F463540

General Info

Members Datasets Scaffolds Average Seq Length
559 251 559 128

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100389728|Ga0070708_1003897281
Length 147
Sequence MTGETYRILLAEDDRFLRKAAETTLKRSGFEVTTATDGEEALRAVGACNPHLVLLDLIMPKIQGFEVLRSIKADPATAAIPVIVLSNLGQERDVQRAMEGGAVAYRIKANLSLDDLVKQVKQVLGLEAAPVPAAAAGEPRVGKWAKP

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
106 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
197 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
202 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
203 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
248 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.38
Nodule 0
Rhizoplane 1.79
Rhizosphere 87.12
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10131026 3300005290 Bacteria 1549
2 Ga0065715_10200651 3300005293 Bacteria 1363
3 Ga0065707_10095295 3300005295 Bacteria 3394
4 Ga0070676_10004994 3300005328 Bacteria 7026
5 Ga0070690_100206809 3300005330 Bacteria 1368
6 Ga0070690_100287112 3300005330 Bacteria 1176
7 Ga0070670_100016475 3300005331 Bacteria 6346
8 Ga0070670_100203953 3300005331 Bacteria 1718
9 Ga0070677_10123588 3300005333 Bacteria 1172
10 Ga0068869_100012194 3300005334 Bacteria 5671
11 Ga0068869_100993356 3300005334 Bacteria 730
12 Ga0068869_101050600 3300005334 Unclassified 711
13 Ga0070666_11287886 3300005335 Bacteria 545
14 Ga0070680_100057339 3300005336 Bacteria 3184
15 Ga0070680_100085930 3300005336 Bacteria 2599
16 Ga0070680_101130324 3300005336 Bacteria 677
17 Ga0070682_100000209 3300005337 Bacteria 42875
18 Ga0068868_100188185 3300005338 Bacteria 1716
19 Ga0070660_100000889 3300005339 Bacteria 19987
20 Ga0070689_100040262 3300005340 Bacteria 3582
21 Ga0070689_100286529 3300005340 Bacteria 1368
22 Ga0070691_10092435 3300005341 Bacteria 1493
23 Ga0070691_10709998 3300005341 Bacteria 604
24 Ga0070687_100025254 3300005343 Bacteria 2848
25 Ga0070687_100293384 3300005343 Bacteria 1029
26 Ga0070687_100657793 3300005343 Bacteria 727
27 Ga0070687_101037994 3300005343 Bacteria 596
28 Ga0070661_100099572 3300005344 Bacteria 2160
29 Ga0070692_10002653 3300005345 Bacteria 6997
30 Ga0070692_10202611 3300005345 Bacteria 1163
31 Ga0070692_10429999 3300005345 Bacteria 840
32 Ga0070668_102167651 3300005347 Bacteria 513
33 Ga0070669_100021355 3300005353 Bacteria 4626
34 Ga0070669_100148512 3300005353 Bacteria 1813
35 Ga0070669_100158895 3300005353 Bacteria 1755
36 Ga0070675_100226825 3300005354 Bacteria 1628
37 Ga0070671_100026220 3300005355 Bacteria 4788
38 Ga0070671_100200890 3300005355 Bacteria 1690
39 Ga0070674_100565580 3300005356 Bacteria 956
40 Ga0070673_100146487 3300005364 Bacteria 1996
41 Ga0070673_100267348 3300005364 Bacteria 1496
42 Ga0070688_100329446 3300005365 Bacteria 1112
43 Ga0070659_100081193 3300005366 Bacteria 2589
44 Ga0070667_100244676 3300005367 Bacteria 1602
45 Ga0070667_101320983 3300005367 Bacteria 676
46 Ga0070703_10011031 3300005406 Bacteria 2551
47 Ga0070703_10048157 3300005406 Bacteria 1353
48 Ga0070701_10199906 3300005438 Bacteria 1181
49 Ga0070705_100002138 3300005440 Bacteria 10055
50 Ga0070705_100011402 3300005440 Bacteria 4484
51 Ga0070705_100025632 3300005440 Bacteria 3199
52 Ga0070705_100092807 3300005440 Bacteria 1885
53 Ga0070700_100180644 3300005441 Bacteria 1468
