F463530

General Info

Members Datasets Scaffolds Average Seq Length
559 269 1118 287

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10001656|Ga0070676_100016569
Length 317
Sequence MEPNIAIPLTASLTHTSIESLPLVAADPGGPVDVRQDQLQSWIGRSERFEDTVYPTPVVALTATLDHPAAPLGPGTPLPPLWHWLYFLPTHRQSEIGPDGHAKRGSFLPPVPLPRRMWAGSQFDFRSPIRVGDRVARTSIIDDVTVKDGRSGKLVFVKVRHEVRCNEAGEPALIEFHDIVYRAAQGPTDVAPPPQPAPTDATWRREIVPDDVLLFRYSALTFNGHRIHYDRQYVTQVEGYPGLIVHGPLIATLLMDLLRRQMPDADVASFRFKAVRPTFDLNPFHVSGQAHADGKTIRLWASDHEGWLTMDATATLR

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
164 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
165 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
176 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
179 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
180 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
181 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
182 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
183 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
184 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
245 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
259 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
260 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
261 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
262 2643221672 Variovorax sp. Root434 Isolate Unclassified
263 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
264 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
265 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
266 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
267 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
268 2904456579 Variovorax sp. 2002 Isolate Unclassified
269 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 0
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.16
Nodule 0.72
Rhizoplane 4.47
Rhizosphere 84.26
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10001656 3300005328 Bacteria 11344
2 JGI25152J39213_1001278 3300002773 Bacteria 11330
3 JGI25151J46595_10003564 3300003187 Bacteria 8538
4 JGI25153J46596_10001018 3300003215 Bacteria 17040
5 Ga0055526_1001244 3300003771 Bacteria 18280
6 Ga0070676_10010396 3300005328 Bacteria 5048
7 Ga0070676_10116429 3300005328 Bacteria 1671
8 Ga0070676_10120746 3300005328 Bacteria 1644
9 Ga0070690_100021694 3300005330 Bacteria 3923
10 Ga0070690_100036267 3300005330 Bacteria 3098
11 Ga0070670_100061134 3300005331 Bacteria 3234
12 Ga0070670_100126338 3300005331 Bacteria 2207
13 Ga0070670_100131895 3300005331 Bacteria 2158
14 Ga0070670_100160325 3300005331 Bacteria 1949
15 Ga0070670_100283584 3300005331 Bacteria 1446
16 Ga0070670_100405162 3300005331 Bacteria 1204
17 Ga0070670_100645231 3300005331 Bacteria 949
18 Ga0070677_10010100 3300005333 Bacteria 3218
19 Ga0070677_10022039 3300005333 Bacteria 2342
20 Ga0068869_100015211 3300005334 Bacteria 5156
21 Ga0068869_100043324 3300005334 Bacteria 3232
22 Ga0070666_10002356 3300005335 Bacteria 11412
23 Ga0070666_10015312 3300005335 Bacteria 4889
24 Ga0070666_10029851 3300005335 Bacteria 3587
25 Ga0070666_10073615 3300005335 Bacteria 2327
26 Ga0068868_100004021 3300005338 Bacteria 10266
27 Ga0068868_100015163 3300005338 Bacteria 5694
28 Ga0068868_100136762 3300005338 Bacteria 2009
29 Ga0068868_100264170 3300005338 Bacteria 1452
30 Ga0068868_100411940 3300005338 Bacteria 1168
31 Ga0070689_100016060 3300005340 Bacteria 5475
32 Ga0070689_100394356 3300005340 Bacteria 1169
33 Ga0070687_100003277 3300005343 Bacteria 6259
34 Ga0070661_100007761 3300005344 Bacteria 7402
35 Ga0070661_100233393 3300005344 Bacteria 1414
36 Ga0070661_100469664 3300005344 Bacteria 1003
37 Ga0070668_100002946 3300005347 Bacteria 12590
38 Ga0070669_100064434 3300005353 Bacteria 2699
39 Ga0070669_100107577 3300005353 Bacteria 2112
40 Ga0070675_100008803 3300005354 Bacteria 7840
41 Ga0070675_100079934 3300005354 Bacteria 2725
42 Ga0070675_100112092 3300005354 Bacteria 2309
43 Ga0070675_100207205 3300005354 Bacteria 1703
44 Ga0070671_100000534 3300005355 Bacteria 26702
45 Ga0070671_100001751 3300005355 Bacteria 16492
46 Ga0070671_100004653 3300005355 Bacteria 10882
47 Ga0070671_100009290 3300005355 Bacteria 7897
48 Ga0070671_100081834 3300005355 Bacteria 2700
49 Ga0070671_100175961 3300005355 Bacteria 1811
50 Ga0070674_100004521 3300005356 Bacteria 7942
51 Ga0070673_100003867 3300005364 Bacteria 9404
52 Ga0070673_100011490 3300005364 Bacteria 6044
53 Ga0070673_100323417 3300005364 Bacteria 1363
54 Ga0070688_100101391 3300005365 Bacteria 1899
55 Ga0070659_100178861 3300005366 Bacteria 1740
56 Ga0070659_100448678 3300005366 Bacteria 1094
57 Ga0070667_100272255 3300005367 Bacteria 1518
58 Ga0070667_100489373 3300005367 Bacteria 1127
59 Ga0070705_100378387 3300005440 Bacteria 1041
60 Ga0070700_100296782 3300005441 Bacteria 1178
61 Ga0070708_100097203 3300005445 Bacteria 2692
62 Ga0070708_100297401 3300005445 Bacteria 1520
63 Ga0070708_100485915 3300005445 Bacteria 1165
64 Ga0070678_100000398 3300005456 Bacteria 20455
65 Ga0070678_100009895 3300005456 Bacteria 5796
66 Ga0070678_100062895 3300005456 Bacteria 2743
67 Ga0070678_100122902 3300005456 Bacteria 2050
68 Ga0070678_100141001 3300005456 Bacteria 1929
69 Ga0070662_100008969 3300005457 Bacteria 6523
70 Ga0070662_100012076 3300005457 Bacteria 5718
71 Ga0070662_100046524 3300005457 Bacteria 3117
72 Ga0070662_100510467 3300005457 Bacteria 1003
73 Ga0068867_100004355 3300005459 Bacteria 9969
