F463539

General Info

Members Datasets Scaffolds Average Seq Length
559 281 552 144

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100097332|Ga0070705_1000973322
Length 180
Sequence VRPLSTKLHDDGVGLYPSPPGRQQEIMSLYGTYDDDNVFARILRGELPCHRIYEDEDVLAFLDAFPQAQGHTLIVPKRLRARNLLELPEAAVAPLFLCAKRLMAVLVAELEPVGVQMLQFNGGDGGQSVFHVHVHLVPRWAGQPLGLHGQVAGDPQQLAEVATRLRDRVTVMAPAWGPGQ

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
6 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
7 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
8 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
9 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
180 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
181 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
182 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
183 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
186 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
187 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
188 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
189 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
190 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
193 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
194 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
195 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
196 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
201 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
202 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
203 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
275 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
278 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0.72
Rhizoplane 2.86
Rhizosphere 89.09
Stem 0
Stem Tuber 0
Unclassified 5.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_121946 2162886006 Bacteria 976
2 SwRhRL3b_contig_2280204 2162886006 Unclassified 1694
3 SwRhRL2b_contig_2960894 2162886007 Bacteria 18966
4 SwRhRL2b_contig_3176492 2162886007 Bacteria 88382
5 SwRhRL2b_contig_3548226 2162886007 Bacteria 4069
6 JGI24750J21931_1003811 3300002070 Bacteria 1815
7 JGI24748J21848_1004694 3300002074 Bacteria 1572
8 JGI24748J21848_1024294 3300002074 Bacteria 737
9 JGI24034J26672_10011990 3300002239 Bacteria 1303
10 JGI24034J26672_10012730 3300002239 Bacteria 1271
11 JGI24751J29686_10000021 3300002459 Bacteria 104690
12 JGI24751J29686_10030580 3300002459 Unclassified 1117
13 JGI24751J29686_10039656 3300002459 Bacteria 975
14 JGI24751J29686_10087433 3300002459 Unclassified 647
15 JGI25165J46597_1000286 3300003214 Bacteria 64278
16 Ga0065704_10001735 3300005289 Bacteria 6719
17 Ga0065704_10070182 3300005289 Bacteria 120495
18 Ga0065704_10070243 3300005289 Bacteria 50129
19 Ga0065704_10074055 3300005289 Bacteria 6574
20 Ga0065704_10237392 3300005289 Bacteria 1025
21 Ga0065707_10000429 3300005295 Bacteria 96496
22 Ga0065707_10081908 3300005295 Bacteria 29959
23 Ga0065707_10087286 3300005295 Bacteria 5091
24 Ga0065707_10110335 3300005295 Bacteria 2434
25 Ga0065707_10125778 3300005295 Bacteria 2017
26 Ga0065707_10185887 3300005295 Unclassified 1389
27 Ga0065707_10556567 3300005295 Unclassified 717
28 Ga0070658_10065452 3300005327 Bacteria 2966
29 Ga0070676_10516750 3300005328 Bacteria 850
30 Ga0070676_10945459 3300005328 Bacteria 644
31 Ga0070670_100000006 3300005331 Bacteria 319420
32 Ga0070670_100008603 3300005331 Bacteria 8708
33 Ga0070670_100136196 3300005331 Bacteria 2122
34 Ga0070670_100708780 3300005331 Bacteria 905
35 Ga0070670_101130219 3300005331 Bacteria 715
36 Ga0070677_10073662 3300005333 Bacteria 1443
37 Ga0070666_10020904 3300005335 Bacteria 4236
38 Ga0070666_10023715 3300005335 Bacteria 3995
39 Ga0070666_10211113 3300005335 Bacteria 1367
40 Ga0070680_100073276 3300005336 Bacteria 2816
41 Ga0070682_101256036 3300005337 Unclassified 627
42 Ga0068868_102244655 3300005338 Unclassified 520
43 Ga0070660_100416980 3300005339 Bacteria 1111
44 Ga0070660_100586184 3300005339 Bacteria 932
45 Ga0070691_10253996 3300005341 Bacteria 944
46 Ga0070668_100003865 3300005347 Bacteria 11058
47 Ga0070668_100049185 3300005347 Unclassified 3244
48 Ga0070668_100067734 3300005347 Bacteria 2774
49 Ga0070669_100000142 3300005353 Bacteria 64092
50 Ga0070669_100000305 3300005353 Bacteria 38624
51 Ga0070669_100073662 3300005353 Bacteria 2530
52 Ga0070669_100832252 3300005353 Unclassified 786
53 Ga0070671_100001357 3300005355 Bacteria 18338
54 Ga0070671_100086764 3300005355 Bacteria 2619
55 Ga0070674_100007315 3300005356 Bacteria 6506
56 Ga0070659_100612906 3300005366 Bacteria 936
57 Ga0070667_100001490 3300005367 Bacteria 20980
58 Ga0070667_100002768 3300005367 Bacteria 15163
59 Ga0070667_100038261 3300005367 Bacteria 4022
60 Ga0070667_100135983 3300005367 Bacteria 2149
61 Ga0070667_101041785 3300005367 Bacteria 764
62 Ga0070711_100612066 3300005439 Bacteria 910
63 Ga0070705_100097332 3300005440 Bacteria 1849
64 Ga0070705_100161492 3300005440 Bacteria 1498
65 Ga0070708_100006274 3300005445 Bacteria 9457
66 Ga0070678_100506480 3300005456 Bacteria 1066
67 Ga0070662_100057582 3300005457 Bacteria 2824
68 Ga0070681_10221368 3300005458 Bacteria 1808
69 Ga0070681_10351306 3300005458 Unclassified 1385
70 Ga0068867_100037532 3300005459 Bacteria 3522
71 Ga0070685_10610417 3300005466 Bacteria 786
72 Ga0070706_100250021 3300005467 Bacteria 1655
73 Ga0070672_100026177 3300005543 Bacteria 4336
74 Ga0070672_100203977 3300005543 Unclassified 1654
75 Ga0070686_100186333 3300005544 Bacteria 1478
76 Ga0070696_101748099 3300005546 Bacteria 537
77 Ga0070665_100010084 3300005548 Bacteria 9561
78 Ga0070665_100025987 3300005548 Bacteria 5898
79 Ga0070665_100124380 3300005548 Bacteria 2581
80 Ga0070665_100907455 3300005548 Bacteria 894
81 Ga0068855_100017268 3300005563 Bacteria 8685
82 Ga0068855_100104291 3300005563 Bacteria 3262
83 Ga0068855_100447605 3300005563 Bacteria 1410
84 Ga0068855_101074167 3300005563 Bacteria 843
85 Ga0068857_100406822 3300005577 Bacteria 1267
86 Ga0068857_100956301 3300005577 Unclassified 823
87 Ga0068854_100475530 3300005578 Bacteria 1048
88 Ga0068856_101245086 3300005614 Bacteria 760
89 Ga0070702_100088831 3300005615 Bacteria 1869
90 Ga0070702_101264498 3300005615 Bacteria 598
91 Ga0068852_100371037 3300005616 Bacteria 1402
92 Ga0068859_100008174 3300005617 Bacteria 10614
93 Ga0068859_100140506 3300005617 Bacteria 2488
94 Ga0068859_100180300 3300005617 Unclassified 2195
95 Ga0068864_100000014 3300005618 Bacteria 308927
96 Ga0068864_100011628 3300005618 Bacteria 7269
97 Ga0068861_100005563 3300005719 Bacteria 8537
98 Ga0068861_100079594 3300005719 Bacteria 2562
99 Ga0068851_10680403 3300005834 Unclassified 632
100 Ga0068870_10020516 3300005840 Bacteria 3219
101 Ga0068870_10179404 3300005840 Bacteria 1270
102 Ga0068863_100009781 3300005841 Bacteria 9346
103 Ga0068863_100225220 3300005841 Bacteria 1808
104 Ga0068863_102419686 3300005841 Bacteria 535
105 Ga0068858_100000037 3300005842 Bacteria 137966
106 Ga0068858_100121751 3300005842 Bacteria 2440
107 Ga0068860_100001149 3300005843 Bacteria 29035
108 Ga0068860_100025233 3300005843 Bacteria 5736
109 Ga0068860_100025549 3300005843 Bacteria 5698
110 Ga0068862_100000007 3300005844 Bacteria 313933
111 Ga0068862_100000728 3300005844 Bacteria 33304
112 Ga0068862_100002993 3300005844 Bacteria 14736
113 Ga0068862_100016222 3300005844 Bacteria 6198
114 Ga0075364_10101210 3300006051 Bacteria 1918
115 Ga0068871_100428554 3300006358 Bacteria 1182
116 Ga0075428_101236697 3300006844 Bacteria 786
117 Ga0075431_100100053 3300006847 Bacteria 2991
118 Ga0068865_100026691 3300006881 Bacteria 3810
119 Ga0068865_100120811 3300006881 Bacteria 1948
120 Ga0097620_100008174 3300006931 Bacteria 10614
121 Ga0097620_100140518 3300006931 Bacteria 2488
122 Ga0097620_100180300 3300006931 Unclassified 2195
123 Ga0105251_10002008 3300009011 Bacteria 16531
124 Ga0105251_10190938 3300009011 Bacteria 923
125 Ga0105250_10001628 3300009092 Bacteria 12004
126 Ga0105240_10011909 3300009093 Bacteria 12064