54 Ga0070700_100357991 3300005441 Bacteria 1084
55 Ga0070700_101193630 3300005441 Unclassified 635
56 Ga0070694_100035346 3300005444 Bacteria 3303
57 Ga0070694_100094820 3300005444 Bacteria 2100
58 Ga0070694_100120513 3300005444 Bacteria 1882
59 Ga0070694_100209059 3300005444 Bacteria 1458
60 Ga0070694_100227937 3300005444 Bacteria 1400
61 Ga0070694_100260256 3300005444 Bacteria 1316
62 Ga0070708_100035879 3300005445 Bacteria 4322
63 Ga0070708_100123755 3300005445 Bacteria 2388
64 Ga0070708_100280173 3300005445 Bacteria 1569
65 Ga0070708_100305083 3300005445 Bacteria 1499
66 Ga0070708_100389728 3300005445 Bacteria 1314
67 Ga0070663_100060002 3300005455 Bacteria 2735
68 Ga0070663_100102237 3300005455 Bacteria 2140
69 Ga0070663_100133778 3300005455 Bacteria 1886
70 Ga0070662_100001887 3300005457 Bacteria 12851
71 Ga0070681_10040550 3300005458 Bacteria 4664
72 Ga0068867_100008628 3300005459 Bacteria 7198
73 Ga0068867_101430717 3300005459 Bacteria 642
74 Ga0070685_10454361 3300005466 Unclassified 898
75 Ga0070706_100013629 3300005467 Bacteria 7516
76 Ga0070706_100053816 3300005467 Bacteria 3715
77 Ga0070706_100255223 3300005467 Bacteria 1637
78 Ga0070706_100501723 3300005467 Bacteria 1129
79 Ga0070706_100617294 3300005467 Bacteria 1007
80 Ga0070706_101350701 3300005467 Bacteria 653
81 Ga0070707_100023904 3300005468 Bacteria 5781
82 Ga0070707_100047594 3300005468 Bacteria 4105
83 Ga0070707_100059927 3300005468 Bacteria 3650
84 Ga0070707_100384178 3300005468 Unclassified 1364
85 Ga0070707_100437103 3300005468 Bacteria 1269
86 Ga0070698_100043197 3300005471 Bacteria 4622
87 Ga0070698_100619447 3300005471 Bacteria 1023
88 Ga0070698_101114574 3300005471 Bacteria 738
89 Ga0070698_101547185 3300005471 Bacteria 615
90 Ga0070699_100050293 3300005518 Bacteria 3608
91 Ga0070699_100222511 3300005518 Bacteria 1682
92 Ga0070699_100421370 3300005518 Bacteria 1208
93 Ga0070699_101752322 3300005518 Bacteria 569
94 Ga0070679_100004203 3300005530 Bacteria 13282
95 Ga0070679_100085634 3300005530 Bacteria 3138
96 Ga0070697_100398636 3300005536 Viruses 1194
97 Ga0070697_100497201 3300005536 Bacteria 1066
98 Ga0070697_100614277 3300005536 Bacteria 956
99 Ga0070697_101593930 3300005536 Unclassified 584
100 Ga0068853_100000779 3300005539 Bacteria 22116
101 Ga0070672_100703482 3300005543 Bacteria 885
102 Ga0070686_100065099 3300005544 Bacteria 2366
103 Ga0070686_100255128 3300005544 Unclassified 1283
104 Ga0070686_100486083 3300005544 Bacteria 955
105 Ga0070686_101321382 3300005544 Bacteria 603
106 Ga0070695_100005992 3300005545 Bacteria 7179
107 Ga0070695_100027123 3300005545 Bacteria 3546
108 Ga0070695_100359264 3300005545 Unclassified 1093
109 Ga0070695_101599704 3300005545 Bacteria 544
110 Ga0070696_100021012 3300005546 Bacteria 4424
111 Ga0070696_100098996 3300005546 Bacteria 2086
112 Ga0070696_100262259 3300005546 Bacteria 1310
113 Ga0070696_100282831 3300005546 Bacteria 1265
114 Ga0070696_101062794 3300005546 Bacteria 679
115 Ga0070693_100009061 3300005547 Bacteria 4938
116 Ga0070665_100051283 3300005548 Bacteria 4138
117 Ga0070665_100250577 3300005548 Bacteria 1771
118 Ga0070665_101801174 3300005548 Bacteria 619
119 Ga0070704_100000295 3300005549 Bacteria 21958
120 Ga0070704_100019748 3300005549 Bacteria 4335