74 Ga0068867_100017384 3300005459 Bacteria 5109
75 Ga0068867_100130031 3300005459 Bacteria 1955
76 Ga0068867_100176986 3300005459 Bacteria 1693
77 Ga0068867_100285587 3300005459 Bacteria 1355
78 Ga0070706_100007532 3300005467 Bacteria 10201
79 Ga0070707_100358842 3300005468 Bacteria 1416
80 Ga0070699_100478102 3300005518 Bacteria 1131
81 Ga0068853_100016921 3300005539 Bacteria 6010
82 Ga0068853_100024284 3300005539 Bacteria 5081
83 Ga0068853_100250042 3300005539 Bacteria 1626
84 Ga0070672_100003734 3300005543 Bacteria 9910
85 Ga0070672_100004240 3300005543 Bacteria 9374
86 Ga0070672_100054960 3300005543 Bacteria 3118
87 Ga0070672_100409990 3300005543 Bacteria 1162
88 Ga0070665_100004618 3300005548 Bacteria 14398
89 Ga0070665_100016303 3300005548 Bacteria 7451
90 Ga0070665_100194216 3300005548 Bacteria 2031
91 Ga0068855_100216125 3300005563 Bacteria 2152
92 Ga0070664_100382730 3300005564 Bacteria 1285
93 Ga0068857_100028905 3300005577 Bacteria 4892
94 Ga0068857_100056586 3300005577 Bacteria 3481
95 Ga0068857_100058719 3300005577 Bacteria 3417
96 Ga0068854_100065746 3300005578 Bacteria 2637
97 Ga0068854_100072859 3300005578 Bacteria 2516
98 Ga0068854_100073459 3300005578 Bacteria 2507
99 Ga0068854_100174439 3300005578 Bacteria 1675
100 Ga0068854_100241109 3300005578 Bacteria 1440
101 Ga0068852_100002662 3300005616 Bacteria 12347
102 Ga0068852_100039777 3300005616 Bacteria 3961
103 Ga0068852_100148541 3300005616 Bacteria 2177
104 Ga0068852_100234058 3300005616 Bacteria 1752
105 Ga0068852_100301682 3300005616 Bacteria 1550
106 Ga0068852_100490102 3300005616 Bacteria 1222
107 Ga0068859_100087895 3300005617 Bacteria 3157
108 Ga0068859_100359453 3300005617 Bacteria 1551
109 Ga0068864_100009957 3300005618 Bacteria 7843
110 Ga0068864_100048639 3300005618 Bacteria 3646
111 Ga0068864_100083208 3300005618 Bacteria 2810
112 Ga0068866_10033634 3300005718 Bacteria 2489
113 Ga0068866_10045628 3300005718 Bacteria 2199
114 Ga0068861_100048529 3300005719 Bacteria 3210
115 Ga0068861_100204657 3300005719 Bacteria 1659
116 Ga0068851_10095804 3300005834 Bacteria 1568
117 Ga0068851_10130710 3300005834 Bacteria 1357
118 Ga0068851_10130713 3300005834 Bacteria 1357
119 Ga0068851_10137060 3300005834 Bacteria 1328
120 Ga0068870_10022067 3300005840 Bacteria 3124
121 Ga0068863_100001931 3300005841 Bacteria 20577
122 Ga0068863_100012511 3300005841 Bacteria 8188
123 Ga0068863_100067113 3300005841 Bacteria 3393
124 Ga0068863_100084529 3300005841 Bacteria 3007
125 Ga0068863_100210912 3300005841 Bacteria 1871
126 Ga0068863_100233499 3300005841 Bacteria 1774
127 Ga0068858_100013092 3300005842 Bacteria 7822
128 Ga0068858_100074254 3300005842 Bacteria 3157
129 Ga0068858_100218660 3300005842 Bacteria 1804
130 Ga0068860_100011527 3300005843 Bacteria 8714
131 Ga0068860_100013623 3300005843 Bacteria 7970
132 Ga0068860_100024666 3300005843 Bacteria 5807
133 Ga0068860_100258039 3300005843 Bacteria 1698
134 Ga0068862_100048424 3300005844 Bacteria 3628
135 Ga0068862_100287658 3300005844 Bacteria 1508
136 Ga0075363_100024634 3300006048 Bacteria 3061
137 Ga0075362_10009683 3300006177 Bacteria 3736
138 Ga0075362_10013812 3300006177 Bacteria 3243
139 Ga0075367_10006462 3300006178 Bacteria 5925
140 Ga0075367_10094150 3300006178 Bacteria 1826
141 Ga0075366_10006457 3300006195 Bacteria 6426
142 Ga0075366_10084447 3300006195 Bacteria 1898
143 Ga0075366_10098253 3300006195 Bacteria 1756
144 Ga0075366_10108795 3300006195 Bacteria 1667
145 Ga0075366_10119299 3300006195 Bacteria 1589
146 Ga0097621_100023757 3300006237 Bacteria 4777
147 Ga0097621_100384221 3300006237 Bacteria 1255
148 Ga0097621_100545876 3300006237 Bacteria 1054
149 Ga0097621_100667916 3300006237 Bacteria 955
150 Ga0075370_10005574 3300006353 Bacteria 6275
151 Ga0075370_10005601 3300006353 Bacteria 6263
152 Ga0068871_100020371 3300006358 Bacteria 5079
153 Ga0068871_100141939 3300006358 Bacteria 2043
154 Ga0068871_100320893 3300006358 Bacteria 1364
155 Ga0068871_100578135 3300006358 Bacteria 1020
156 Ga0075430_100053192 3300006846 Bacteria 3410
157 Ga0075430_100097174 3300006846 Bacteria 2461
158 Ga0075429_100000252 3300006880 Bacteria 36895
159 Ga0075429_100001373 3300006880 Bacteria 19922
160 Ga0068865_100100586 3300006881 Bacteria 2116
161 Ga0097620_100087897 3300006931 Bacteria 3157
162 Ga0097620_100359424 3300006931 Bacteria 1551
163 Ga0099826_10006947 3300006948 Bacteria 8298
164 Ga0105245_10013791 3300009098 Bacteria 7038
165 Ga0105245_10223609 3300009098 Bacteria 1818
166 Ga0105245_10585136 3300009098 Bacteria 1141
167 Ga0105243_10045820 3300009148 Bacteria 3438
168 Ga0105243_10567456 3300009148 Unclassified 1087
169 Ga0105243_10724162 3300009148 Bacteria 972
170 Ga0105241_10270527 3300009174 Bacteria 1447
171 Ga0105242_10096666 3300009176 Bacteria 2496
172 Ga0105248_10041700 3300009177 Bacteria 5146
173 Ga0105248_10093377 3300009177 Bacteria 3388
174 Ga0105248_10191457 3300009177 Bacteria 2305
175 Ga0105248_10303353 3300009177 Bacteria 1798
176 Ga0105248_10364616 3300009177 Bacteria 1627
177 Ga0105237_10021948 3300009545 Bacteria 6556
178 Ga0105237_10072295 3300009545 Bacteria 3443
179 Ga0105237_10162135 3300009545 Bacteria 2235
180 Ga0105237_10228775 3300009545 Bacteria 1860
181 Ga0105249_10287445 3300009553 Bacteria 1644
182 Ga0105239_10139175 3300010375 Bacteria 2704
183 Ga0105239_10142125 3300010375 Bacteria 2675
184 Ga0157373_10018374 3300013100 Bacteria 5092