127 Ga0105240_10035277 3300009093 Bacteria 6447
128 Ga0105240_11177298 3300009093 Bacteria 813
129 Ga0105247_10000444 3300009101 Bacteria 35009
130 Ga0105247_10036659 3300009101 Bacteria 2989
131 Ga0105247_10085674 3300009101 Bacteria 1993
132 Ga0105243_10114846 3300009148 Bacteria 2260
133 Ga0105241_10080469 3300009174 Bacteria 2550
134 Ga0105241_10274394 3300009174 Bacteria 1438
135 Ga0105248_10000139 3300009177 Bacteria 84082
136 Ga0105248_10003016 3300009177 Bacteria 18673
137 Ga0105248_10015427 3300009177 Bacteria 8422
138 Ga0105248_10064494 3300009177 Bacteria 4113
139 Ga0105248_12268007 3300009177 Unclassified 618
140 Ga0105237_10188250 3300009545 Bacteria 2064
141 Ga0105237_10494977 3300009545 Bacteria 1229
142 Ga0105238_10095459 3300009551 Bacteria 2960
143 Ga0105238_10434803 3300009551 Bacteria 1308
144 Ga0105238_10782795 3300009551 Bacteria 969
145 Ga0105249_10025631 3300009553 Bacteria 5311
146 Ga0105249_10027933 3300009553 Bacteria 5092
147 Ga0105249_10141464 3300009553 Bacteria 2308
148 Ga0105249_10986042 3300009553 Bacteria 911
149 Ga0105148_100004 3300009978 Bacteria 47832
150 Ga0105239_10076331 3300010375 Bacteria 3685
151 Ga0105239_10104928 3300010375 Bacteria 3129
152 Ga0105239_10146980 3300010375 Bacteria 2630
153 Ga0105239_11528378 3300010375 Unclassified 771
154 Ga0157370_10386976 3300013104 Bacteria 1288
155 Ga0157369_10054636 3300013105 Bacteria 4312
156 Ga0163162_10000562 3300013306 Bacteria 34275
157 Ga0163162_10038161 3300013306 Bacteria 4794
158 Ga0163162_10097143 3300013306 Bacteria 3034
159 Ga0163162_10631382 3300013306 Bacteria 1196
160 Ga0163162_12398994 3300013306 Unclassified 606
161 Ga0157375_10343247 3300013308 Bacteria 1658
162 Ga0163163_10025754 3300014325 Bacteria 5611
163 Ga0163163_10046224 3300014325 Bacteria 4276
164 Ga0163163_10106852 3300014325 Bacteria 2825
165 Ga0157380_10000014 3300014326 Bacteria 130737
166 Ga0157380_10000090 3300014326 Bacteria 49394
167 Ga0157380_10021050 3300014326 Bacteria 4886
168 Ga0157380_10054565 3300014326 Bacteria 3171
169 Ga0157379_10023914 3300014968 Bacteria 5423
170 Ga0157379_10174165 3300014968 Bacteria 1942
171 Ga0163161_10129868 3300017792 Bacteria 1900
172 Ga0213876_10018486 3300021384 Bacteria 3681
173 Ga0209233_1000013 3300025261 Bacteria 1013785
174 Ga0209455_1009164 3300025272 Bacteria 2620
175 Ga0207673_1006199 3300025290 Bacteria 1474
176 Ga0207697_10009182 3300025315 Bacteria 4279
177 Ga0207696_1000958 3300025711 Bacteria 17589
178 Ga0207713_1000985 3300025735 Bacteria 25046
179 Ga0207713_1017238 3300025735 Bacteria 3631
180 Ga0207710_10000902 3300025900 Bacteria 15883
181 Ga0207680_10022797 3300025903 Unclassified 3410
182 Ga0207680_10032994 3300025903 Bacteria 2949
183 Ga0207680_10319484 3300025903 Bacteria 1085
184 Ga0207680_10864667 3300025903 Bacteria 648
185 Ga0207645_10018207 3300025907 Bacteria 4627
186 Ga0207643_10027319 3300025908 Bacteria 3163
187 Ga0207643_10157749 3300025908 Bacteria 1364
188 Ga0207654_10800603 3300025911 Bacteria 681
189 Ga0207707_10669662 3300025912 Bacteria 873
190 Ga0207695_10007174 3300025913 Bacteria 14258
191 Ga0207695_10011239 3300025913 Bacteria 10855
192 Ga0207695_10058556 3300025913 Bacteria 3998
193 Ga0207695_11001890 3300025913 Bacteria 715
194 Ga0207671_10109266 3300025914 Bacteria 2102
195 Ga0207671_10814820 3300025914 Bacteria 740
196 Ga0207663_10246248 3300025916 Bacteria 1313
197 Ga0207660_10593287 3300025917 Bacteria 902
198 Ga0207657_10030665 3300025919 Bacteria 4878
199 Ga0207657_10789880 3300025919 Bacteria 734
200 Ga0207681_10000001 3300025923 Bacteria 1105841
201 Ga0207681_10000229 3300025923 Bacteria 44082
202 Ga0207681_10031286 3300025923 Unclassified 3475
203 Ga0207681_10786824 3300025923 Unclassified 794
204 Ga0207694_10041115 3300025924 Bacteria 3562
205 Ga0207694_10056647 3300025924 Bacteria 3045
206 Ga0207650_10000023 3300025925 Bacteria 308148
207 Ga0207650_10000353 3300025925 Bacteria 44269
208 Ga0207644_10005087 3300025931 Bacteria 8587
209 Ga0207644_10020343 3300025931 Bacteria 4513
210 Ga0207690_10303487 3300025932 Bacteria 1250
211 Ga0207690_10979383 3300025932 Bacteria 703
212 Ga0207706_10034576 3300025933 Bacteria 4496
213 Ga0207669_10322115 3300025937 Bacteria 1183
214 Ga0207704_10266551 3300025938 Bacteria 1294
215 Ga0207691_10000307 3300025940 Bacteria 48698
216 Ga0207691_10214526 3300025940 Unclassified 1671
217 Ga0207711_10000646 3300025941 Bacteria 34791
218 Ga0207711_10040703 3300025941 Bacteria 3954
219 Ga0207711_10067497 3300025941 Bacteria 3096
220 Ga0207711_10074336 3300025941 Bacteria 2955
221 Ga0207711_10230613 3300025941 Bacteria 1696
222 Ga0207667_10032939 3300025949 Bacteria 5578
223 Ga0207667_10033289 3300025949 Bacteria 5543
224 Ga0207667_10308661 3300025949 Bacteria 1616
225 Ga0207712_10000186 3300025961 Bacteria 64235
226 Ga0207712_10025601 3300025961 Bacteria 3922
227 Ga0207712_10116506 3300025961 Bacteria 2013
228 Ga0207668_10001050 3300025972 Bacteria 16465
229 Ga0207668_10012445 3300025972 Bacteria 5208
230 Ga0207668_10499395 3300025972 Unclassified 1046
231 Ga0207640_10440301 3300025981 Bacteria 1071
232 Ga0207658_10001241 3300025986 Bacteria 20160
233 Ga0207658_10004125 3300025986 Bacteria 10134
234 Ga0207658_10027018 3300025986 Bacteria 4029
235 Ga0207658_10762902 3300025986 Bacteria 876
236 Ga0207658_10935084 3300025986 Bacteria 790
237 Ga0207703_10000228 3300026035 Bacteria 64483
238 Ga0207703_10008486 3300026035 Bacteria 8118
239 Ga0207703_10332099 3300026035 Bacteria 1395
240 Ga0207708_10172443 3300026075 Bacteria 1714
241 Ga0207702_10699417 3300026078 Bacteria 999
242 Ga0207641_10155791 3300026088 Bacteria 2072
243 Ga0207641_10855781 3300026088 Bacteria 901
244 Ga0207648_10002642 3300026089 Bacteria 19142
245 Ga0207648_10479577 3300026089 Bacteria 1136
246 Ga0207676_10000017 3300026095 Bacteria 308709
247 Ga0207676_10002454 3300026095 Bacteria 13224
248 Ga0207674_10412908 3300026116 Bacteria 1304
249 Ga0207675_100000707 3300026118 Bacteria 33068
250 Ga0207675_100001848 3300026118 Bacteria 21253
251 Ga0207683_10255017 3300026121 Bacteria 1601
252 Ga0209973_1006204 3300027252 Bacteria 1297
253 Ga0209967_1013322 3300027364 Bacteria 1166
254 Ga0209996_1007982 3300027395 Bacteria 1383
255 Ga0210000_1005717 3300027462 Bacteria 1807
256 Ga0210000_1033077 3300027462 Bacteria 812
257 Ga0209968_1007913 3300027526 Bacteria 1615
258 Ga0209982_1003042 3300027552 Bacteria 2373
259 Ga0209970_1025088 3300027614 Bacteria 1021
260 Ga0210002_1001941 3300027617 Bacteria 2967
261 Ga0209983_1005582 3300027665 Bacteria 2596
262 Ga0209983_1086709 3300027665 Bacteria 704
263 Ga0209971_1000728 3300027682 Bacteria 8501
264 Ga0209966_1005276 3300027695 Bacteria 2217
265 Ga0209966_1022486 3300027695 Bacteria 1233
266 Ga0209998_10000548 3300027717 Bacteria 10147
267 Ga0209998_10093563 3300027717 Bacteria 739
268 Ga0209974_10001992 3300027876 Bacteria 7445
269 Ga0209974_10014835 3300027876 Bacteria 2587
270 Ga0207428_10141042 3300027907 Bacteria 1839
271 Ga0268266_10007786 3300028379 Bacteria 9606
272 Ga0268266_10020596 3300028379 Bacteria 5619
273 Ga0268266_10204358 3300028379 Bacteria 1809
274 Ga0268266_10432689 3300028379 Unclassified 1248
275 Ga0268265_10000002 3300028380 Bacteria 1035381
276 Ga0268265_10000370 3300028380 Bacteria 48735
277 Ga0268265_10008501 3300028380 Bacteria 6938
278 Ga0268265_10024661 3300028380 Unclassified 4258
279 Ga0268265_10032838 3300028380 Bacteria 3766
280 Ga0268265_10114279 3300028380 Bacteria 2210
281 Ga0268264_10000397 3300028381 Bacteria 62284
282 Ga0268264_10015326 3300028381 Bacteria 6285
283 Ga0268264_10018198 3300028381 Bacteria 5746
284 Ga0265318_10008251 3300028577 Bacteria 4648
285 Ga0265338_10029309 3300028800 Bacteria 5457
286 Ga0265338_10166985 3300028800 Bacteria 1693
287 Ga0265330_10032148 3300031235 Bacteria 2351
288 Ga0265330_10089961 3300031235 Bacteria 1318
289 Ga0265332_10102032 3300031238 Bacteria 1210
290 Ga0265332_10260926 3300031238 Bacteria 716