121 Ga0070704_100034310 3300005549 Bacteria 3440
122 Ga0070704_100062074 3300005549 Bacteria 2677
123 Ga0070704_100124787 3300005549 Bacteria 1984
124 Ga0070704_100225909 3300005549 Bacteria 1524
125 Ga0068855_100000002 3300005563 Bacteria 616881
126 Ga0068855_100043065 3300005563 Bacteria 5349
127 Ga0070664_100022654 3300005564 Bacteria 5180
128 Ga0070664_100030512 3300005564 Bacteria 4498
129 Ga0068857_100009095 3300005577 Bacteria 8618
130 Ga0068857_100025547 3300005577 Bacteria 5201
131 Ga0068857_100136677 3300005577 Bacteria 2213
132 Ga0068857_100851923 3300005577 Unclassified 872
133 Ga0068857_100953571 3300005577 Bacteria 824
134 Ga0068854_100010618 3300005578 Bacteria 5976
135 Ga0068856_100000353 3300005614 Bacteria 50137
136 Ga0070702_100154757 3300005615 Bacteria 1476
137 Ga0070702_100649862 3300005615 Bacteria 797
138 Ga0070702_100688644 3300005615 Bacteria 778
139 Ga0068852_100000001 3300005616 Bacteria 716526
140 Ga0068852_100192609 3300005616 Bacteria 1925
141 Ga0068859_100017951 3300005617 Bacteria 7111
142 Ga0068859_100114427 3300005617 Bacteria 2762
143 Ga0068859_100190985 3300005617 Bacteria 2132
144 Ga0068859_100242326 3300005617 Bacteria 1892
145 Ga0068859_100243780 3300005617 Bacteria 1887
146 Ga0068859_100731954 3300005617 Unclassified 1079
147 Ga0068859_101553907 3300005617 Unclassified 731
148 Ga0068864_100009574 3300005618 Bacteria 7989
149 Ga0068864_100078861 3300005618 Bacteria 2883
150 Ga0068864_100167270 3300005618 Bacteria 2003
151 Ga0068864_100320052 3300005618 Bacteria 1457
152 Ga0068866_10757139 3300005718 Bacteria 671
153 Ga0068861_100001021 3300005719 Bacteria 17112
154 Ga0068861_100055106 3300005719 Bacteria 3031
155 Ga0068861_100182717 3300005719 Bacteria 1747
156 Ga0068861_100202572 3300005719 Bacteria 1667
157 Ga0068861_100305929 3300005719 Bacteria 1379
158 Ga0068861_100936273 3300005719 Bacteria 823
159 Ga0068851_10045297 3300005834 Bacteria 2223
160 Ga0068870_10290714 3300005840 Bacteria 1028
161 Ga0068863_100094380 3300005841 Bacteria 2839
162 Ga0068863_100380576 3300005841 Bacteria 1378
163 Ga0068863_100942608 3300005841 Bacteria 864
164 Ga0068860_100020511 3300005843 Bacteria 6401
165 Ga0068860_100047048 3300005843 Bacteria 4111
166 Ga0068860_100345006 3300005843 Bacteria 1464
167 Ga0068860_100444247 3300005843 Bacteria 1289
168 Ga0068860_101224393 3300005843 Bacteria 771
169 Ga0068860_102502402 3300005843 Bacteria 536
170 Ga0068862_100005272 3300005844 Bacteria 10841
171 Ga0068862_100009388 3300005844 Bacteria 8091
172 Ga0068862_100100047 3300005844 Bacteria 2535
173 Ga0068862_101329047 3300005844 Bacteria 721
174 Ga0081538_10050547 3300005981 Bacteria 2509
175 Ga0081538_10179358 3300005981 Bacteria 909
176 Ga0081539_10072664 3300005985 Bacteria 1837
177 Ga0070717_11538424 3300006028 Unclassified 603
178 Ga0075365_10034505 3300006038 Bacteria 3267
179 Ga0075365_10051807 3300006038 Unclassified 2712
180 Ga0075365_10056071 3300006038 Bacteria 2619
181 Ga0075365_10094007 3300006038 Unclassified 2046
182 Ga0075365_10318842 3300006038 Bacteria 1095
183 Ga0075365_10464707 3300006038 Bacteria 894
184 Ga0075368_10022900 3300006042 Bacteria 2381
185 Ga0075368_10033496 3300006042 Bacteria 1998
186 Ga0075368_10094787 3300006042 Bacteria 1222
187 Ga0075368_10110099 3300006042 Bacteria 1135