185 Ga0157371_10384322 3300013102 Bacteria 1025
186 Ga0157370_10008352 3300013104 Bacteria 11168
187 Ga0157374_10740824 3300013296 Unclassified 997
188 Ga0157378_10031192 3300013297 Bacteria 4707
189 Ga0157378_10073491 3300013297 Bacteria 3074
190 Ga0157378_10302885 3300013297 Bacteria 1547
191 Ga0157378_10636974 3300013297 Bacteria 1080
192 Ga0163162_10003041 3300013306 Bacteria 16027
193 Ga0163162_10026576 3300013306 Bacteria 5722
194 Ga0163162_10347520 3300013306 Bacteria 1616
195 Ga0163162_10428509 3300013306 Bacteria 1455
196 Ga0163162_10496963 3300013306 Bacteria 1350
197 Ga0163162_10500344 3300013306 Bacteria 1346
198 Ga0157375_10018251 3300013308 Bacteria 6359
199 Ga0157375_10071975 3300013308 Bacteria 3472
200 Ga0157375_10639313 3300013308 Bacteria 1221
201 Ga0157375_10709841 3300013308 Bacteria 1159
202 Ga0157380_10122653 3300014326 Bacteria 2204
203 Ga0182008_10000821 3300014497 Bacteria 21644
204 Ga0157377_10144756 3300014745 Bacteria 1464
205 Ga0157379_10228061 3300014968 Bacteria 1688
206 Ga0157379_10282418 3300014968 Bacteria 1511
207 Ga0157379_10448294 3300014968 Bacteria 1191
208 Ga0157376_10065565 3300014969 Bacteria 3067
209 Ga0157376_10293402 3300014969 Bacteria 1536
210 Ga0182007_10001410 3300015262 Bacteria 12931
211 Ga0182007_10006552 3300015262 Bacteria 4991
212 Ga0183362_10001 3300015683 Bacteria 2046624
213 Ga0163161_10000455 3300017792 Bacteria 33945
214 Ga0163161_10059094 3300017792 Bacteria 2788
215 Ga0163161_10064797 3300017792 Bacteria 2666
216 Ga0163161_10244860 3300017792 Bacteria 1396
217 Ga0207425_1000710 3300025245 Bacteria 17927
218 Ga0209129_1000175 3300025258 Bacteria 93817
219 Ga0209025_1002169 3300025294 Bacteria 21834
220 Ga0209025_1028925 3300025294 Bacteria 2698
221 Ga0209564_1000136 3300025295 Bacteria 185198
222 Ga0209758_1002351 3300025297 Bacteria 19494
223 Ga0209256_1011882 3300025299 Bacteria 3417
224 Ga0207656_10073068 3300025321 Bacteria 1528
225 Ga0207656_10078945 3300025321 Bacteria 1476
226 Ga0207656_10094744 3300025321 Bacteria 1360
227 Ga0207655_1003776 3300025728 Bacteria 11096
228 Ga0207682_10002457 3300025893 Bacteria 8294
229 Ga0207682_10006893 3300025893 Bacteria 4558
230 Ga0207642_10014171 3300025899 Bacteria 2933
231 Ga0207642_10237851 3300025899 Bacteria 1027
232 Ga0207688_10057426 3300025901 Bacteria 2188
233 Ga0207688_10197644 3300025901 Bacteria 1205
234 Ga0207680_10001975 3300025903 Bacteria 9595
235 Ga0207680_10021042 3300025903 Bacteria 3523
236 Ga0207647_10094228 3300025904 Bacteria 1784
237 Ga0207645_10000826 3300025907 Bacteria 25958
238 Ga0207645_10005745 3300025907 Bacteria 8953
239 Ga0207645_10015239 3300025907 Bacteria 5117
240 Ga0207645_10027960 3300025907 Bacteria 3640
241 Ga0207645_10044329 3300025907 Bacteria 2846
242 Ga0207643_10003681 3300025908 Bacteria 8254
243 Ga0207643_10035911 3300025908 Bacteria 2780
244 Ga0207684_10005490 3300025910 Bacteria 11680
245 Ga0207671_10035824 3300025914 Bacteria 3680
246 Ga0207649_10017203 3300025920 Bacteria 4096
247 Ga0207681_10110758 3300025923 Bacteria 1996
248 Ga0207681_10128608 3300025923 Bacteria 1869
249 Ga0207681_10379900 3300025923 Bacteria 1137
250 Ga0207694_10277186 3300025924 Bacteria 1377
251 Ga0207650_10060178 3300025925 Bacteria 2834
252 Ga0207650_10063987 3300025925 Bacteria 2752
253 Ga0207659_10001543 3300025926 Bacteria 13671
254 Ga0207659_10005705 3300025926 Bacteria 7579
255 Ga0207659_10022475 3300025926 Bacteria 4200
256 Ga0207687_10359340 3300025927 Bacteria 1188
257 Ga0207700_10000778 3300025928 Bacteria 18406
258 Ga0207644_10016181 3300025931 Bacteria 5018
259 Ga0207644_10019721 3300025931 Bacteria 4578
260 Ga0207644_10026660 3300025931 Bacteria 3985
261 Ga0207644_10076898 3300025931 Bacteria 2457
262 Ga0207644_10278898 3300025931 Bacteria 1341
263 Ga0207644_10311044 3300025931 Bacteria 1272
264 Ga0207706_10003957 3300025933 Bacteria 14039
265 Ga0207706_10012395 3300025933 Bacteria 7766
266 Ga0207706_10350869 3300025933 Bacteria 1283
267 Ga0207706_10405561 3300025933 Bacteria 1181
268 Ga0207686_10019645 3300025934 Bacteria 3846
269 Ga0207686_10134261 3300025934 Bacteria 1701
270 Ga0207709_10004788 3300025935 Bacteria 7757
271 Ga0207709_10027761 3300025935 Bacteria 3265
272 Ga0207669_10000571 3300025937 Bacteria 16059
273 Ga0207669_10070304 3300025937 Bacteria 2194
274 Ga0207669_10131755 3300025937 Bacteria 1719
275 Ga0207669_10407884 3300025937 Unclassified 1066
276 Ga0207704_10017603 3300025938 Bacteria 3710
277 Ga0207704_10186501 3300025938 Bacteria 1504
278 Ga0207691_10003141 3300025940 Bacteria 16144
279 Ga0207691_10004497 3300025940 Bacteria 13499
280 Ga0207691_10056580 3300025940 Bacteria 3572
281 Ga0207691_10124646 3300025940 Bacteria 2280
282 Ga0207691_10145528 3300025940 Bacteria 2086
283 Ga0207691_10154746 3300025940 Bacteria 2014
284 Ga0207691_10445463 3300025940 Bacteria 1102
285 Ga0207711_10024344 3300025941 Bacteria 5071
286 Ga0207711_10044869 3300025941 Bacteria 3775
287 Ga0207711_10049221 3300025941 Bacteria 3608
288 Ga0207711_10055944 3300025941 Bacteria 3388
289 Ga0207711_10162989 3300025941 Bacteria 2019
290 Ga0207689_10002401 3300025942 Bacteria 17436
291 Ga0207689_10021604 3300025942 Bacteria 5411
292 Ga0207689_10024922 3300025942 Bacteria 5014
293 Ga0207667_10232038 3300025949 Bacteria 1889
294 Ga0207651_10001433 3300025960 Bacteria 10856
295 Ga0207651_10006294 3300025960 Bacteria 6192
296 Ga0207651_10014813 3300025960 Bacteria 4513
297 Ga0207651_10032669 3300025960 Bacteria 3346