291 Ga0265328_10044204 3300031239 Bacteria 1638
292 Ga0265328_10082554 3300031239 Bacteria 1185
293 Ga0265320_10459682 3300031240 Bacteria 562
294 Ga0265325_10044717 3300031241 Bacteria 2305
295 Ga0265325_10048132 3300031241 Bacteria 2205
296 Ga0265325_10092655 3300031241 Bacteria 1488
297 Ga0265325_10129035 3300031241 Bacteria 1212
298 Ga0265340_10000059 3300031247 Bacteria 50238
299 Ga0265340_10013560 3300031247 Bacteria 4278
300 Ga0265339_10030198 3300031249 Bacteria 3070
301 Ga0265339_10053659 3300031249 Bacteria 2192
302 Ga0265339_10252247 3300031249 Bacteria 853
303 Ga0265339_10391063 3300031249 Bacteria 651
304 Ga0265339_10466892 3300031249 Bacteria 585
305 Ga0265331_10016153 3300031250 Bacteria 3925
306 Ga0265331_10058785 3300031250 Bacteria 1819
307 Ga0265331_10294933 3300031250 Bacteria 726
308 Ga0265316_10011082 3300031344 Bacteria 8166
309 Ga0265316_10081375 3300031344 Bacteria 2482
310 Ga0265316_10452001 3300031344 Bacteria 921
311 Ga0265316_10574252 3300031344 Bacteria 801
312 Ga0265313_10002218 3300031595 Bacteria 17114
313 Ga0265313_10008536 3300031595 Bacteria 6791
314 Ga0265313_10037011 3300031595 Bacteria 2445
315 Ga0265313_10072744 3300031595 Bacteria 1579
316 Ga0265314_10074946 3300031711 Bacteria 2252
317 Ga0265314_10092672 3300031711 Bacteria 1963
318 Ga0265314_10244543 3300031711 Bacteria 1033
319 Ga0265314_10277301 3300031711 Bacteria 950
320 Ga0265314_10314989 3300031711 Bacteria 872
321 Ga0265342_10022373 3300031712 Bacteria 4019
322 Ga0316576_10029457 3300031727 Unclassified 3881
323 Ga0316578_10838414 3300031728 Unclassified 532
324 Ga0307405_10059175 3300031731 Bacteria 2414
325 Ga0316577_10023802 3300031733 Bacteria 3400
326 Ga0307413_10069845 3300031824 Bacteria 2206
327 Ga0307413_10131798 3300031824 Bacteria 1712
328 Ga0307413_10197393 3300031824 Bacteria 1450
329 Ga0307410_10177040 3300031852 Bacteria 1612
330 Ga0307406_10325174 3300031901 Bacteria 1191
331 Ga0307407_10943985 3300031903 Bacteria 664
332 Ga0307412_10734869 3300031911 Bacteria 850
333 Ga0307409_100046599 3300031995 Bacteria 3283
334 Ga0307409_100111461 3300031995 Bacteria 2295
335 Ga0307416_100080503 3300032002 Bacteria 2750
336 Ga0307416_100750949 3300032002 Bacteria 1068
337 Ga0307411_10038720 3300032005 Bacteria 3010
338 Ga0307411_10055343 3300032005 Bacteria 2609
339 Ga0307411_10194081 3300032005 Bacteria 1553
340 Ga0307411_11410094 3300032005 Bacteria 638
341 Ga0307415_100020213 3300032126 Bacteria 4061
342 Ga0307415_100190607 3300032126 Bacteria 1617
343 Ga0373950_0046372 3300034818 Bacteria 844
344 Ga0316582_0861036 3300036647 Unclassified 620
345 Ga0316584_0067576 3300036712 Bacteria 2679
346 Ga0400483_131903 3300039062 Bacteria 2363
347 Ga0436365_1557676 3300039437 Bacteria 11789
348 Ga0436363_1221608 3300039450 Bacteria 725
349 Ga0439447_071968 3300041407 Bacteria 803
350 Ga0439461_0062037 3300041410 Bacteria 851
351 Ga0439461_0152597 3300041410 Bacteria 597
352 Ga0439431_0276314 3300041997 Bacteria 502
353 Ga0439441_026735 3300042001 Bacteria 1097
354 Ga0439443_009914 3300042003 Bacteria 1375
355 Ga0439445_0135503 3300042004 Bacteria 712
356 Ga0439432_151907 3300042006 Bacteria 679
357 Ga0439451_017613 3300042009 Bacteria 1441
358 Ga0439456_020647 3300042013 Bacteria 1390
359 Ga0439462_0025633 3300042015 Bacteria 1553
360 Ga0439462_0066199 3300042015 Bacteria 979
361 Ga0450920_024073 3300042122 Bacteria 1182
362 Ga0450922_001526 3300042124 Bacteria 2269
363 Ga0450923_002616 3300042125 Bacteria 2609
364 Ga0450923_003995 3300042125 Bacteria 2280
365 Ga0450894_020513 3300042131 Bacteria 891
366 Ga0450896_003110 3300042133 Bacteria 2184
367 Ga0450896_009899 3300042133 Bacteria 1333
368 Ga0450898_018133 3300042134 Bacteria 1216
369 Ga0450906_050961 3300042145 Bacteria 731
370 Ga0450910_053558 3300042147 Bacteria 670
371 Ga0439446_0001353 3300042156 Bacteria 5532
372 Ga0439446_0026149 3300042156 Bacteria 1671
373 Ga0450908_007475 3300042184 Bacteria 2060
374 Ga0439434_0018104 3300042435 Bacteria 2107
375 Ga0439434_0206608 3300042435 Bacteria 663
376 Ga0439435_0001811 3300042436 Bacteria 4076
377 Ga0439435_0006151 3300042436 Bacteria 2685
378 Ga0439444_0003905 3300042437 Bacteria 2132
379 Ga0439444_0005461 3300042437 Bacteria 1885
380 Ga0439460_0066327 3300042461 Bacteria 1110
381 Ga0450893_0017070 3300042532 Bacteria 1232
382 Ga0450893_0022221 3300042532 Bacteria 1099
383 Ga0451577_0006530 3300042876 Bacteria 11602
384 Ga0451577_0047389 3300042876 Bacteria 3843
385 Ga0451577_1743117 3300042876 Bacteria 547
386 Ga0453683_0055721 3300044673 Bacteria 2474
387 Ga0466963_0024510 3300044694 Bacteria 3841
388 Ga0466963_0851775 3300044694 Bacteria 643
389 Ga0453684_0044982 3300044712 Bacteria 5895
390 Ga0453684_0142370 3300044712 Bacteria 2861
391 Ga0453684_0650865 3300044712 Bacteria 1150
392 Ga0466959_0134745 3300045049 Bacteria 1749
393 Ga0451576_0006005 3300045051 Bacteria 15016
394 Ga0451576_0183206 3300045051 Bacteria 2186
395 Ga0466958_0027374 3300045836 Bacteria 3375
396 Ga0466958_0031270 3300045836 Bacteria 3163
397 Ga0466967_0016669 3300045976 Bacteria 5802
398 Ga0495616_0179665 3300046513 Bacteria 941
399 Ga0495642_0243306 3300046528 Bacteria 786
400 Ga0495625_0830795 3300046660 Bacteria 535
401 Ga0496100_0005098 3300048903 Bacteria 7035
402 Ga0496102_0000790 3300048905 Bacteria 30777
403 Ga0496102_1742609 3300048905 Unclassified 540
404 Ga0496103_0001463 3300048906 Bacteria 15819
405 Ga0496104_0001292 3300048907 Bacteria 21588
406 Ga0496105_0000099 3300048908 Bacteria 59095
407 Ga0496106_0178083 3300048909 Bacteria 1687
408 Ga0496107_0278957 3300048910 Bacteria 1244
409 Ga0496108_0967695 3300048911 Bacteria 728
410 Ga0496110_0025641 3300048913 Bacteria 5041
411 Ga0496110_0343833 3300048913 Bacteria 1359
412 Ga0496111_0118557 3300048914 Bacteria 1954
413 Ga0496112_0102432 3300048915 Bacteria 2833
414 Ga0496113_0012342 3300048916 Bacteria 5740
415 Ga0496114_1765955 3300048917 Bacteria 507
416 Ga0496115_0360190 3300048918 Bacteria 1185
417 Ga0496116_0022270 3300048919 Bacteria 4753
418 Ga0496116_0113050 3300048919 Bacteria 1590
419 Ga0496117_0000739 3300048920 Bacteria 51387
420 Ga0496117_0013651 3300048920 Bacteria 7068
421 Ga0496118_0000778 3300048921 Bacteria 51108
422 Ga0496118_0000862 3300048921 Bacteria 48139
423 Ga0496118_0153775 3300048921 Unclassified 1435
424 Ga0496119_0002550 3300048922 Bacteria 19834
425 Ga0496119_0005771 3300048922 Bacteria 11725
426 Ga0496120_0002075 3300048923 Bacteria 21531
427 Ga0496121_0000058 3300048924 Bacteria 281335
428 Ga0496121_0010844 3300048924 Bacteria 10193
429 Ga0496121_0059944 3300048924 Bacteria 3135
430 Ga0496121_0775749 3300048924 Bacteria 567
431 Ga0496122_0002786 3300048925 Bacteria 24036
432 Ga0496122_0033512 3300048925 Bacteria 4222
433 Ga0496122_0041881 3300048925 Bacteria 3612
434 Ga0496122_0304798 3300048925 Bacteria 857
435 Ga0496123_0000332 3300048926 Bacteria 89657
436 Ga0496123_0021192 3300048926 Bacteria 5058
437 Ga0496124_0000007 3300048927 Bacteria 883534
438 Ga0496124_0011178 3300048927 Bacteria 9001
439 Ga0496124_0021629 3300048927 Bacteria 5925
440 Ga0496126_0000934 3300048929 Bacteria 50431
441 Ga0501031_0020308 3300049568 Bacteria 4331
442 Ga0501031_0049493 3300049568 Bacteria 2739
443 Ga0501032_0007111 3300049569 Bacteria 8195
444 Ga0501032_0026094 3300049569 Bacteria 4024
445 Ga0501032_1011637 3300049569 Bacteria 522
446 Ga0501033_0064066 3300049570 Bacteria 2705
447 Ga0501033_0064293 3300049570 Bacteria 2700
448 Ga0501033_0066586 3300049570 Bacteria 2649
449 Ga0501033_0298082 3300049570 Bacteria 1135
450 Ga0501033_0404197 3300049570 Bacteria 952
451 Ga0501034_0024429 3300049571 Bacteria 6148
452 Ga0501034_0036972 3300049571 Bacteria 4944
453 Ga0501034_0661421 3300049571 Bacteria 946
454 Ga0501036_0008585 3300049572 Bacteria 8381
455 Ga0501036_0066925 3300049572 Bacteria 3039
456 Ga0501036_0281150 3300049572 Bacteria 1393
457 Ga0501036_0829462 3300049572 Bacteria 761
458 Ga0501037_0441392 3300049573 Bacteria 889
