369_1000078
568 JGI25152J39213_1000462
569 JGI25152J39213_1001551
570 JGI25152J39213_1001673
571 JGI25152J39213_1002597
572 JGI25152J39213_1002911
573 JGI25152J39213_1010426
574 JGI25152J39213_1011332
575 JGI25150J39212_1000047
576 JGI25150J39212_1000084
577 JGI25150J39212_1000085
578 JGI25159J45721_1000756
579 JGI25159J45721_1001008
580 JGI25151J46595_10000126
581 JGI25151J46595_10000190
582 JGI25151J46595_10002195
583 JGI25151J46595_10003188
584 JGI25151J46595_10014212
585 JGI25165J46597_1000356
586 JGI25165J46597_1000500
587 JGI25165J46597_1003573
588 JGI25153J46596_10001341
589 JGI25153J46596_10002046
590 JGI25153J46596_10003206
591 JGI25153J46596_10003219
592 JGI25153J46596_10027728
593 rootH1_10069601
594 rootH2_10059318
595 rootL2_10006456
596 JGI25160J50197_1000001
597 JGI25160J50197_1001364
598 JGI25160J50197_1002189
599 JGI25160J50197_1013198
600 JGI25161J50226_1000001
601 JGI25161J50226_1000118
602 JGI25161J50226_1004790
603 Ga0055526_1002019
604 Ga0055526_1003623
605 Ga0055526_1003912
606 Ga0055537_1001461
607 Ga0055524_1001714
608 Ga0055524_1002596
609 Ga0055524_1005388
610 Ga0055534_1000847
611 Ga0055528_1000193
612 Ga0055528_1001004
613 Ga0055528_1002403
614 Ga0055528_1002762
615 Ga0055528_1007962
616 Ga0055528_1011260
617 Ga0055540_1000293
618 Ga0055540_1002969
619 Ga0055540_1013080
620 Ga0055531_10002692
621 Ga0055543_1000003
622 Ga0055543_1000304
623 Ga0055543_1006850
624 Ga0065165_1000469
625 Ga0065165_1002090
626 Ga0065165_1002753
627 Ga0065165_1010109
628 Ga0070658_10038326
629 Ga0070658_10039494
630 Ga0070670_100005707
631 Ga0070660_100033806
632 Ga0070660_100173045
633 Ga0070661_100092590
634 Ga0070669_100067798
635 Ga0070674_100051440
636 Ga0070673_100025932
637 Ga0068867_100120701
638 Ga0070665_100074211
639 Ga0068855_100257852
640 Ga0070664_100125069
641 Ga0068857_100008613
642 Ga0068854_100046271
643 Ga0068856_100078254
644 Ga0068852_100002986
645 Ga0068852_100114985
646 Ga0068851_10075727
647 Ga0068862_100053481
648 Ga0075365_10016689
649 Ga0075367_10018190
650 Ga0075366_10016151
651 Ga0068871_100185446
652 Ga0068865_100030805
653 Ga0105240_10000014
654 Ga0105241_10049730
655 Ga0105237_10001389
656 Ga0105237_10012821
657 Ga0123341_1007449
658 Ga0123342_1022778
659 Ga0105239_10001103
660 Ga0105239_10004698
661 Ga0105239_10097287
662 Ga0105239_10212986
663 Ga0157370_10001013
664 Ga0157370_10006535
665 Ga0157370_10053112
666 Ga0157375_10233559
667 Ga0182007_10004389
668 Ga0182005_1002036
669 Ga0163161_10000171
670 Ga0209435_100054
671 Ga0209436_100198
672 Ga0209437_100098
673 Ga0207425_1000010
674 Ga0207425_1000909
675 Ga0207425_1003761
676 Ga0207425_1012401
677 Ga0209646_1000170
678 Ga0209646_1003191
679 Ga0209026_1000193
680 Ga0209677_106413
681 Ga0209759_1000222
682 Ga0209129_1000013
683 Ga0209129_1000034
684 Ga0209129_1000348
685 Ga0209129_1001467
686 Ga0209129_1005104
687 Ga0209233_1000095
688 Ga0209233_1000148
689 Ga0209233_1000913
690 Ga0209565_1000228
691 Ga0209673_1000010
692 Ga0209673_1000025
693 Ga0209673_1000309
694 Ga0209673_1001435
695 Ga0209673_1001488
696 Ga0209673_1002597
697 Ga0209673_1002930
698 Ga0209130_1000003
699 Ga0209130_1000020
700 Ga0209130_1000284
701 Ga0209675_1000238
702 Ga0209676_1002911