298 Ga0207651_10667700 3300025960 Bacteria 913
299 Ga0207712_10043545 3300025961 Bacteria 3097
300 Ga0207668_10056325 3300025972 Bacteria 2737
301 Ga0207668_10124052 3300025972 Bacteria 1960
302 Ga0207640_10017275 3300025981 Bacteria 4219
303 Ga0207640_10048699 3300025981 Bacteria 2741
304 Ga0207658_10014296 3300025986 Bacteria 5435
305 Ga0207658_10057630 3300025986 Bacteria 2888
306 Ga0207658_10058550 3300025986 Bacteria 2867
307 Ga0207658_10083324 3300025986 Bacteria 2457
308 Ga0207658_10346605 3300025986 Bacteria 1292
309 Ga0207677_10005265 3300026023 Bacteria 7007
310 Ga0207677_10102412 3300026023 Bacteria 2111
311 Ga0207677_10152915 3300026023 Bacteria 1783
312 Ga0207677_10239203 3300026023 Bacteria 1468
313 Ga0207703_10003506 3300026035 Bacteria 13120
314 Ga0207703_10041497 3300026035 Bacteria 3687
315 Ga0207639_10045975 3300026041 Bacteria 3291
316 Ga0207639_10130971 3300026041 Bacteria 2076
317 Ga0207639_10175738 3300026041 Bacteria 1818
318 Ga0207678_10043836 3300026067 Bacteria 3870
319 Ga0207678_10059048 3300026067 Bacteria 3300
320 Ga0207678_10110370 3300026067 Bacteria 2347
321 Ga0207678_10161850 3300026067 Bacteria 1911
322 Ga0207678_10166101 3300026067 Bacteria 1884
323 Ga0207708_10257034 3300026075 Bacteria 1409
324 Ga0207641_10006666 3300026088 Bacteria 9694
325 Ga0207641_10027261 3300026088 Bacteria 4718
326 Ga0207641_10055436 3300026088 Bacteria 3366
327 Ga0207641_10093075 3300026088 Bacteria 2641
328 Ga0207641_10093365 3300026088 Bacteria 2637
329 Ga0207641_10147091 3300026088 Bacteria 2131
330 Ga0207641_10237618 3300026088 Bacteria 1696
331 Ga0207648_10016057 3300026089 Bacteria 6860
332 Ga0207648_10028845 3300026089 Bacteria 4918
333 Ga0207648_10139034 3300026089 Bacteria 2140
334 Ga0207648_10370673 3300026089 Bacteria 1293
335 Ga0207676_10007619 3300026095 Bacteria 7687
336 Ga0207676_10093925 3300026095 Bacteria 2470
337 Ga0207676_10100612 3300026095 Bacteria 2395
338 Ga0207676_10125177 3300026095 Bacteria 2175
339 Ga0207676_10615710 3300026095 Bacteria 1044
340 Ga0207674_10016125 3300026116 Bacteria 8186
341 Ga0207674_10024347 3300026116 Bacteria 6471
342 Ga0207674_10110706 3300026116 Bacteria 2721
343 Ga0207675_100015712 3300026118 Bacteria 7060
344 Ga0207675_100046909 3300026118 Bacteria 4036
345 Ga0207683_10000463 3300026121 Bacteria 37729
346 Ga0207683_10019843 3300026121 Bacteria 5742
347 Ga0207683_10040790 3300026121 Bacteria 4053
348 Ga0207683_10089894 3300026121 Bacteria 2734
349 Ga0207683_10120320 3300026121 Bacteria 2357
350 Ga0207683_10523927 3300026121 Bacteria 1095
351 Ga0207698_10009889 3300026142 Bacteria 6099
352 Ga0207698_10020872 3300026142 Bacteria 4519
353 Ga0207698_10079337 3300026142 Bacteria 2640
354 Ga0207698_10354818 3300026142 Bacteria 1386
355 Ga0207698_10468585 3300026142 Bacteria 1219
356 Ga0209282_1063854 3300027666 Bacteria 2039
357 Ga0268266_10011978 3300028379 Bacteria 7507
358 Ga0268266_10043800 3300028379 Bacteria 3825
359 Ga0268266_10111513 3300028379 Bacteria 2424
360 Ga0268266_10178681 3300028379 Bacteria 1931
361 Ga0268266_10188566 3300028379 Bacteria 1882
362 Ga0268265_10124179 3300028380 Bacteria 2133
363 Ga0268265_10165258 3300028380 Bacteria 1885
364 Ga0268265_10204212 3300028380 Bacteria 1716
365 Ga0268265_10535364 3300028380 Bacteria 1110
366 Ga0268264_10347615 3300028381 Bacteria 1410
367 Ga0268264_10497527 3300028381 Bacteria 1188
368 Ga0265324_10058861 3300029957 Bacteria 1314
369 Ga0265331_10000584 3300031250 Bacteria 32625
370 Ga0265327_10000120 3300031251 Bacteria 171108
371 Ga0307513_10039048 3300031456 Bacteria 5265
372 Ga0307513_10242931 3300031456 Bacteria 1604
373 Ga0307509_10067401 3300031507 Bacteria 3750
374 Ga0307408_100003655 3300031548 Bacteria 10482
375 Ga0307408_100196958 3300031548 Bacteria 1627
376 Ga0307516_10076654 3300031730 Bacteria 3195
377 Ga0307405_10013385 3300031731 Bacteria 4373
378 Ga0307410_10005131 3300031852 Bacteria 6884
379 Ga0307406_10004975 3300031901 Bacteria 7241
380 Ga0307406_10156807 3300031901 Bacteria 1631
381 Ga0307407_10007138 3300031903 Bacteria 5036
382 Ga0307412_10007226 3300031911 Bacteria 6299
383 Ga0307412_10105903 3300031911 Bacteria 1998
384 Ga0307409_100220337 3300031995 Bacteria 1712
385 Ga0307416_100054608 3300032002 Bacteria 3212
386 Ga0307416_100112690 3300032002 Bacteria 2401
387 Ga0307414_10011995 3300032004 Bacteria 5109
388 Ga0307411_10038023 3300032005 Bacteria 3031
389 Ga0307415_100077455 3300032126 Bacteria 2361
390 Ga0373946_0200221 3300035171 Bacteria 956
391 Ga0373935_0248656 3300035692 Bacteria 1244
392 Ga0373937_0176620 3300036401 Bacteria 2005
393 Ga0373925_0157029 3300037068 Bacteria 1790
394 Ga0395905_0045696 3300037471 Bacteria 4107
395 Ga0439436_0000092 3300041404 Bacteria 21425
396 Ga0439436_0000765 3300041404 Bacteria 8700
397 Ga0439436_0002159 3300041404 Bacteria 5882
398 Ga0439436_0041210 3300041404 Bacteria 1322
399 Ga0439439_0000021 3300041406 Bacteria 22666
400 Ga0439447_002462 3300041407 Bacteria 6737
401 Ga0439466_0004033 3300041411 Bacteria 5668
402 Ga0439466_0046235 3300041411 Bacteria 1438
403 Ga0439466_0048803 3300041411 Bacteria 1391
404 Ga0439465_0011337 3300041413 Bacteria 2797
405 Ga0439465_0037369 3300041413 Bacteria 1561
406 Ga0451853_1576222 3300041512 Bacteria 1815
407 Ga0439431_0011132 3300041997 Bacteria 2051
408 Ga0439431_0057859 3300041997 Bacteria 1015
409 Ga0439433_0000171 3300041999 Bacteria 10131