188 Ga0075364_10000716 3300006051 Bacteria 17323
189 Ga0075364_10031160 3300006051 Bacteria 3426
190 Ga0075364_10035947 3300006051 Bacteria 3201
191 Ga0075364_10207491 3300006051 Bacteria 1328
192 Ga0075432_10244444 3300006058 Bacteria 726
193 Ga0070716_101206920 3300006173 Unclassified 608
194 Ga0075362_10005563 3300006177 Bacteria 4625
195 Ga0075367_10006867 3300006178 Bacteria 5790
196 Ga0075367_10016394 3300006178 Bacteria 4046
197 Ga0075367_10033051 3300006178 Bacteria 2979
198 Ga0075366_10003514 3300006195 Bacteria 8283
199 Ga0075366_10006558 3300006195 Bacteria 6385
200 Ga0075366_10321783 3300006195 Bacteria 947
201 Ga0097621_100473703 3300006237 Bacteria 1131
202 Ga0097621_101209941 3300006237 Bacteria 712
203 Ga0075370_10009539 3300006353 Bacteria 5045
204 Ga0075370_10021358 3300006353 Bacteria 3546
205 Ga0075370_10790077 3300006353 Bacteria 578
206 Ga0068871_100763965 3300006358 Bacteria 889
207 Ga0075428_100008676 3300006844 Bacteria 11275
208 Ga0075428_100052001 3300006844 Bacteria 4492
209 Ga0075430_100230940 3300006846 Bacteria 1534
210 Ga0075430_100584089 3300006846 Unclassified 922
211 Ga0075431_100120025 3300006847 Bacteria 2713
212 Ga0075431_100205701 3300006847 Bacteria 2013
213 Ga0075431_100378638 3300006847 Unclassified 1420
214 Ga0075431_101882101 3300006847 Unclassified 554
215 Ga0075433_10013130 3300006852 Bacteria 6721
216 Ga0075433_10021975 3300006852 Bacteria 5353
217 Ga0075433_10251709 3300006852 Bacteria 1567
218 Ga0075433_10377984 3300006852 Bacteria 1251
219 Ga0075434_100001560 3300006871 Bacteria 19430
220 Ga0075434_100052542 3300006871 Bacteria 4049
221 Ga0075434_100245755 3300006871 Bacteria 1809
222 Ga0075434_101028548 3300006871 Bacteria 837
223 Ga0075434_101335628 3300006871 Bacteria 727
224 Ga0075434_101463595 3300006871 Bacteria 693
225 Ga0075429_100029640 3300006880 Bacteria 4752
226 Ga0075429_100377162 3300006880 Bacteria 1242
227 Ga0075429_100478824 3300006880 Bacteria 1091
228 Ga0068865_100340549 3300006881 Bacteria 1212
229 Ga0097620_100017952 3300006931 Bacteria 7111
230 Ga0097620_100114434 3300006931 Bacteria 2762
231 Ga0097620_100190989 3300006931 Bacteria 2132
232 Ga0097620_100242350 3300006931 Bacteria 1892
233 Ga0097620_100243760 3300006931 Bacteria 1887
234 Ga0097620_100731941 3300006931 Unclassified 1079
235 Ga0097620_101553791 3300006931 Unclassified 731
236 Ga0075435_100021755 3300007076 Bacteria 4939
237 Ga0075435_100155524 3300007076 Bacteria 1924
238 Ga0075435_100212503 3300007076 Unclassified 1641
239 Ga0075435_100251781 3300007076 Bacteria 1504
240 Ga0075435_102017571 3300007076 Bacteria 506
241 Ga0099794_10056271 3300007265 Unclassified 1903
242 Ga0105251_10183957 3300009011 Bacteria 941
243 Ga0105240_10002413 3300009093 Bacteria 30045
244 Ga0105240_10687802 3300009093 Bacteria 1118
245 Ga0111539_10004161 3300009094 Bacteria 18966
246 Ga0111539_10475102 3300009094 Unclassified 1456
247 Ga0105247_10178512 3300009101 Unclassified 1416
248 Ga0114129_10001045 3300009147 Bacteria 36274
249 Ga0114129_10034448 3300009147 Bacteria 7152
250 Ga0114129_10045009 3300009147 Bacteria 6206
251 Ga0114129_10656463 3300009147 Bacteria 1353
252 Ga0114129_11820123 3300009147 Unclassified 740
253 Ga0105243_10159431 3300009148 Bacteria 1944