459 Ga0501037_0689751 3300049573 Bacteria 680
460 Ga0501038_0042445 3300049574 Bacteria 3961
461 Ga0501038_0176540 3300049574 Bacteria 1726
462 Ga0501038_0496808 3300049574 Bacteria 933
463 Ga0501038_0510674 3300049574 Bacteria 918
464 Ga0501039_0001358 3300049575 Bacteria 17934
465 Ga0501039_0038626 3300049575 Bacteria 3686
466 Ga0501039_0381175 3300049575 Bacteria 1108
467 Ga0501040_0017408 3300049576 Bacteria 4770
468 Ga0501040_0230358 3300049576 Bacteria 1319
469 Ga0501040_0672070 3300049576 Bacteria 749
470 Ga0501041_0018599 3300049577 Bacteria 4138
471 Ga0501042_0004839 3300049578 Bacteria 8607
472 Ga0501042_0027392 3300049578 Bacteria 4007
473 Ga0501042_0244353 3300049578 Bacteria 1295
474 Ga0501043_0625805 3300049579 Bacteria 793
475 Ga0501046_0138472 3300049580 Bacteria 1843
476 Ga0501046_0332430 3300049580 Bacteria 1105
477 Ga0501047_0024527 3300049581 Bacteria 5788
478 Ga0501047_0105436 3300049581 Bacteria 2699
479 Ga0501047_0485225 3300049581 Bacteria 1063
480 Ga0501047_0988148 3300049581 Bacteria 655
481 Ga0501048_0002580 3300049582 Bacteria 13862
482 Ga0501048_0044131 3300049582 Bacteria 3189
483 Ga0501048_0608213 3300049582 Bacteria 785
484 Ga0501067_0001589 3300049583 Bacteria 12437
485 Ga0501068_0011937 3300049584 Bacteria 4913
486 Ga0501068_0175070 3300049584 Bacteria 1355
487 Ga0501069_0033378 3300049585 Bacteria 2835
488 Ga0501069_0060165 3300049585 Bacteria 2120
489 Ga0501069_0465682 3300049585 Bacteria 752
490 Ga0501070_0037876 3300049586 Bacteria 4024
491 Ga0501070_0205659 3300049586 Bacteria 1616
492 Ga0501071_0000921 3300049587 Bacteria 15921
493 Ga0501071_0107213 3300049587 Bacteria 2063
494 Ga0501071_0267540 3300049587 Bacteria 1292
495 Ga0501071_0348074 3300049587 Bacteria 1127
496 Ga0501072_0057107 3300049588 Bacteria 3076
497 Ga0501072_0109369 3300049588 Bacteria 2200
498 Ga0501072_0135353 3300049588 Bacteria 1964
499 Ga0501073_0458758 3300049589 Bacteria 881
500 Ga0501073_0772950 3300049589 Bacteria 662
501 Ga0501074_0011061 3300049590 Bacteria 6551
502 Ga0501074_0034726 3300049590 Bacteria 3655
503 Ga0501074_0384238 3300049590 Bacteria 996
504 Ga0501075_0049788 3300049591 Bacteria 3149
505 Ga0501075_0169150 3300049591 Bacteria 1667
506 Ga0501075_0255105 3300049591 Bacteria 1337
507 Ga0501076_0004872 3300049592 Bacteria 9594
508 Ga0501076_0090848 3300049592 Bacteria 2456
509 Ga0501077_0341655 3300049593 Bacteria 955
510 Ga0501079_0140004 3300049741 Bacteria 1885
511 Ga0501080_0035208 3300049742 Bacteria 4673
512 Ga0501080_0313319 3300049742 Bacteria 1422
513 Ga0501080_0534616 3300049742 Bacteria 1045
514 Ga0501081_0014892 3300049743 Bacteria 5130
515 Ga0501081_0047536 3300049743 Bacteria 2952
516 Ga0501081_0102993 3300049743 Bacteria 2019
517 Ga0501083_0122220 3300049744 Bacteria 1708
518 Ga0501083_0123618 3300049744 Bacteria 1697
519 Ga0501035_0003558 3300049822 Bacteria 14881
520 Ga0501035_0021128 3300049822 Bacteria 5983
521 Ga0501035_0029460 3300049822 Bacteria 5006
522 Ga0501035_0062838 3300049822 Bacteria 3303
523 Ga0501035_0074932 3300049822 Bacteria 2993
524 Ga0501035_0110123 3300049822 Bacteria 2413
525 Ga0501035_0567151 3300049822 Bacteria 928
526 Ga0501044_0012537 3300049823 Bacteria 9182
527 Ga0501044_0016340 3300049823 Bacteria 7968
528 Ga0501044_0135187 3300049823 Bacteria 2457
529 Ga0501044_0189506 3300049823 Bacteria 2020
530 Ga0501044_1097480 3300049823 Bacteria 665
531 Ga0501045_0102718 3300049824 Bacteria 2116
532 Ga0501045_0103879 3300049824 Bacteria 2104
533 Ga0501045_0135176 3300049824 Bacteria 1833
534 nmdc:mga00v17_71268_c1 3300050491 Bacteria 1261
535 nmdc:mga08y16_1186369_c1 3300050511 Bacteria 735
536 Ga0500562_060075 3300053108 Bacteria 1021
537 Ga0500607_018781 3300053121 Bacteria 3923
538 Ga0500636_0000716 3300053177 Bacteria 17826
539 Ga0500637_0098954 3300053178 Bacteria 1691
540 Ga0500625_025128 3300053729 Bacteria 2816
541 Ga0501084_0012232 3300054114 Bacteria 7104
542 Ga0501084_0036099 3300054114 Bacteria 4130
543 Ga0501084_1052648 3300054114 Bacteria 683
544 Ga0501082_0009438 3300060353 Bacteria 8398
545 Ga0501082_0102395 3300060353 Bacteria 2477
546 Ga0501082_0207447 3300060353 Bacteria 1705
547 Ga0501082_0294358 3300060353 Bacteria 1413
548 Ga0501082_0310757 3300060353 Bacteria 1373
549 Ga0501082_0770351 3300060353 Bacteria 842
550 Ga0530510_0036229 3300061734 Bacteria 3556
551 Ga0530510_0081010 3300061734 Bacteria 2363
552 Ga0530510_0161024 3300061734 Bacteria 1660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2508501122 2509107835 135
2 iso_pu_bacteria 2509276019 2509376232 135
3 iso_pu_bacteria 2558860100 2558863100 135
4 iso_pu_bacteria 2850079185 2850080828 135
5 iso_pu_bacteria 2791355094 2792642629 136
6 iso_pu_bacteria 2857542790 2857544343 136
7 3300025914 Ga0207671_10814820 Ga0207671_108148201 137
8 3300025919 Ga0207657_10789880 Ga0207657_107898802 137
9 3300003214 JGI25165J46597_1000286 JGI25165J46597_100028651 138
10 3300005327 Ga0070658_10065452 Ga0070658_100654524 138
11 3300005328 Ga0070676_10945459 Ga0070676_109454592 138
12 3300005335 Ga0070666_10020904 Ga0070666_100209044 138
13 3300005339 Ga0070660_100416980 Ga0070660_1004169802 138
14 3300005458 Ga0070681_10351306 Ga0070681_103513064 138
15 3300005548 Ga0070665_100124380 Ga0070665_1001243802 138
16 3300005614 Ga0068856_101245086 Ga0068856_1012450862 138
17 3300005615 Ga0070702_101264498 Ga0070702_1012644982 138
18 3300005841 Ga0068863_102419686 Ga0068863_1024196861 138
19 3300009093 Ga0105240_11177298 Ga0105240_111772982 138
20 3300010375 Ga0105239_10104928 Ga0105239_101049282 138
21 3300013104 Ga0157370_10386976 Ga0157370_103869762 138
22 3300013306 Ga0163162_10097143 Ga0163162_100971436 138
23 3300013306 Ga0163162_12398994 Ga0163162_123989941 138
24 3300021384 Ga0213876_10018486 Ga0213876_100184864 138
25 3300025261 Ga0209233_1000013 Ga0209233_1000013801 138
26 3300025272 Ga0209455_1009164 Ga0209455_10091642 138
27 3300025903 Ga0207680_10864667 Ga0207680_108646672 138
28 3300025919 Ga0207657_10030665 Ga0207657_100306656 138
29 3300026089 Ga0207648_10479577 Ga0207648_104795771 138
30 3300027462 Ga0210000_1033077 Ga0210000_10330772 138
31 3300027665 Ga0209983_1086709 Ga0209983_10867092 138
32 3300027695 Ga0209966_1022486 Ga0209966_10224863 138
33 3300027717 Ga0209998_10093563 Ga0209998_100935632 138
34 3300027876 Ga0209974_10014835 Ga0209974_100148352 138
35 3300028379 Ga0268266_10204358 Ga0268266_102043582 138
36 3300028577 Ga0265318_10008251 Ga0265318_100082515 138
37 3300028800 Ga0265338_10029309 Ga0265338_100293092 138
38 3300031235 Ga0265330_10032148 Ga0265330_100321484 138
39 3300031238 Ga0265332_10102032 Ga0265332_101020323 138
40 3300031238 Ga0265332_10260926 Ga0265332_102609261 138
41 3300031239 Ga0265328_10082554 Ga0265328_100825542 138
42 3300031240 Ga0265320_10459682 Ga0265320_104596821 138
43 3300031241 Ga0265325_10044717 Ga0265325_100447171 138
44 3300031241 Ga0265325_10129035 Ga0265325_101290352 138
45 3300031247 Ga0265340_10000059 Ga0265340_1000005944 138
46 3300031247 Ga0265340_10013560 Ga0265340_100135602 138
47 3300031249 Ga0265339_10030198 Ga0265339_100301982 138
48 3300031249 Ga0265339_10252247 Ga0265339_102522472 138
49 3300031249 Ga0265339_10391063 Ga0265339_103910631 138
50 3300031249 Ga0265339_10466892 Ga0265339_104668922 138
51 3300031250 Ga0265331_10016153 Ga0265331_100161533 138
52 3300031250 Ga0265331_10058785 Ga0265331_100587852 138
53 3300031250 Ga0265331_10294933 Ga0265331_102949331 138
54 3300031344 Ga0265316_10011082 Ga0265316_100110829 138
55 3300031344 Ga0265316_10081375 Ga0265316_100813751 138
56 3300031344 Ga0265316_10452001 Ga0265316_104520012 138
57 3300031595 Ga0265313_10002218 Ga0265313_1000221818 138
58 3300031595 Ga0265313_10008536 Ga0265313_100085368 138
59 3300031595 Ga0265313_10037011 Ga0265313_100370111 138
60 3300031711 Ga0265314_10074946 Ga0265314_100749462 138
61 3300031711 Ga0265314_10092672 Ga0265314_100926722 138
62 3300031711 Ga0265314_10277301 Ga0265314_102773011 138