410 Ga0439442_001937 3300042002 Bacteria 4067
411 Ga0439442_005458 3300042002 Bacteria 2543
412 Ga0439445_0003359 3300042004 Bacteria 3590
413 Ga0439445_0022658 3300042004 Bacteria 1585
414 Ga0439445_0030789 3300042004 Bacteria 1392
415 Ga0439432_000936 3300042006 Bacteria 10984
416 Ga0439449_0000003 3300042007 Bacteria 94735
417 Ga0439449_0002393 3300042007 Bacteria 7339
418 Ga0439449_0004373 3300042007 Bacteria 5452
419 Ga0439449_0011900 3300042007 Bacteria 3271
420 Ga0439452_001024 3300042010 Bacteria 12386
421 Ga0439452_001607 3300042010 Bacteria 8928
422 Ga0439452_020073 3300042010 Bacteria 1757
423 Ga0439457_008629 3300042014 Bacteria 2396
424 Ga0439462_0000090 3300042015 Bacteria 14033
425 Ga0439462_0002699 3300042015 Bacteria 4167
426 Ga0439462_0002999 3300042015 Bacteria 4008
427 Ga0439462_0015039 3300042015 Bacteria 1991
428 Ga0450911_000447 3300042115 Bacteria 13425
429 Ga0450919_000220 3300042121 Bacteria 6343
430 Ga0450890_006694 3300042127 Bacteria 1473
431 Ga0450897_001318 3300042128 Bacteria 1667
432 Ga0450897_001755 3300042128 Bacteria 1527
433 Ga0450898_000619 3300042134 Bacteria 4265
434 Ga0450906_007321 3300042145 Bacteria 2183
435 Ga0450906_011701 3300042145 Bacteria 1637
436 Ga0450910_030711 3300042147 Bacteria 843
437 Ga0439446_0009526 3300042156 Bacteria 2602
438 Ga0439446_0018809 3300042156 Bacteria 1939
439 Ga0439458_0048445 3300042157 Bacteria 1045
440 Ga0450908_009765 3300042184 Bacteria 1778
441 Ga0439434_0000809 3300042435 Bacteria 9017
442 Ga0439434_0001183 3300042435 Bacteria 7512
443 Ga0439434_0009002 3300042435 Bacteria 2934
444 Ga0439434_0015535 3300042435 Bacteria 2271
445 Ga0439434_0020902 3300042435 Bacteria 1966
446 Ga0439464_0014721 3300042439 Bacteria 2106
447 Ga0450918_000061 3300042531 Bacteria 21919
448 Ga0450918_000214 3300042531 Bacteria 13184
449 Ga0451577_0012006 3300042876 Bacteria 8156
450 Ga0453684_0000789 3300044712 Bacteria 108459
451 Ga0451576_0004381 3300045051 Bacteria 18394
452 Ga0495651_0086582 3300046462 Bacteria 2357
453 Ga0495650_0005268 3300046471 Bacteria 8469
454 Ga0495650_0005465 3300046471 Bacteria 8243
455 Ga0495580_0016185 3300046472 Bacteria 5604
456 Ga0495639_0094652 3300046475 Bacteria 1405
457 Ga0495594_0025711 3300046499 Bacteria 3165
458 Ga0495643_0031229 3300046522 Bacteria 2966
459 Ga0495666_0037981 3300046526 Bacteria 2342
460 Ga0495642_0157473 3300046528 Bacteria 984
461 Ga0495665_0006189 3300046531 Bacteria 6465
462 Ga0495645_0148836 3300046543 Bacteria 1628
463 Ga0495622_0069399 3300046557 Bacteria 1627
464 Ga0495656_0006776 3300046615 Bacteria 4026
465 Ga0495656_0031968 3300046615 Bacteria 2138
466 Ga0495588_0037506 3300046674 Bacteria 2463
467 Ga0495646_0135380 3300046680 Bacteria 1383
468 Ga0495658_0191077 3300046683 Bacteria 1273
469 Ga0495624_0023189 3300046690 Bacteria 4094
470 Ga0495600_0247320 3300046809 Bacteria 1135
471 Ga0495604_0028126 3300047317 Bacteria 4472
472 Ga0495636_0000270 3300047318 Bacteria 20561
473 Ga0495685_089973 3300047447 Bacteria 1018
474 Ga0495681_0085685 3300047470 Bacteria 1399
475 Ga0495684_0143418 3300047471 Bacteria 1790
476 Ga0496101_0275266 3300048904 Bacteria 1315
477 Ga0496102_0000852 3300048905 Bacteria 29264
478 Ga0496104_0029371 3300048907 Bacteria 5099
479 Ga0496104_0101152 3300048907 Bacteria 2759
480 Ga0496105_0018628 3300048908 Bacteria 5587
481 Ga0496107_0111136 3300048910 Bacteria 2014
482 Ga0496107_0322247 3300048910 Bacteria 1150
483 Ga0496108_0099726 3300048911 Bacteria 2476
484 Ga0496108_0205535 3300048911 Bacteria 1709
485 Ga0496108_0386989 3300048911 Bacteria 1221
486 Ga0496108_0437499 3300048911 Bacteria 1142
487 Ga0496108_0496341 3300048911 Bacteria 1066
488 Ga0496109_0052712 3300048912 Bacteria 3709
489 Ga0496109_0061321 3300048912 Bacteria 3438
490 Ga0496109_0247320 3300048912 Bacteria 1679
491 Ga0496109_0418496 3300048912 Bacteria 1266
492 Ga0496110_0007171 3300048913 Bacteria 8876
493 Ga0496110_0173544 3300048913 Bacteria 1956
494 Ga0496110_0422115 3300048913 Bacteria 1216
495 Ga0496110_0542452 3300048913 Bacteria 1057
496 Ga0496112_0002412 3300048915 Bacteria 15055
497 Ga0496112_0009210 3300048915 Bacteria 8874
498 Ga0496112_0184411 3300048915 Bacteria 2050
499 Ga0496112_0288970 3300048915 Bacteria 1586
500 Ga0496114_0366136 3300048917 Bacteria 1275
501 Ga0496116_0074533 3300048919 Bacteria 2134
502 Ga0496118_0022943 3300048921 Bacteria 5437
503 Ga0496119_0192756 3300048922 Bacteria 1061
504 Ga0496121_0021940 3300048924 Bacteria 6228
505 Ga0496121_0055111 3300048924 Bacteria 3315
506 Ga0496122_0177168 3300048925 Bacteria 1277
507 Ga0496125_0048389 3300048928 Bacteria 3547
508 Ga0496126_0065880 3300048929 Bacteria 3240
509 Ga0501031_0035945 3300049568 Bacteria 3231
510 Ga0501032_0007274 3300049569 Bacteria 8099
511 Ga0501033_0001305 3300049570 Bacteria 22157
512 Ga0501037_0001243 3300049573 Bacteria 18791
513 Ga0501043_0000003 3300049579 Bacteria 318844
514 Ga0501068_0018987 3300049584 Bacteria 3985
515 Ga0501069_0000263 3300049585 Bacteria 23824
516 Ga0501070_0000774 3300049586 Bacteria 29131
517 Ga0501071_0035556 3300049587 Bacteria 3548
518 Ga0501073_0045197 3300049589 Bacteria 3102
519 Ga0501074_0000565 3300049590 Bacteria 22957
520 Ga0501198_000027 3300049649 Bacteria 65442
521 Ga0501222_000026 3300049662 Bacteria 63988
522 Ga0501080_0000071 3300049742 Bacteria 67464
523 Ga0501083_0000083 3300049744 Bacteria 63951
524 Ga0501035_0000083 3300049822 Bacteria 117302
525 Ga0501035_0042879 3300049822 Bacteria 4079