703 Ga0209025_1000022
704 Ga0209025_1000026
705 Ga0209025_1000393
706 Ga0209025_1002036
707 Ga0209025_1002049
708 Ga0209025_1015702
709 Ga0209025_1017623
710 Ga0209025_1043431
711 Ga0209564_1000222
712 Ga0209564_1000618
713 Ga0209564_1000628
714 Ga0209564_1001430
715 Ga0209564_1006170
716 Ga0209564_1019076
717 Ga0209758_1000080
718 Ga0209758_1000134
719 Ga0209758_1001930
720 Ga0209758_1002077
721 Ga0209758_1002703
722 Ga0209758_1003551
723 Ga0209050_1006344
724 Ga0209256_1000060
725 Ga0209256_1000561
726 Ga0209256_1002014
727 Ga0209256_1002755
728 Ga0209256_1006638
729 Ga0207426_1000008
730 Ga0207426_1000011
731 Ga0207426_1000100
732 Ga0207426_1000218
733 Ga0209051_1000097
734 Ga0209051_1000245
735 Ga0209051_1023997
736 Ga0209257_1001946
737 Ga0209257_1007470
738 Ga0207645_10055364
739 Ga0207705_10023332
740 Ga0207705_10068794
741 Ga0207695_10000037
742 Ga0207671_10000168
743 Ga0207671_10003788
744 Ga0207657_10002856
745 Ga0207657_10044996
746 Ga0207657_10053820
747 Ga0207649_10020952
748 Ga0207681_10107524
749 Ga0207650_10000822
750 Ga0207704_10044550
751 Ga0207679_10186270
752 Ga0207667_10002485
753 Ga0207667_10165326
754 Ga0207651_10071975
755 Ga0207640_10028391
756 Ga0207640_10068670
757 Ga0207639_10102776
758 Ga0207678_10064369
759 Ga0207702_10058095
760 Ga0207702_10214095
761 Ga0207674_10036468
762 Ga0207683_10051785
763 Ga0207698_10092789
764 Ga0268266_10000974
765 Ga0268265_10009258
766 Ga0265319_1003170
767 Ga0307515_10023717
768 Ga0265338_10037801
769 Ga0265320_10020660
770 Ga0265325_10001162
771 Ga0265339_10000239
772 Ga0265316_10012591
773 Ga0265313_10001393
774 Ga0265313_10055472
775 Ga0265314_10103306
776 Ga0307412_10000061
777 Ga0307412_10023912
778 Ga0307416_100101946
779 Ga0451833_1329452
780 Ga0451837_1567322
781 Ga0451839_0012095
782 Ga0451845_0746327
783 Ga0466970_0000072
784 Ga0466959_0059387
785 Ga0495651_0171943
786 Ga0495650_0019875
787 Ga0495585_0034473
788 Ga0495585_0054958
789 Ga0495606_0006398
790 Ga0495606_0033436
791 Ga0495606_0098432
792 Ga0495610_0000861
793 Ga0495616_0055331
794 Ga0495616_0056083
795 Ga0495620_0009674
796 Ga0495632_0002455
797 Ga0495632_0041379
798 Ga0495632_0097918
799 Ga0495643_0007759
800 Ga0495643_0022638
801 Ga0495643_0025270
802 Ga0495643_0065430
803 Ga0495648_0028001
804 Ga0495654_0040337
805 Ga0495587_0076772
806 Ga0495609_0026716
807 Ga0495622_0094700
808 Ga0495633_0017445
809 Ga0495633_0060582
810 Ga0495668_0038967
811 Ga0495611_0058197
812 Ga0495625_0020565
813 Ga0495625_0057463
814 Ga0495625_0109714
815 Ga0495661_0022219
816 Ga0495657_0073137
817 Ga0495670_0057835
818 Ga0495671_0029811
819 Ga0495649_0067372
820 Ga0495604_0008505
821 Ga0495672_0014047
822 Ga0495683_0073442
823 Ga0495687_043788
824 Ga0495673_0052229
825 Ga0495686_0002146
826 Ga0495686_0005448
827 Ga0495686_0007219
828 Ga0495626_0073036
829 Ga0496100_0003636
830 Ga0496102_0003723
831 Ga0496102_0028351
832 Ga0496104_0007056
833 Ga0496105_0009886
834 Ga0496106_0000601
835 Ga0496106_0262855
836 Ga0496110_0009016
837 Ga0496111_0032193
838 Ga0496113_0008924
839 Ga0496113_0302194
840 Ga0496116_0001927
841 Ga0496116_0004742
842 Ga0496116_0008405
843 Ga0496116_0010833
844 Ga0496116_0018333
845 Ga0496116_0044368