63 3300031711 Ga0265314_10314989 Ga0265314_103149892 138
64 3300031712 Ga0265342_10022373 Ga0265342_100223732 138
65 3300031824 Ga0307413_10069845 Ga0307413_100698454 138
66 3300031824 Ga0307413_10131798 Ga0307413_101317982 138
67 3300031901 Ga0307406_10325174 Ga0307406_103251742 138
68 3300031911 Ga0307412_10734869 Ga0307412_107348692 138
69 3300031995 Ga0307409_100046599 Ga0307409_1000465993 138
70 3300032005 Ga0307411_10055343 Ga0307411_100553433 138
71 3300032005 Ga0307411_11410094 Ga0307411_114100942 138
72 3300032126 Ga0307415_100190607 Ga0307415_1001906072 138
73 3300039062 Ga0400483_131903 Ga0400483_131903_712_1128 138
74 3300039437 Ga0436365_1557676 Ga0436365_1557676_9142_9558 138
75 3300039450 Ga0436363_1221608 Ga0436363_1221608_261_677 138
76 3300041410 Ga0439461_0062037 Ga0439461_0062037_242_658 138
77 3300041410 Ga0439461_0152597 Ga0439461_0152597_135_551 138
78 3300042001 Ga0439441_026735 Ga0439441_026735_221_637 138
79 3300042003 Ga0439443_009914 Ga0439443_009914_489_905 138
80 3300042004 Ga0439445_0135503 Ga0439445_0135503_191_607 138
81 3300042013 Ga0439456_020647 Ga0439456_020647_446_862 138
82 3300042015 Ga0439462_0025633 Ga0439462_0025633_767_1183 138
83 3300042122 Ga0450920_024073 Ga0450920_024073_309_725 138
84 3300042124 Ga0450922_001526 Ga0450922_001526_587_1003 138
85 3300042125 Ga0450923_002616 Ga0450923_002616_2161_2577 138
86 3300042125 Ga0450923_003995 Ga0450923_003995_430_846 138
87 3300042131 Ga0450894_020513 Ga0450894_020513_129_545 138
88 3300042133 Ga0450896_003110 Ga0450896_003110_10_426 138
89 3300042133 Ga0450896_009899 Ga0450896_009899_282_698 138
90 3300042134 Ga0450898_018133 Ga0450898_018133_401_817 138
91 3300042145 Ga0450906_050961 Ga0450906_050961_109_525 138
92 3300042147 Ga0450910_053558 Ga0450910_053558_244_660 138
93 3300042156 Ga0439446_0001353 Ga0439446_0001353_2980_3396 138
94 3300042156 Ga0439446_0026149 Ga0439446_0026149_46_462 138
95 3300042184 Ga0450908_007475 Ga0450908_007475_1445_1861 138
96 3300042435 Ga0439434_0018104 Ga0439434_0018104_46_462 138
97 3300042435 Ga0439434_0206608 Ga0439434_0206608_41_457 138
98 3300042436 Ga0439435_0001811 Ga0439435_0001811_3331_3747 138
99 3300042437 Ga0439444_0003905 Ga0439444_0003905_247_663 138
100 3300042461 Ga0439460_0066327 Ga0439460_0066327_362_778 138
101 3300046513 Ga0495616_0179665 Ga0495616_0179665_351_767 138
102 3300046528 Ga0495642_0243306 Ga0495642_0243306_239_655 138
103 3300049568 Ga0501031_0049493 Ga0501031_0049493_1010_1426 138
104 3300049569 Ga0501032_0026094 Ga0501032_0026094_2617_3033 138
105 3300049569 Ga0501032_1011637 Ga0501032_1011637_87_503 138
106 3300049570 Ga0501033_0064066 Ga0501033_0064066_22_438 138
107 3300049570 Ga0501033_0064293 Ga0501033_0064293_1199_1615 138
108 3300049570 Ga0501033_0066586 Ga0501033_0066586_110_526 138
109 3300049570 Ga0501033_0404197 Ga0501033_0404197_454_870 138
110 3300049571 Ga0501034_0036972 Ga0501034_0036972_1599_2015 138
111 3300049571 Ga0501034_0661421 Ga0501034_0661421_307_723 138
112 3300049572 Ga0501036_0066925 Ga0501036_0066925_1243_1659 138
113 3300049572 Ga0501036_0281150 Ga0501036_0281150_189_605 138
114 3300049572 Ga0501036_0829462 Ga0501036_0829462_109_525 138
115 3300049573 Ga0501037_0441392 Ga0501037_0441392_146_562 138
116 3300049573 Ga0501037_0689751 Ga0501037_0689751_82_498 138
117 3300049574 Ga0501038_0042445 Ga0501038_0042445_152_568 138
118 3300049574 Ga0501038_0176540 Ga0501038_0176540_737_1153 138
119 3300049574 Ga0501038_0510674 Ga0501038_0510674_144_560 138
120 3300049575 Ga0501039_0001358 Ga0501039_0001358_15839_16255 138
121 3300049575 Ga0501039_0381175 Ga0501039_0381175_241_657 138
122 3300049576 Ga0501040_0017408 Ga0501040_0017408_2570_2986 138
123 3300049576 Ga0501040_0230358 Ga0501040_0230358_339_755 138
124 3300049576 Ga0501040_0672070 Ga0501040_0672070_304_720 138
125 3300049577 Ga0501041_0018599 Ga0501041_0018599_3466_3882 138
126 3300049578 Ga0501042_0004839 Ga0501042_0004839_2748_3164 138
127 3300049578 Ga0501042_0244353 Ga0501042_0244353_852_1268 138
128 3300049579 Ga0501043_0625805 Ga0501043_0625805_350_766 138
129 3300049580 Ga0501046_0138472 Ga0501046_0138472_1022_1438 138
130 3300049580 Ga0501046_0332430 Ga0501046_0332430_349_765 138
131 3300049581 Ga0501047_0105436 Ga0501047_0105436_1231_1647 138
132 3300049581 Ga0501047_0485225 Ga0501047_0485225_500_916 138
133 3300049581 Ga0501047_0988148 Ga0501047_0988148_194_610 138
134 3300049582 Ga0501048_0002580 Ga0501048_0002580_3348_3764 138
135 3300049582 Ga0501048_0608213 Ga0501048_0608213_261_677 138
136 3300049584 Ga0501068_0175070 Ga0501068_0175070_18_434 138
137 3300049585 Ga0501069_0033378 Ga0501069_0033378_1914_2330 138
138 3300049585 Ga0501069_0465682 Ga0501069_0465682_14_430 138
139 3300049586 Ga0501070_0205659 Ga0501070_0205659_702_1118 138
140 3300049587 Ga0501071_0000921 Ga0501071_0000921_11204_11620 138
141 3300049587 Ga0501071_0107213 Ga0501071_0107213_56_472 138
142 3300049587 Ga0501071_0267540 Ga0501071_0267540_252_668 138
143 3300049587 Ga0501071_0348074 Ga0501071_0348074_147_563 138
144 3300049588 Ga0501072_0057107 Ga0501072_0057107_586_1002 138
145 3300049588 Ga0501072_0109369 Ga0501072_0109369_376_792 138
146 3300049588 Ga0501072_0135353 Ga0501072_0135353_422_838 138
147 3300049589 Ga0501073_0458758 Ga0501073_0458758_175_591 138
148 3300049589 Ga0501073_0772950 Ga0501073_0772950_224_640 138
149 3300049590 Ga0501074_0034726 Ga0501074_0034726_104_520 138
150 3300049590 Ga0501074_0384238 Ga0501074_0384238_330_746 138
151 3300049591 Ga0501075_0049788 Ga0501075_0049788_1467_1883 138
152 3300049591 Ga0501075_0169150 Ga0501075_0169150_1108_1524 138
153 3300049591 Ga0501075_0255105 Ga0501075_0255105_227_643 138
154 3300049592 Ga0501076_0004872 Ga0501076_0004872_5390_5806 138
155 3300049592 Ga0501076_0090848 Ga0501076_0090848_1346_1762 138
156 3300049593 Ga0501077_0341655 Ga0501077_0341655_257_673 138
157 3300049741 Ga0501079_0140004 Ga0501079_0140004_1374_1790 138
158 3300049742 Ga0501080_0313319 Ga0501080_0313319_778_1194 138
159 3300049742 Ga0501080_0534616 Ga0501080_0534616_304_720 138
160 3300049743 Ga0501081_0014892 Ga0501081_0014892_3546_3962 138
161 3300049743 Ga0501081_0047536 Ga0501081_0047536_1593_2009 138
162 3300049743 Ga0501081_0102993 Ga0501081_0102993_589_1005 138
163 3300049744 Ga0501083_0122220 Ga0501083_0122220_138_554 138
164 3300049744 Ga0501083_0123618 Ga0501083_0123618_859_1275 138
165 3300049822 Ga0501035_0003558 Ga0501035_0003558_8435_8851 138
166 3300049822 Ga0501035_0029460 Ga0501035_0029460_793_1209 138
167 3300049822 Ga0501035_0110123 Ga0501035_0110123_304_720 138
168 3300049822 Ga0501035_0567151 Ga0501035_0567151_396_812 138
169 3300049823 Ga0501044_0012537 Ga0501044_0012537_8508_8924 138
170 3300049823 Ga0501044_0135187 Ga0501044_0135187_1745_2161 138
171 3300049823 Ga0501044_1097480 Ga0501044_1097480_60_476 138
172 3300049824 Ga0501045_0102718 Ga0501045_0102718_1161_1577 138
173 3300049824 Ga0501045_0103879 Ga0501045_0103879_345_761 138
174 3300054114 Ga0501084_0036099 Ga0501084_0036099_1111_1527 138
175 3300054114 Ga0501084_1052648 Ga0501084_1052648_95_511 138
176 3300060353 Ga0501082_0102395 Ga0501082_0102395_951_1367 138
177 3300060353 Ga0501082_0207447 Ga0501082_0207447_897_1313 138
178 3300060353 Ga0501082_0294358 Ga0501082_0294358_332_748 138
179 3300060353 Ga0501082_0310757 Ga0501082_0310757_210_626 138
180 3300060353 Ga0501082_0770351 Ga0501082_0770351_410_826 138
181 3300061734 Ga0530510_0036229 Ga0530510_0036229_2351_2767 138
182 3300061734 Ga0530510_0081010 Ga0530510_0081010_1530_1946 138
183 3300061734 Ga0530510_0161024 Ga0530510_0161024_191_607 138
184 3300005289 Ga0065704_10074055 Ga0065704_100740553 139
185 3300005331 Ga0070670_100708780 Ga0070670_1007087802 139
186 3300005333 Ga0070677_10073662 Ga0070677_100736621 139
187 3300005336 Ga0070680_100073276 Ga0070680_1000732761 139
188 3300005339 Ga0070660_100586184 Ga0070660_1005861842 139
189 3300005341 Ga0070691_10253996 Ga0070691_102539962 139