526 Ga0501044_0003070 3300049823 Bacteria 18892
527 nmdc:mga03683_24673_c1 3300050489 Bacteria 2355
528 nmdc:mga03n38_44918_c1 3300050490 Bacteria 1943
529 nmdc:mga0k408_120936_c1 3300050493 Bacteria 1551
530 nmdc:mga0k408_132771_c1 3300050493 Bacteria 1478
531 nmdc:mga0k408_178330_c1 3300050493 Bacteria 1267
532 nmdc:mga0k408_24016_c1 3300050493 Bacteria 3443
533 nmdc:mga0k408_32418_c1 3300050493 Bacteria 2985
534 nmdc:mga0k408_986_c1 3300050493 Bacteria 15635
535 nmdc:mga06z11_15689_c1 3300050494 Bacteria 3388
536 nmdc:mga06z11_89443_c1 3300050494 Bacteria 1669
537 nmdc:mga07m45_10533_c2 3300050496 Bacteria 2302
538 nmdc:mga07m45_116355_c1 3300050496 Bacteria 1542
539 nmdc:mga07m45_14972_c1 3300050496 Bacteria 4140
540 nmdc:mga07m45_1838_c1 3300050496 Bacteria 9802
541 nmdc:mga07m45_3092_c1 3300050496 Bacteria 7957
542 nmdc:mga07m45_5811_c1 3300050496 Bacteria 6184
543 nmdc:mga07m45_79596_c1 3300050496 Bacteria 1871
544 nmdc:mga09592_1513_c1 3300050508 Bacteria 18722
545 nmdc:mga09592_50340_c1 3300050508 Bacteria 3514
546 nmdc:mga0qj67_142385_c1 3300050509 Bacteria 1944
547 Ga0495595_0073826 3300053084 Bacteria 1616
548 2524443366 2524023205 Bacteria 8918781
549 2587732818 2585428058 Bacteria 6853932
550 2644159196 2643221628 Bacteria 5745828
551 2644245275 2643221644 Bacteria 6865017
552 2644401370 2643221672 Bacteria 6322190
553 2728754106 2728368998 Bacteria 8720350
554 2745075627 2744054633 Bacteria 8678936
555 2881101528 2881101125 Bacteria 4590519
556 2900641829 2900634093 Bacteria 10263517
557 2904450026 2904449895 Bacteria 6927402
558 2904457158 2904456579 Bacteria 6819253
559 2939632935 2939631187 Bacteria 6118131
560 Ga0070676_10001656
561 JGI25152J39213_1001278
562 JGI25151J46595_10003564
563 JGI25153J46596_10001018
564 Ga0055526_1001244
565 Ga0070676_10010396
566 Ga0070676_10116429
567 Ga0070676_10120746
568 Ga0070690_100021694
569 Ga0070690_100036267
570 Ga0070670_100061134
571 Ga0070670_100126338
572 Ga0070670_100131895
573 Ga0070670_100160325
574 Ga0070670_100283584
575 Ga0070670_100405162
576 Ga0070670_100645231
577 Ga0070677_10010100
578 Ga0070677_10022039
579 Ga0068869_100015211
580 Ga0068869_100043324
581 Ga0070666_10002356
582 Ga0070666_10015312
583 Ga0070666_10029851
584 Ga0070666_10073615
585 Ga0068868_100004021
586 Ga0068868_100015163
587 Ga0068868_100136762
588 Ga0068868_100264170
589 Ga0068868_100411940
590 Ga0070689_100016060
591 Ga0070689_100394356
592 Ga0070687_100003277
593 Ga0070661_100007761
594 Ga0070661_100233393
595 Ga0070661_100469664
596 Ga0070668_100002946
597 Ga0070669_100064434
598 Ga0070669_100107577
599 Ga0070675_100008803
600 Ga0070675_100079934
601 Ga0070675_100112092
602 Ga0070675_100207205
603 Ga0070671_100000534
604 Ga0070671_100001751
605 Ga0070671_100004653
606 Ga0070671_100009290
607 Ga0070671_100081834
608 Ga0070671_100175961
609 Ga0070674_100004521
610 Ga0070673_100003867
611 Ga0070673_100011490
612 Ga0070673_100323417
613 Ga0070688_100101391
614 Ga0070659_100178861
615 Ga0070659_100448678
616 Ga0070667_100272255
617 Ga0070667_100489373
618 Ga0070705_100378387
619 Ga0070700_100296782
620 Ga0070708_100097203
621 Ga0070708_100297401
622 Ga0070708_100485915
623 Ga0070678_100000398
624 Ga0070678_100009895
625 Ga0070678_100062895
626 Ga0070678_100122902
627 Ga0070678_100141001
628 Ga0070662_100008969
629 Ga0070662_100012076
630 Ga0070662_100046524
631 Ga0070662_100510467
632 Ga0068867_100004355
633 Ga0068867_100017384
634 Ga0068867_100130031
635 Ga0068867_100176986
636 Ga0068867_100285587
637 Ga0070706_100007532
638 Ga0070707_100358842
639 Ga0070699_100478102
640 Ga0068853_100016921
641 Ga0068853_100024284
642 Ga0068853_100250042
643 Ga0070672_100003734
644 Ga0070672_100004240
645 Ga0070672_100054960
646 Ga0070672_100409990
647 Ga0070665_100004618
648 Ga0070665_100016303
649 Ga0070665_100194216
650 Ga0068855_100216125
651 Ga0070664_100382730
652 Ga0068857_100028905
653 Ga0068857_100056586
654 Ga0068857_100058719
655 Ga0068854_100065746
656 Ga0068854_100072859
657 Ga0068854_100073459
658 Ga0068854_100174439
659 Ga0068854_100241109
660 Ga0068852_100002662
661 Ga0068852_100039777
662 Ga0068852_100148541
663 Ga0068852_100234058
664 Ga0068852_100301682
665 Ga0068852_100490102
666 Ga0068859_100087895
667 Ga0068859_100359453
668 Ga0068864_100009957
669 Ga0068864_100048639
670 Ga0068864_100083208
671 Ga0068866_10033634
672 Ga0068866_10045628
673 Ga0068861_100048529
674 Ga0068861_100204657
675 Ga0068851_10095804
676 Ga0068851_10130710
677 Ga0068851_10130713
678 Ga0068851_10137060
679 Ga0068870_10022067
680 Ga0068863_100001931
681 Ga0068863_100012511
682 Ga0068863_100067113
683 Ga0068863_100084529
684 Ga0068863_100210912
685 Ga0068863_100233499
686 Ga0068858_100013092
687 Ga0068858_100074254
688 Ga0068858_100218660
689 Ga0068860_100011527
690 Ga0068860_100013623
691 Ga0068860_100024666
692 Ga0068860_100258039
693 Ga0068862_100048424
694 Ga0068862_100287658
695 Ga0075363_100024634
696 Ga0075362_10009683
697 Ga0075362_10013812
698 Ga0075367_10006462
699 Ga0075367_10094150
700 Ga0075366_10006457
701 Ga0075366_10084447
702 Ga0075366_10098253
703 Ga0075366_10108795
704 Ga0075366_10119299
705 Ga0097621_100023757
706 Ga0097621_100384221
707 Ga0097621_100545876
708 Ga0097621_100667916
709 Ga0075370_10005574
710 Ga0075370_10005601
711 Ga0068871_100020371
712 Ga0068871_100141939
713 Ga0068871_100320893
714 Ga0068871_100578135
715 Ga0075430_100053192
716 Ga0075430_100097174