846 Ga0496116_0044807
847 Ga0496116_0058861
848 Ga0496117_0001336
849 Ga0496117_0005284
850 Ga0496117_0012823
851 Ga0496117_0022676
852 Ga0496118_0003734
853 Ga0496118_0004095
854 Ga0496118_0007446
855 Ga0496118_0011741
856 Ga0496118_0019985
857 Ga0496118_0044626
858 Ga0496118_0053994
859 Ga0496118_0137912
860 Ga0496119_0005806
861 Ga0496120_0002450
862 Ga0496120_0028818
863 Ga0496121_0001365
864 Ga0496121_0001813
865 Ga0496121_0005187
866 Ga0496121_0006687
867 Ga0496121_0025023
868 Ga0496121_0063397
869 Ga0496121_0072256
870 Ga0496121_0086885
871 Ga0496121_0120142
872 Ga0496121_0140634
873 Ga0496121_0208622
874 Ga0496122_0000449
875 Ga0496122_0000669
876 Ga0496122_0006435
877 Ga0496122_0023514
878 Ga0496122_0059613
879 Ga0496122_0060433
880 Ga0496122_0103274
881 Ga0496122_0108561
882 Ga0496123_0000263
883 Ga0496123_0000977
884 Ga0496123_0001831
885 Ga0496123_0005654
886 Ga0496123_0029276
887 Ga0496123_0044405
888 Ga0496123_0051239
889 Ga0496124_0000103
890 Ga0496124_0002086
891 Ga0496124_0005915
892 Ga0496124_0005932
893 Ga0496124_0045318
894 Ga0496124_0132692
895 Ga0496125_0000051
896 Ga0496125_0010744
897 Ga0496125_0011052
898 Ga0496125_0013656
899 Ga0496125_0037025
900 Ga0496125_0125673
901 Ga0496126_0014121
902 Ga0496126_0023441
903 Ga0496126_0030206
904 Ga0496126_0120138
905 Ga0501032_0029098
906 Ga0501032_0050406
907 Ga0501033_0022120
908 Ga0501033_0025970
909 Ga0501034_0088750
910 Ga0501034_0094210
911 Ga0501034_0333873
912 Ga0501036_0028311
913 Ga0501036_0052321
914 Ga0501036_0230401
915 Ga0501037_0036402
916 Ga0501038_0025719
917 Ga0501038_0125881
918 Ga0501039_0011916
919 Ga0501039_0192647
920 Ga0501043_0038729
921 Ga0501043_0137821
922 Ga0501046_0004753
923 Ga0501046_0057349
924 Ga0501047_0015902
925 Ga0501068_0078033
926 Ga0501070_0016437
927 Ga0501070_0078893
928 Ga0501073_0100322
929 Ga0501238_006963
930 Ga0501080_0055270
931 Ga0501083_0015489
932 Ga0501035_0010430
933 Ga0501035_0024966
934 Ga0501035_0080027
935 Ga0501035_0268149
936 Ga0501044_0012345
937 Ga0501044_0019592
938 nmdc:mga07m45_292_c1
939 nmdc:mga0sz30_5581_c1
940 Ga0500610_0000748
941 Ga0500610_0059484
942 Ga0500610_0093992
943 Ga0500578_0006427
944 Ga0500593_002920
945 Ga0500618_000356
946 Ga0500618_000866
947 Ga0500658_0005523
948 Ga0500658_0084119
949 Ga0500559_0008594
950 Ga0500568_0000509
951 Ga0500568_0001937
952 Ga0500573_0003486
953 Ga0500573_0142096
954 Ga0500604_0003671
955 Ga0500616_0000421
956 Ga0500616_0003563
957 Ga0500616_0005619
958 Ga0500616_0006556
959 Ga0500622_0000210
960 Ga0500627_0005312
961 Ga0500627_0005636
962 Ga0500633_0000143
963 Ga0500634_0020975
964 Ga0500636_0069729
965 2509391946
966 2509447202
967 2510134039
968 2510895459
969 2511174111
970 2511199114
971 2513577031
972 2513593313
973 2513633297
974 2513707697
975 2514018227
976 2515639096
977 2515645742
978 2515655269
979 2515739567
980 2517036804
981 2517095915
982 2517407487
983 2524463258
984 2530645870
985 2585205727
986 2585222943
987 2585232527
988 2585255199
989 2585271224
990 2585279157
991 2585323238
992 2585331343
993 2585404435
994 2585524585
995 2585531358
996 2585538283
997 2585545526
998 2585552719
999 2585558969
1000 2585824757
1001 2585836236
1002 2585845709
1003 2585898351