190 3300005347 Ga0070668_100003865 Ga0070668_1000038654 139
191 3300005353 Ga0070669_100073662 Ga0070669_1000736622 139
192 3300005356 Ga0070674_100007315 Ga0070674_1000073152 139
193 3300005366 Ga0070659_100612906 Ga0070659_1006129062 139
194 3300005367 Ga0070667_101041785 Ga0070667_1010417851 139
195 3300005456 Ga0070678_100506480 Ga0070678_1005064802 139
196 3300005457 Ga0070662_100057582 Ga0070662_1000575823 139
197 3300005458 Ga0070681_10221368 Ga0070681_102213682 139
198 3300005459 Ga0068867_100037532 Ga0068867_1000375324 139
199 3300005543 Ga0070672_100026177 Ga0070672_1000261772 139
200 3300005546 Ga0070696_101748099 Ga0070696_1017480991 139
201 3300005563 Ga0068855_100447605 Ga0068855_1004476052 139
202 3300005563 Ga0068855_101074167 Ga0068855_1010741672 139
203 3300005577 Ga0068857_100406822 Ga0068857_1004068222 139
204 3300005577 Ga0068857_100956301 Ga0068857_1009563012 139
205 3300005578 Ga0068854_100475530 Ga0068854_1004755302 139
206 3300005616 Ga0068852_100371037 Ga0068852_1003710372 139
207 3300005719 Ga0068861_100005563 Ga0068861_1000055634 139
208 3300005834 Ga0068851_10680403 Ga0068851_106804031 139
209 3300005840 Ga0068870_10020516 Ga0068870_100205162 139
210 3300005840 Ga0068870_10179404 Ga0068870_101794042 139
211 3300005844 Ga0068862_100002993 Ga0068862_1000029935 139
212 3300006358 Ga0068871_100428554 Ga0068871_1004285542 139
213 3300006844 Ga0075428_101236697 Ga0075428_1012366971 139
214 3300006847 Ga0075431_100100053 Ga0075431_1001000532 139
215 3300006881 Ga0068865_100120811 Ga0068865_1001208112 139
216 3300009148 Ga0105243_10114846 Ga0105243_101148462 139
217 3300009553 Ga0105249_10986042 Ga0105249_109860421 139
218 3300013308 Ga0157375_10343247 Ga0157375_103432472 139
219 3300014326 Ga0157380_10054565 Ga0157380_100545654 139
220 3300025907 Ga0207645_10018207 Ga0207645_100182072 139
221 3300025908 Ga0207643_10027319 Ga0207643_100273192 139
222 3300025908 Ga0207643_10157749 Ga0207643_101577492 139
223 3300025912 Ga0207707_10669662 Ga0207707_106696621 139
224 3300025913 Ga0207695_11001890 Ga0207695_110018902 139
225 3300025917 Ga0207660_10593287 Ga0207660_105932872 139
226 3300025932 Ga0207690_10303487 Ga0207690_103034872 139
227 3300025933 Ga0207706_10034576 Ga0207706_100345764 139
228 3300025937 Ga0207669_10322115 Ga0207669_103221152 139
229 3300025938 Ga0207704_10266551 Ga0207704_102665511 139
230 3300025940 Ga0207691_10000307 Ga0207691_1000030745 139
231 3300025949 Ga0207667_10308661 Ga0207667_103086613 139
232 3300025981 Ga0207640_10440301 Ga0207640_104403012 139
233 3300025986 Ga0207658_10935084 Ga0207658_109350841 139
234 3300026035 Ga0207703_10332099 Ga0207703_103320991 139
235 3300026075 Ga0207708_10172443 Ga0207708_101724431 139
236 3300026089 Ga0207648_10002642 Ga0207648_100026425 139
237 3300026116 Ga0207674_10412908 Ga0207674_104129082 139
238 3300026118 Ga0207675_100001848 Ga0207675_10000184814 139
239 3300026121 Ga0207683_10255017 Ga0207683_102550172 139
240 3300027252 Ga0209973_1006204 Ga0209973_10062042 139
241 3300027364 Ga0209967_1013322 Ga0209967_10133222 139
242 3300027395 Ga0209996_1007982 Ga0209996_10079822 139
243 3300027462 Ga0210000_1005717 Ga0210000_10057172 139
244 3300027526 Ga0209968_1007913 Ga0209968_10079132 139
245 3300027552 Ga0209982_1003042 Ga0209982_10030422 139
246 3300027614 Ga0209970_1025088 Ga0209970_10250882 139
247 3300027617 Ga0210002_1001941 Ga0210002_10019412 139
248 3300027665 Ga0209983_1005582 Ga0209983_10055822 139
249 3300027682 Ga0209971_1000728 Ga0209971_10007285 139
250 3300027695 Ga0209966_1005276 Ga0209966_10052762 139
251 3300027717 Ga0209998_10000548 Ga0209998_100005485 139
252 3300027876 Ga0209974_10001992 Ga0209974_100019922 139
253 3300027907 Ga0207428_10141042 Ga0207428_101410422 139
254 3300028380 Ga0268265_10008501 Ga0268265_100085016 139
255 3300031731 Ga0307405_10059175 Ga0307405_100591752 139
256 3300031824 Ga0307413_10197393 Ga0307413_101973932 139
257 3300031852 Ga0307410_10177040 Ga0307410_101770402 139
258 3300031903 Ga0307407_10943985 Ga0307407_109439851 139
259 3300031995 Ga0307409_100111461 Ga0307409_1001114612 139
260 3300032002 Ga0307416_100080503 Ga0307416_1000805033 139
261 3300032002 Ga0307416_100750949 Ga0307416_1007509492 139
262 3300032005 Ga0307411_10038720 Ga0307411_100387202 139
263 3300032005 Ga0307411_10194081 Ga0307411_101940812 139
264 3300032126 Ga0307415_100020213 Ga0307415_1000202133 139
265 3300042009 Ga0439451_017613 Ga0439451_017613_46_465 139
266 3300042436 Ga0439435_0006151 Ga0439435_0006151_1073_1492 139
267 3300042437 Ga0439444_0005461 Ga0439444_0005461_204_623 139
268 3300042532 Ga0450893_0017070 Ga0450893_0017070_543_962 139
269 3300042532 Ga0450893_0022221 Ga0450893_0022221_437_856 139
270 3300042876 Ga0451577_0006530 Ga0451577_0006530_8692_9111 139
271 3300042876 Ga0451577_0047389 Ga0451577_0047389_377_796 139
272 3300044673 Ga0453683_0055721 Ga0453683_0055721_1838_2257 139
273 3300044712 Ga0453684_0044982 Ga0453684_0044982_398_817 139
274 3300044712 Ga0453684_0142370 Ga0453684_0142370_2127_2546 139
275 3300045051 Ga0451576_0006005 Ga0451576_0006005_14257_14676 139
276 3300045051 Ga0451576_0183206 Ga0451576_0183206_879_1298 139
277 3300048917 Ga0496114_1765955 Ga0496114_1765955_40_459 139
278 3300049568 Ga0501031_0020308 Ga0501031_0020308_616_1035 139
279 3300049569 Ga0501032_0007111 Ga0501032_0007111_7146_7565 139
280 3300049570 Ga0501033_0298082 Ga0501033_0298082_303_722 139
281 3300049571 Ga0501034_0024429 Ga0501034_0024429_4934_5353 139
282 3300049572 Ga0501036_0008585 Ga0501036_0008585_7474_7893 139
283 3300049574 Ga0501038_0496808 Ga0501038_0496808_442_861 139
284 3300049575 Ga0501039_0038626 Ga0501039_0038626_829_1248 139
285 3300049578 Ga0501042_0027392 Ga0501042_0027392_1752_2171 139
286 3300049581 Ga0501047_0024527 Ga0501047_0024527_3849_4268 139
287 3300049582 Ga0501048_0044131 Ga0501048_0044131_1888_2307 139
288 3300049583 Ga0501067_0001589 Ga0501067_0001589_3189_3608 139
289 3300049584 Ga0501068_0011937 Ga0501068_0011937_2186_2605 139
290 3300049585 Ga0501069_0060165 Ga0501069_0060165_654_1073 139
291 3300049586 Ga0501070_0037876 Ga0501070_0037876_644_1063 139
292 3300049590 Ga0501074_0011061 Ga0501074_0011061_3694_4113 139
293 3300049742 Ga0501080_0035208 Ga0501080_0035208_113_532 139
294 3300049822 Ga0501035_0021128 Ga0501035_0021128_4934_5353 139
295 3300049822 Ga0501035_0062838 Ga0501035_0062838_2701_3120 139
296 3300049822 Ga0501035_0074932 Ga0501035_0074932_1671_2090 139
297 3300049823 Ga0501044_0016340 Ga0501044_0016340_7207_7626 139
298 3300049823 Ga0501044_0189506 Ga0501044_0189506_989_1408 139
299 3300049824 Ga0501045_0135176 Ga0501045_0135176_941_1360 139
300 3300050511 nmdc:mga08y16_1186369_c1 nmdc:mga08y16_1186369_c1_38_457 139
301 3300053121 Ga0500607_018781 Ga0500607_018781_940_1359 139
302 3300053177 Ga0500636_0000716 Ga0500636_0000716_1778_2197 139
303 3300053178 Ga0500637_0098954 Ga0500637_0098954_1148_1567 139
304 3300053729 Ga0500625_025128 Ga0500625_025128_13_432 139
305 3300054114 Ga0501084_0012232 Ga0501084_0012232_3086_3505 139
306 3300060353 Ga0501082_0009438 Ga0501082_0009438_3102_3521 139
307 3300005337 Ga0070682_101256036 Ga0070682_1012560362 140
308 3300005338 Ga0068868_102244655 Ga0068868_1022446551 140
309 3300005543 Ga0070672_100203977 Ga0070672_1002039772 140
310 3300005548 Ga0070665_100907455 Ga0070665_1009074552 140
311 3300005563 Ga0068855_100017268 Ga0068855_1000172688 140
312 3300005563 Ga0068855_100104291 Ga0068855_1001042912 140
313 3300006051 Ga0075364_10101210 Ga0075364_101012101 140
314 3300006881 Ga0068865_100026691 Ga0068865_1000266914 140
315 3300009093 Ga0105240_10011909 Ga0105240_100119099 140
316 3300009093 Ga0105240_10035277 Ga0105240_100352774 140
317 3300009174 Ga0105241_10080469 Ga0105241_100804694 140
318 3300009174 Ga0105241_10274394 Ga0105241_102743943 140
319 3300009545 Ga0105237_10188250 Ga0105237_101882504 140
320 3300009545 Ga0105237_10494977 Ga0105237_104949773 140
321 3300009551 Ga0105238_10095459 Ga0105238_100954592 140