717 Ga0075429_100000252
718 Ga0075429_100001373
719 Ga0068865_100100586
720 Ga0097620_100087897
721 Ga0097620_100359424
722 Ga0099826_10006947
723 Ga0105245_10013791
724 Ga0105245_10223609
725 Ga0105245_10585136
726 Ga0105243_10045820
727 Ga0105243_10567456
728 Ga0105243_10724162
729 Ga0105241_10270527
730 Ga0105242_10096666
731 Ga0105248_10041700
732 Ga0105248_10093377
733 Ga0105248_10191457
734 Ga0105248_10303353
735 Ga0105248_10364616
736 Ga0105237_10021948
737 Ga0105237_10072295
738 Ga0105237_10162135
739 Ga0105237_10228775
740 Ga0105249_10287445
741 Ga0105239_10139175
742 Ga0105239_10142125
743 Ga0157373_10018374
744 Ga0157371_10384322
745 Ga0157370_10008352
746 Ga0157374_10740824
747 Ga0157378_10031192
748 Ga0157378_10073491
749 Ga0157378_10302885
750 Ga0157378_10636974
751 Ga0163162_10003041
752 Ga0163162_10026576
753 Ga0163162_10347520
754 Ga0163162_10428509
755 Ga0163162_10496963
756 Ga0163162_10500344
757 Ga0157375_10018251
758 Ga0157375_10071975
759 Ga0157375_10639313
760 Ga0157375_10709841
761 Ga0157380_10122653
762 Ga0182008_10000821
763 Ga0157377_10144756
764 Ga0157379_10228061
765 Ga0157379_10282418
766 Ga0157379_10448294
767 Ga0157376_10065565
768 Ga0157376_10293402
769 Ga0182007_10001410
770 Ga0182007_10006552
771 Ga0183362_10001
772 Ga0163161_10000455
773 Ga0163161_10059094
774 Ga0163161_10064797
775 Ga0163161_10244860
776 Ga0207425_1000710
777 Ga0209129_1000175
778 Ga0209025_1002169
779 Ga0209025_1028925
780 Ga0209564_1000136
781 Ga0209758_1002351
782 Ga0209256_1011882
783 Ga0207656_10073068
784 Ga0207656_10078945
785 Ga0207656_10094744
786 Ga0207655_1003776
787 Ga0207682_10002457
788 Ga0207682_10006893
789 Ga0207642_10014171
790 Ga0207642_10237851
791 Ga0207688_10057426
792 Ga0207688_10197644
793 Ga0207680_10001975
794 Ga0207680_10021042
795 Ga0207647_10094228
796 Ga0207645_10000826
797 Ga0207645_10005745
798 Ga0207645_10015239
799 Ga0207645_10027960
800 Ga0207645_10044329
801 Ga0207643_10003681
802 Ga0207643_10035911
803 Ga0207684_10005490
804 Ga0207671_10035824
805 Ga0207649_10017203
806 Ga0207681_10110758
807 Ga0207681_10128608
808 Ga0207681_10379900
809 Ga0207694_10277186
810 Ga0207650_10060178
811 Ga0207650_10063987
812 Ga0207659_10001543
813 Ga0207659_10005705
814 Ga0207659_10022475
815 Ga0207687_10359340
816 Ga0207700_10000778
817 Ga0207644_10016181
818 Ga0207644_10019721
819 Ga0207644_10026660
820 Ga0207644_10076898
821 Ga0207644_10278898
822 Ga0207644_10311044
823 Ga0207706_10003957
824 Ga0207706_10012395
825 Ga0207706_10350869
826 Ga0207706_10405561
827 Ga0207686_10019645
828 Ga0207686_10134261
829 Ga0207709_10004788
830 Ga0207709_10027761
831 Ga0207669_10000571
832 Ga0207669_10070304
833 Ga0207669_10131755
834 Ga0207669_10407884
835 Ga0207704_10017603
836 Ga0207704_10186501
837 Ga0207691_10003141
838 Ga0207691_10004497
839 Ga0207691_10056580
840 Ga0207691_10124646
841 Ga0207691_10145528
842 Ga0207691_10154746
843 Ga0207691_10445463
844 Ga0207711_10024344
845 Ga0207711_10044869
846 Ga0207711_10049221
847 Ga0207711_10055944
848 Ga0207711_10162989
849 Ga0207689_10002401
850 Ga0207689_10021604
851 Ga0207689_10024922
852 Ga0207667_10232038
853 Ga0207651_10001433
854 Ga0207651_10006294
855 Ga0207651_10014813
856 Ga0207651_10032669
857 Ga0207651_10667700
858 Ga0207712_10043545
859 Ga0207668_10056325
860 Ga0207668_10124052
861 Ga0207640_10017275
862 Ga0207640_10048699
863 Ga0207658_10014296
864 Ga0207658_10057630
865 Ga0207658_10058550
866 Ga0207658_10083324
867 Ga0207658_10346605
868 Ga0207677_10005265
869 Ga0207677_10102412
870 Ga0207677_10152915
871 Ga0207677_10239203
872 Ga0207703_10003506
873 Ga0207703_10041497
874 Ga0207639_10045975
875 Ga0207639_10130971
876 Ga0207639_10175738
877 Ga0207678_10043836
878 Ga0207678_10059048
879 Ga0207678_10110370
880 Ga0207678_10161850
881 Ga0207678_10166101
882 Ga0207708_10257034
883 Ga0207641_10006666
884 Ga0207641_10027261
885 Ga0207641_10055436
886 Ga0207641_10093075
887 Ga0207641_10093365
888 Ga0207641_10147091
889 Ga0207641_10237618
890 Ga0207648_10016057
891 Ga0207648_10028845
892 Ga0207648_10139034
893 Ga0207648_10370673
894 Ga0207676_10007619
895 Ga0207676_10093925
896 Ga0207676_10100612
897 Ga0207676_10125177
898 Ga0207676_10615710
899 Ga0207674_10016125
900 Ga0207674_10024347
901 Ga0207674_10110706
902 Ga0207675_100015712
903 Ga0207675_100046909
904 Ga0207683_10000463
905 Ga0207683_10019843
906 Ga0207683_10040790
907 Ga0207683_10089894
908 Ga0207683_10120320
909 Ga0207683_10523927
910 Ga0207698_10009889
911 Ga0207698_10020872
912 Ga0207698_10079337
913 Ga0207698_10354818
914 Ga0207698_10468585
915 Ga0209282_1063854
916 Ga0268266_10011978
917 Ga0268266_10043800
918 Ga0268266_10111513
919 Ga0268266_10178681
920 Ga0268266_10188566
921 Ga0268265_10124179
922 Ga0268265_10165258
923 Ga0268265_10204212
924 Ga0268265_10535364
925 Ga0268264_10347615
926 Ga0268264_10497527
927 Ga0265324_10058861
928 Ga0265331_10000584
929 Ga0265327_10000120
930 Ga0307513_10039048
931 Ga0307513_10242931
932 Ga0307509_10067401
933 Ga0307408_100003655
934 Ga0307408_100196958
935 Ga0307516_10076654
936 Ga0307405_10013385
937 Ga0307410_10005131
938 Ga0307406_10004975
939 Ga0307406_10156807
940 Ga0307407_10007138
941 Ga0307412_10007226
942 Ga0307412_10105903
943 Ga0307409_100220337
944 Ga0307416_100054608
945 Ga0307416_100112690
946 Ga0307414_10011995
947 Ga0307411_10038023
948 Ga0307415_100077455
949 Ga0373946_0200221
950 Ga0373935_0248656
951 Ga0373937_0176620