1004 2585904084
1005 2586001069
1006 2587980799
1007 2599902864
1008 2616312809
1009 2616554342
1010 2643861699
1011 2643983271
1012 2644005349
1013 2644123535
1014 2644165234
1015 2644193295
1016 2644350964
1017 2671111340
1018 2719386495
1019 2721400199
1020 2724039012
1021 2725952454
1022 2738799439
1023 2738884732
1024 2739032923
1025 2766065958
1026 2793316004
1027 2793330863
1028 2793362053
1029 2793368777
1030 2806045061
1031 2806050144
1032 2806056982
1033 2806064363
1034 2806071630
1035 2809033203
1036 2819609228
1037 2819641463
1038 2838033642
1039 2838045049
1040 2838683373
1041 2838686966
1042 2838697683
1043 2838710799
1044 2838730077
1045 2838742908
1046 2841852410
1047 2841867039
1048 2842078972
1049 2842113180
1050 2842118518
1051 2842158132
1052 2842168709
1053 2842181751
1054 2842218025
1055 2842230199
1056 2842240429
1057 2842244086
1058 2842257828
1059 2842271496
1060 2842292634
1061 2842303966
1062 2842305128
1063 2842347437
1064 2842363576
1065 2842368872
1066 2842374004
1067 2842379032
1068 2842385028
1069 2842400263
1070 2842480389
1071 2842505390
1072 2842511013
1073 2842735707
1074 2842749105
1075 2844458262
1076 2852390339
1077 2855732081
1078 2855768788
1079 2857517343
1080 2857543416
1081 2858952122
1082 2881415260
1083 2919106377
1084 2919410092
1085 2928117825
1086 2933570935
1087 2933588763
1088 2935896931
1089 2935901873
1090 2936371953
1091 2936379788
1092 2936388307
1093 2941482549
1094 2945910732
1095 3005417459
1096 3005448535
1097 639649264
1098 8005281296
1099 8005312916
1100 8005315752
1101 8005381011
1102 8005389036
1103 8005396019
1104 8005489103
1105 8005556934
1106 8005573376
1107 8005650086
1108 8005682798
1109 8005697492
1110 8018164488
1111 8018176967
1112 8023683084
1113 8024482781
1114 8024488120
1115 8046771853
1116 8056376017
1117 8057575616
1118 8057877594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05977

MFS_3

Transmembrane secretion effector

72

433

0.86

PF07690

MFS_1

Major Facilitator Superfamily

82

423

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8597 14 399
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.841 14 399
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8359 16 400
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.8275 16 397
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8238 16 400
ID Description Score Start End Superfamily
af_P24077_14_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9572 15 400 1.20.1250.20
af_P24077_14_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9477 15 400 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9243 11 210 1.20.1250.20
af_P9WJX9_6_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9201 16 197 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9155 11 210 1.20.1250.20
ID Description Score Start End GO Terms
AF-E3HP86-F1-model_v4 Major facilitator superfamily protein 3 0.9908 7 409 GO:0005886
GO:0022857
AF-A0A2V7CHS9-F1-model_v4 MFS transporter 0.99 13 409 GO:0005886
AF-A0A244DEA1-F1-model_v4 deleted 0.99 11 409
AF-A0A1P8FQ99-F1-model_v4 Multidrug efflux pump Tap 0.9893 17 409 GO:0005886
GO:0022857
AF-A0A2V6PQG9-F1-model_v4 MFS transporter 0.9886 34 405 GO:0005886
GO:0022857

Map