322 3300009551 Ga0105238_10434803 Ga0105238_104348032 140
323 3300009551 Ga0105238_10782795 Ga0105238_107827952 140
324 3300010375 Ga0105239_10076331 Ga0105239_100763314 140
325 3300010375 Ga0105239_10146980 Ga0105239_101469804 140
326 3300010375 Ga0105239_11528378 Ga0105239_115283782 140
327 3300013105 Ga0157369_10054636 Ga0157369_100546364 140
328 3300025911 Ga0207654_10800603 Ga0207654_108006031 140
329 3300025913 Ga0207695_10007174 Ga0207695_100071744 140
330 3300025913 Ga0207695_10011239 Ga0207695_100112393 140
331 3300025913 Ga0207695_10058556 Ga0207695_100585564 140
332 3300025914 Ga0207671_10109266 Ga0207671_101092662 140
333 3300025924 Ga0207694_10041115 Ga0207694_100411152 140
334 3300025924 Ga0207694_10056647 Ga0207694_100566474 140
335 3300025932 Ga0207690_10979383 Ga0207690_109793832 140
336 3300025940 Ga0207691_10214526 Ga0207691_102145261 140
337 3300025949 Ga0207667_10032939 Ga0207667_100329392 140
338 3300025949 Ga0207667_10033289 Ga0207667_100332894 140
339 3300026078 Ga0207702_10699417 Ga0207702_106994172 140
340 3300028379 Ga0268266_10432689 Ga0268266_104326893 140
341 3300028800 Ga0265338_10166985 Ga0265338_101669852 140
342 3300031235 Ga0265330_10089961 Ga0265330_100899612 140
343 3300031241 Ga0265325_10092655 Ga0265325_100926551 140
344 3300031249 Ga0265339_10053659 Ga0265339_100536593 140
345 3300031344 Ga0265316_10574252 Ga0265316_105742522 140
346 3300031595 Ga0265313_10072744 Ga0265313_100727442 140
347 3300031711 Ga0265314_10244543 Ga0265314_102445431 140
348 3300041407 Ga0439447_071968 Ga0439447_071968_356_778 140
349 3300041997 Ga0439431_0276314 Ga0439431_0276314_57_479 140
350 3300042006 Ga0439432_151907 Ga0439432_151907_174_596 140
351 3300042015 Ga0439462_0066199 Ga0439462_0066199_458_880 140
352 3300042876 Ga0451577_1743117 Ga0451577_1743117_107_529 140
353 3300044712 Ga0453684_0650865 Ga0453684_0650865_186_608 140
354 3300046660 Ga0495625_0830795 Ga0495625_0830795_17_439 140
355 3300048924 Ga0496121_0059944 Ga0496121_0059944_2262_2684 140
356 3300048925 Ga0496122_0304798 Ga0496122_0304798_272_694 140
357 3300048927 Ga0496124_0000007 Ga0496124_0000007_651555_651977 140
358 3300050491 nmdc:mga00v17_71268_c1 nmdc:mga00v17_71268_c1_535_957 140
359 3300005328 Ga0070676_10516750 Ga0070676_105167501 141
360 3300031239 Ga0265328_10044204 Ga0265328_100442042 141
361 3300031727 Ga0316576_10029457 Ga0316576_100294575 141
362 3300031728 Ga0316578_10838414 Ga0316578_108384141 141
363 3300031733 Ga0316577_10023802 Ga0316577_100238022 141
364 3300034818 Ga0373950_0046372 Ga0373950_0046372_359_784 141
365 3300045049 Ga0466959_0134745 Ga0466959_0134745_579_1004 141
366 3300045836 Ga0466958_0031270 Ga0466958_0031270_340_765 141
367 3300005439 Ga0070711_100612066 Ga0070711_1006120661 142
368 3300025916 Ga0207663_10246248 Ga0207663_102462483 142
369 3300031241 Ga0265325_10048132 Ga0265325_100481322 142
370 3300036647 Ga0316582_0861036 Ga0316582_0861036_90_518 142
371 3300036712 Ga0316584_0067576 Ga0316584_0067576_286_714 142
372 3300044694 Ga0466963_0851775 Ga0466963_0851775_93_524 142
373 3300053108 Ga0500562_060075 Ga0500562_060075_264_692 142
374 2162886007 SwRhRL2b_contig_3548226 SwRhRL2b_0795.00003270 143
375 3300044694 Ga0466963_0024510 Ga0466963_0024510_2115_2576 144
376 3300045836 Ga0466958_0027374 Ga0466958_0027374_2289_2750 144
377 3300045976 Ga0466967_0016669 Ga0466967_0016669_4048_4509 144
378 3300009177 Ga0105248_10015427 Ga0105248_100154277 146
379 3300025941 Ga0207711_10040703 Ga0207711_100407035 146
380 3300048905 Ga0496102_1742609 Ga0496102_1742609_56_520 146
381 3300048919 Ga0496116_0113050 Ga0496116_0113050_878_1342 146
382 3300048920 Ga0496117_0013651 Ga0496117_0013651_3117_3581 146
383 3300048921 Ga0496118_0000778 Ga0496118_0000778_22603_23067 146
384 3300048922 Ga0496119_0005771 Ga0496119_0005771_9184_9648 146
385 3300005295 Ga0065707_10185887 Ga0065707_101858871 147
386 3300005353 Ga0070669_100832252 Ga0070669_1008322522 147
387 3300005467 Ga0070706_100250021 Ga0070706_1002500212 147
388 3300025923 Ga0207681_10786824 Ga0207681_107868242 147
389 iso_pu_bacteria 2919709256 2919712595 147
390 3300005295 Ga0065707_10556567 Ga0065707_105565672 149
391 3300005618 Ga0068864_100011628 Ga0068864_1000116285 149
392 3300026095 Ga0207676_10002454 Ga0207676_100024543 149
393 2162886006 SwRhRL3b_contig_2280204 SwRhRL3b_0459.00000470 152
394 3300002459 JGI24751J29686_10030580 JGI24751J29686_100305801 152
395 3300005295 Ga0065707_10000429 Ga0065707_1000042957 152
396 3300014326 Ga0157380_10000090 Ga0157380_1000009016 152
397 2162886006 SwRhRL3b_contig_121946 SwRhRL3b_0991.00000580 154
398 2162886007 SwRhRL2b_contig_2960894 SwRhRL2b_0815.00002220 154
399 2162886007 SwRhRL2b_contig_3176492 SwRhRL2b_0921.00005620 154
400 3300002070 JGI24750J21931_1003811 JGI24750J21931_10038112 154
401 3300002074 JGI24748J21848_1004694 JGI24748J21848_10046942 154
402 3300002074 JGI24748J21848_1024294 JGI24748J21848_10242941 154
403 3300002239 JGI24034J26672_10011990 JGI24034J26672_100119901 154
404 3300002239 JGI24034J26672_10012730 JGI24034J26672_100127302 154
405 3300002459 JGI24751J29686_10000021 JGI24751J29686_1000002110 154
406 3300002459 JGI24751J29686_10039656 JGI24751J29686_100396561 154
407 3300002459 JGI24751J29686_10087433 JGI24751J29686_100874331 154
408 3300005289 Ga0065704_10001735 Ga0065704_100017353 154
409 3300005289 Ga0065704_10070182 Ga0065704_1007018254 154
410 3300005289 Ga0065704_10070243 Ga0065704_1007024331 154
411 3300005289 Ga0065704_10237392 Ga0065704_102373922 154
412 3300005295 Ga0065707_10081908 Ga0065707_1008190812 154
413 3300005295 Ga0065707_10087286 Ga0065707_100872866 154
414 3300005295 Ga0065707_10110335 Ga0065707_101103352 154
415 3300005295 Ga0065707_10125778 Ga0065707_101257782 154
416 3300005331 Ga0070670_100000006 Ga0070670_10000000683 154
417 3300005331 Ga0070670_100008603 Ga0070670_1000086035 154
418 3300005331 Ga0070670_100136196 Ga0070670_1001361962 154
419 3300005331 Ga0070670_101130219 Ga0070670_1011302192 154
420 3300005335 Ga0070666_10023715 Ga0070666_100237152 154
421 3300005335 Ga0070666_10211113 Ga0070666_102111132 154
422 3300005347 Ga0070668_100049185 Ga0070668_1000491853 154
423 3300005347 Ga0070668_100067734 Ga0070668_1000677342 154
424 3300005353 Ga0070669_100000142 Ga0070669_10000014261 154
425 3300005353 Ga0070669_100000305 Ga0070669_10000030528 154
426 3300005355 Ga0070671_100001357 Ga0070671_1000013578 154
427 3300005355 Ga0070671_100086764 Ga0070671_1000867642 154
428 3300005367 Ga0070667_100001490 Ga0070667_10000149014 154
429 3300005367 Ga0070667_100002768 Ga0070667_1000027686 154
430 3300005367 Ga0070667_100038261 Ga0070667_1000382613 154
431 3300005367 Ga0070667_100135983 Ga0070667_1001359832 154
432 3300005440 Ga0070705_100097332 Ga0070705_1000973322 154
433 3300005440 Ga0070705_100161492 Ga0070705_1001614922 154
434 3300005445 Ga0070708_100006274 Ga0070708_1000062747 154
435 3300005466 Ga0070685_10610417 Ga0070685_106104171 154
436 3300005544 Ga0070686_100186333 Ga0070686_1001863331 154
437 3300005548 Ga0070665_100010084 Ga0070665_1000100843 154
438 3300005548 Ga0070665_100025987 Ga0070665_1000259875 154
439 3300005615 Ga0070702_100088831 Ga0070702_1000888312 154
440 3300005617 Ga0068859_100008174 Ga0068859_1000081743 154
441 3300005617 Ga0068859_100140506 Ga0068859_1001405063 154
442 3300005617 Ga0068859_100180300 Ga0068859_1001803002 154
443 3300005618 Ga0068864_100000014 Ga0068864_100000014232 154
444 3300005719 Ga0068861_100079594 Ga0068861_1000795943 154
445 3300005841 Ga0068863_100009781 Ga0068863_10000978111 154
446 3300005841 Ga0068863_100225220 Ga0068863_1002252201 154
447 3300005842 Ga0068858_100000037 Ga0068858_10000003788 154
448 3300005842 Ga0068858_100121751 Ga0068858_1001217513 154
449 3300005843 Ga0068860_100001149 Ga0068860_10000114915 154
450 3300005843 Ga0068860_100025233 Ga0068860_1000252333 154
451 3300005843 Ga0068860_100025549 Ga0068860_1000255493 154