952 Ga0373925_0157029
953 Ga0395905_0045696
954 Ga0439436_0000092
955 Ga0439436_0000765
956 Ga0439436_0002159
957 Ga0439436_0041210
958 Ga0439439_0000021
959 Ga0439447_002462
960 Ga0439466_0004033
961 Ga0439466_0046235
962 Ga0439466_0048803
963 Ga0439465_0011337
964 Ga0439465_0037369
965 Ga0451853_1576222
966 Ga0439431_0011132
967 Ga0439431_0057859
968 Ga0439433_0000171
969 Ga0439442_001937
970 Ga0439442_005458
971 Ga0439445_0003359
972 Ga0439445_0022658
973 Ga0439445_0030789
974 Ga0439432_000936
975 Ga0439449_0000003
976 Ga0439449_0002393
977 Ga0439449_0004373
978 Ga0439449_0011900
979 Ga0439452_001024
980 Ga0439452_001607
981 Ga0439452_020073
982 Ga0439457_008629
983 Ga0439462_0000090
984 Ga0439462_0002699
985 Ga0439462_0002999
986 Ga0439462_0015039
987 Ga0450911_000447
988 Ga0450919_000220
989 Ga0450890_006694
990 Ga0450897_001318
991 Ga0450897_001755
992 Ga0450898_000619
993 Ga0450906_007321
994 Ga0450906_011701
995 Ga0450910_030711
996 Ga0439446_0009526
997 Ga0439446_0018809
998 Ga0439458_0048445
999 Ga0450908_009765
1000 Ga0439434_0000809
1001 Ga0439434_0001183
1002 Ga0439434_0009002
1003 Ga0439434_0015535
1004 Ga0439434_0020902
1005 Ga0439464_0014721
1006 Ga0450918_000061
1007 Ga0450918_000214
1008 Ga0451577_0012006
1009 Ga0453684_0000789
1010 Ga0451576_0004381
1011 Ga0495651_0086582
1012 Ga0495650_0005268
1013 Ga0495650_0005465
1014 Ga0495580_0016185
1015 Ga0495639_0094652
1016 Ga0495594_0025711
1017 Ga0495643_0031229
1018 Ga0495666_0037981
1019 Ga0495642_0157473
1020 Ga0495665_0006189
1021 Ga0495645_0148836
1022 Ga0495622_0069399
1023 Ga0495656_0006776
1024 Ga0495656_0031968
1025 Ga0495588_0037506
1026 Ga0495646_0135380
1027 Ga0495658_0191077
1028 Ga0495624_0023189
1029 Ga0495600_0247320
1030 Ga0495604_0028126
1031 Ga0495636_0000270
1032 Ga0495685_089973
1033 Ga0495681_0085685
1034 Ga0495684_0143418
1035 Ga0496101_0275266
1036 Ga0496102_0000852
1037 Ga0496104_0029371
1038 Ga0496104_0101152
1039 Ga0496105_0018628
1040 Ga0496107_0111136
1041 Ga0496107_0322247
1042 Ga0496108_0099726
1043 Ga0496108_0205535
1044 Ga0496108_0386989
1045 Ga0496108_0437499
1046 Ga0496108_0496341
1047 Ga0496109_0052712
1048 Ga0496109_0061321
1049 Ga0496109_0247320
1050 Ga0496109_0418496
1051 Ga0496110_0007171
1052 Ga0496110_0173544
1053 Ga0496110_0422115
1054 Ga0496110_0542452
1055 Ga0496112_0002412
1056 Ga0496112_0009210
1057 Ga0496112_0184411
1058 Ga0496112_0288970
1059 Ga0496114_0366136
1060 Ga0496116_0074533
1061 Ga0496118_0022943
1062 Ga0496119_0192756
1063 Ga0496121_0021940
1064 Ga0496121_0055111
1065 Ga0496122_0177168
1066 Ga0496125_0048389
1067 Ga0496126_0065880
1068 Ga0501031_0035945
1069 Ga0501032_0007274
1070 Ga0501033_0001305
1071 Ga0501037_0001243
1072 Ga0501043_0000003
1073 Ga0501068_0018987
1074 Ga0501069_0000263
1075 Ga0501070_0000774
1076 Ga0501071_0035556
1077 Ga0501073_0045197
1078 Ga0501074_0000565
1079 Ga0501198_000027
1080 Ga0501222_000026
1081 Ga0501080_0000071
1082 Ga0501083_0000083
1083 Ga0501035_0000083
1084 Ga0501035_0042879
1085 Ga0501044_0003070
1086 nmdc:mga03683_24673_c1
1087 nmdc:mga03n38_44918_c1
1088 nmdc:mga0k408_120936_c1
1089 nmdc:mga0k408_132771_c1
1090 nmdc:mga0k408_178330_c1
1091 nmdc:mga0k408_24016_c1
1092 nmdc:mga0k408_32418_c1
1093 nmdc:mga0k408_986_c1
1094 nmdc:mga06z11_15689_c1
1095 nmdc:mga06z11_89443_c1
1096 nmdc:mga07m45_10533_c2
1097 nmdc:mga07m45_116355_c1
1098 nmdc:mga07m45_14972_c1
1099 nmdc:mga07m45_1838_c1
1100 nmdc:mga07m45_3092_c1
1101 nmdc:mga07m45_5811_c1
1102 nmdc:mga07m45_79596_c1
1103 nmdc:mga09592_1513_c1
1104 nmdc:mga09592_50340_c1
1105 nmdc:mga0qj67_142385_c1
1106 Ga0495595_0073826
1107 2524443366
1108 2587732818
1109 2644159196
1110 2644245275
1111 2644401370
1112 2728754106
1113 2745075627
1114 2881101528
1115 2900641829
1116 2904450026
1117 2904457158
1118 2939632935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

86

175

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a12-assembly1.cif.gz_B structure of the global transcription regulator fapr from staphylococcus aureus in complex with dna operator 0.8895 90 148
5eo2-assembly1.cif.gz_D structural and biochemical characterization of the hypothetical protein sav2348 from staphylococcus aureus in complex with coa. 0.8849 90 149
8huc-assembly1.cif.gz_A crystal structure of paich (pec1) 0.8717 11 276
6fdg-assembly1.cif.gz_D novel crystal structure of dhna-coa thioesterase from staphylococcus aureus 0.8663 90 149
8huc-assembly1.cif.gz_C crystal structure of paich (pec1) 0.8647 14 276
ID Description Score Start End Superfamily
af_Q80ZW2_46_168_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9204 90 148 3.10.129.10
af_Q5A0N4_66_202_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9068 90 149 3.10.129.10
af_A0A1D6KJS7_406_533_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8915 90 149 3.10.129.10
af_A0A0N7KJH1_95_233_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8896 90 149 3.10.129.10
af_F4HX80_37_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8849 90 149 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A5C9BT75-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9299 8 276 GO:0019171
AF-A0A1Z8P3P6-F1-model_v4 Acyl-CoA dehydrogenase 0.9289 8 274 GO:0019171
AF-B9Z0Q1-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9233 1 276 GO:0019171
AF-B9Z0Q1-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9201 1 276 GO:0019171
AF-A0A177RJA6-F1-model_v4 deleted 0.9199 4 276

Map