452 3300005844 Ga0068862_100000007 Ga0068862_10000000771 154
453 3300005844 Ga0068862_100000728 Ga0068862_10000072825 154
454 3300005844 Ga0068862_100016222 Ga0068862_1000162223 154
455 3300006931 Ga0097620_100008174 Ga0097620_1000081743 154
456 3300006931 Ga0097620_100140518 Ga0097620_1001405182 154
457 3300006931 Ga0097620_100180300 Ga0097620_1001803003 154
458 3300009011 Ga0105251_10002008 Ga0105251_1000200816 154
459 3300009011 Ga0105251_10190938 Ga0105251_101909382 154
460 3300009092 Ga0105250_10001628 Ga0105250_100016286 154
461 3300009101 Ga0105247_10000444 Ga0105247_1000044426 154
462 3300009101 Ga0105247_10036659 Ga0105247_100366592 154
463 3300009101 Ga0105247_10085674 Ga0105247_100856743 154
464 3300009177 Ga0105248_10000139 Ga0105248_1000013934 154
465 3300009177 Ga0105248_10003016 Ga0105248_1000301613 154
466 3300009177 Ga0105248_10064494 Ga0105248_100644943 154
467 3300009177 Ga0105248_12268007 Ga0105248_122680071 154
468 3300009553 Ga0105249_10025631 Ga0105249_100256314 154
469 3300009553 Ga0105249_10027933 Ga0105249_100279332 154
470 3300009553 Ga0105249_10141464 Ga0105249_101414642 154
471 3300009978 Ga0105148_100004 Ga0105148_10000421 154
472 3300013306 Ga0163162_10000562 Ga0163162_1000056213 154
473 3300013306 Ga0163162_10038161 Ga0163162_100381613 154
474 3300013306 Ga0163162_10631382 Ga0163162_106313822 154
475 3300014325 Ga0163163_10025754 Ga0163163_100257545 154
476 3300014325 Ga0163163_10046224 Ga0163163_100462244 154
477 3300014325 Ga0163163_10106852 Ga0163163_101068523 154
478 3300014326 Ga0157380_10000014 Ga0157380_1000001457 154
479 3300014326 Ga0157380_10021050 Ga0157380_100210505 154
480 3300014968 Ga0157379_10023914 Ga0157379_100239143 154
481 3300014968 Ga0157379_10174165 Ga0157379_101741652 154
482 3300017792 Ga0163161_10129868 Ga0163161_101298682 154
483 3300025290 Ga0207673_1006199 Ga0207673_10061992 154
484 3300025315 Ga0207697_10009182 Ga0207697_100091823 154
485 3300025711 Ga0207696_1000958 Ga0207696_100095815 154
486 3300025735 Ga0207713_1000985 Ga0207713_10009859 154
487 3300025735 Ga0207713_1017238 Ga0207713_10172382 154
488 3300025900 Ga0207710_10000902 Ga0207710_1000090211 154
489 3300025903 Ga0207680_10022797 Ga0207680_100227972 154
490 3300025903 Ga0207680_10032994 Ga0207680_100329943 154
491 3300025903 Ga0207680_10319484 Ga0207680_103194842 154
492 3300025923 Ga0207681_10000001 Ga0207681_10000001227 154
493 3300025923 Ga0207681_10000229 Ga0207681_100002299 154
494 3300025923 Ga0207681_10031286 Ga0207681_100312863 154
495 3300025925 Ga0207650_10000023 Ga0207650_10000023228 154
496 3300025925 Ga0207650_10000353 Ga0207650_1000035315 154
497 3300025931 Ga0207644_10005087 Ga0207644_100050875 154
498 3300025931 Ga0207644_10020343 Ga0207644_100203434 154
499 3300025941 Ga0207711_10000646 Ga0207711_1000064633 154
500 3300025941 Ga0207711_10067497 Ga0207711_100674973 154
501 3300025941 Ga0207711_10074336 Ga0207711_100743362 154
502 3300025941 Ga0207711_10230613 Ga0207711_102306131 154
503 3300025961 Ga0207712_10000186 Ga0207712_1000018664 154
504 3300025961 Ga0207712_10025601 Ga0207712_100256013 154
505 3300025961 Ga0207712_10116506 Ga0207712_101165062 154
506 3300025972 Ga0207668_10001050 Ga0207668_100010509 154
507 3300025972 Ga0207668_10012445 Ga0207668_100124453 154
508 3300025972 Ga0207668_10499395 Ga0207668_104993952 154
509 3300025986 Ga0207658_10001241 Ga0207658_100012416 154
510 3300025986 Ga0207658_10004125 Ga0207658_100041256 154
511 3300025986 Ga0207658_10027018 Ga0207658_100270182 154
512 3300025986 Ga0207658_10762902 Ga0207658_107629021 154
513 3300026035 Ga0207703_10000228 Ga0207703_100002289 154
514 3300026035 Ga0207703_10008486 Ga0207703_100084862 154
515 3300026088 Ga0207641_10155791 Ga0207641_101557912 154
516 3300026088 Ga0207641_10855781 Ga0207641_108557812 154
517 3300026095 Ga0207676_10000017 Ga0207676_10000017230 154
518 3300026118 Ga0207675_100000707 Ga0207675_10000070726 154
519 3300028379 Ga0268266_10007786 Ga0268266_100077863 154
520 3300028379 Ga0268266_10020596 Ga0268266_100205964 154
521 3300028380 Ga0268265_10000002 Ga0268265_10000002232 154
522 3300028380 Ga0268265_10000370 Ga0268265_1000037041 154
523 3300028380 Ga0268265_10024661 Ga0268265_100246612 154
524 3300028380 Ga0268265_10032838 Ga0268265_100328383 154
525 3300028380 Ga0268265_10114279 Ga0268265_101142792 154
526 3300028381 Ga0268264_10000397 Ga0268264_1000039732 154
527 3300028381 Ga0268264_10015326 Ga0268264_100153264 154
528 3300028381 Ga0268264_10018198 Ga0268264_100181983 154
529 3300048903 Ga0496100_0005098 Ga0496100_0005098_4067_4531 154
530 3300048905 Ga0496102_0000790 Ga0496102_0000790_15309_15773 154
531 3300048906 Ga0496103_0001463 Ga0496103_0001463_6791_7255 154
532 3300048907 Ga0496104_0001292 Ga0496104_0001292_5834_6298 154
533 3300048908 Ga0496105_0000099 Ga0496105_0000099_11527_11991 154
534 3300048909 Ga0496106_0178083 Ga0496106_0178083_1212_1676 154
535 3300048910 Ga0496107_0278957 Ga0496107_0278957_699_1163 154
536 3300048911 Ga0496108_0967695 Ga0496108_0967695_230_694 154
537 3300048913 Ga0496110_0025641 Ga0496110_0025641_1703_2167 154
538 3300048913 Ga0496110_0343833 Ga0496110_0343833_658_1122 154
539 3300048914 Ga0496111_0118557 Ga0496111_0118557_280_744 154
540 3300048915 Ga0496112_0102432 Ga0496112_0102432_24_488 154
541 3300048916 Ga0496113_0012342 Ga0496113_0012342_2243_2707 154
542 3300048918 Ga0496115_0360190 Ga0496115_0360190_388_852 154
543 3300048919 Ga0496116_0022270 Ga0496116_0022270_275_739 154
544 3300048920 Ga0496117_0000739 Ga0496117_0000739_35616_36080 154
545 3300048921 Ga0496118_0000862 Ga0496118_0000862_32368_32832 154
546 3300048921 Ga0496118_0153775 Ga0496118_0153775_63_527 154
547 3300048922 Ga0496119_0002550 Ga0496119_0002550_15303_15767 154
548 3300048923 Ga0496120_0002075 Ga0496120_0002075_15303_15767 154
549 3300048924 Ga0496121_0000058 Ga0496121_0000058_63029_63493 154
550 3300048924 Ga0496121_0010844 Ga0496121_0010844_4722_5186 154
551 3300048924 Ga0496121_0775749 Ga0496121_0775749_64_528 154
552 3300048925 Ga0496122_0002786 Ga0496122_0002786_16173_16637 154
553 3300048925 Ga0496122_0033512 Ga0496122_0033512_159_623 154
554 3300048925 Ga0496122_0041881 Ga0496122_0041881_2482_2946 154
555 3300048926 Ga0496123_0000332 Ga0496123_0000332_29159_29623 154
556 3300048926 Ga0496123_0021192 Ga0496123_0021192_1003_1467 154
557 3300048927 Ga0496124_0011178 Ga0496124_0011178_1881_2345 154
558 3300048927 Ga0496124_0021629 Ga0496124_0021629_1432_1896 154
559 3300048929 Ga0496126_0000934 Ga0496126_0000934_34674_35138 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

44

142

0.98

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

36

144

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9736 6 142
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9591 6 142
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9584 5 142
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9578 5 142
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9527 6 142
ID Description Score Start End Superfamily
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9736 6 142 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9637 10 116 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9591 6 142 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9492 24 113 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9375 45 117 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A1I0TNW8-F1-model_v4 HIT domain-containing protein (HIT family protein) 0.9898 1 142 GO:0003824
GO:0009117
AF-A0A2R3IU41-F1-model_v4 Scavenger mRNA decapping enzyme C-term binding family protein 0.9879 1 144 GO:0003824
GO:0009117
AF-A0A2E9D359-F1-model_v4 HIT family protein 0.9865 5 144 GO:0003824
GO:0009117
AF-A0A0B6S7H0-F1-model_v4 HIT domain-containing protein 0.9861 5 142 GO:0003824
GO:0009117
AF-A0A433B2Y2-F1-model_v4 HIT family protein 0.985 5 143 GO:0003824
GO:0009117

Feature Viewer

pLDDT pTM Quality
94.54 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map