254 Ga0105243_10196867 3300009148 Bacteria 1764
255 Ga0105243_10595502 3300009148 Bacteria 1064
256 Ga0105243_11626083 3300009148 Bacteria 673
257 Ga0105241_10068983 3300009174 Bacteria 2741
258 Ga0105242_10354900 3300009176 Bacteria 1355
259 Ga0105248_10013019 3300009177 Bacteria 9169
260 Ga0105248_10078506 3300009177 Bacteria 3711
261 Ga0105248_10142073 3300009177 Bacteria 2708
262 Ga0105248_10867634 3300009177 Bacteria 1019
263 Ga0105248_12622297 3300009177 Bacteria 575
264 Ga0105237_10000002 3300009545 Bacteria 702357
265 Ga0105237_11952644 3300009545 Unclassified 595
266 Ga0105238_10001532 3300009551 Bacteria 23175
267 Ga0105238_10326328 3300009551 Bacteria 1521
268 Ga0105249_10029848 3300009553 Bacteria 4926
269 Ga0105249_10033653 3300009553 Bacteria 4641
270 Ga0105249_10144715 3300009553 Bacteria 2282
271 Ga0105249_10275270 3300009553 Bacteria 1678
272 Ga0105249_10285798 3300009553 Bacteria 1649
273 Ga0105249_10309900 3300009553 Bacteria 1586
274 Ga0105249_10362215 3300009553 Bacteria 1472
275 Ga0105249_10639201 3300009553 Bacteria 1121
276 Ga0105249_11226986 3300009553 Bacteria 821
277 Ga0105030_116120 3300009987 Bacteria 664
278 Ga0105028_101548 3300009993 Bacteria 2417
279 Ga0105239_11184251 3300010375 Bacteria 880
280 Ga0105239_12986691 3300010375 Unclassified 551
281 Ga0105246_10635709 3300011119 Bacteria 927
282 Ga0157373_10013084 3300013100 Bacteria 6089
283 Ga0157370_10796152 3300013104 Bacteria 860
284 Ga0157369_11792160 3300013105 Bacteria 623
285 Ga0163162_10343092 3300013306 Unclassified 1626
286 Ga0157372_10000063 3300013307 Bacteria 119595
287 Ga0157375_11650608 3300013308 Bacteria 758
288 Ga0157375_13149573 3300013308 Bacteria 550
289 Ga0163163_10221216 3300014325 Bacteria 1942
290 Ga0157380_10112988 3300014326 Bacteria 2286
291 Ga0157380_11510442 3300014326 Bacteria 725
292 Ga0157380_13240464 3300014326 Bacteria 520
293 Ga0157377_11127487 3300014745 Bacteria 603
294 Ga0157379_10262895 3300014968 Bacteria 1568
295 Ga0157379_10415400 3300014968 Bacteria 1238
296 Ga0157379_10614016 3300014968 Bacteria 1016
297 Ga0163161_11278990 3300017792 Bacteria 637
298 Ga0207656_10325893 3300025321 Bacteria 763
299 Ga0207653_10008135 3300025885 Bacteria 3268
300 Ga0207653_10052981 3300025885 Bacteria 1354
301 Ga0207682_10030464 3300025893 Bacteria 2161
302 Ga0207688_10249888 3300025901 Bacteria 1074
303 Ga0207680_10102856 3300025903 Bacteria 1839
304 Ga0207647_10081260 3300025904 Bacteria 1942
305 Ga0207643_10031131 3300025908 Bacteria 2973
306 Ga0207643_10042700 3300025908 Bacteria 2557
307 Ga0207684_10029142 3300025910 Bacteria 4702
308 Ga0207684_10128793 3300025910 Bacteria 2172
309 Ga0207684_10371882 3300025910 Bacteria 1230
310 Ga0207684_10675346 3300025910 Bacteria 879
311 Ga0207684_11122078 3300025910 Bacteria 654
312 Ga0207654_10040898 3300025911 Bacteria 2615
313 Ga0207707_10015145 3300025912 Bacteria 6713
314 Ga0207695_10008799 3300025913 Bacteria 12580
315 Ga0207671_10000008 3300025914 Bacteria 798229
316 Ga0207660_10000191 3300025917 Bacteria 38989
317 Ga0207660_10025790 3300025917 Bacteria 3995
318 Ga0207660_10359603 3300025917 Bacteria 1168
319 Ga0207660_11055593 3300025917 Unclassified 662
320 Ga0207662_10027710 3300025918 Bacteria 3271
321 Ga0207662_10091402 3300025918 Bacteria 1873
322 Ga0207657_10000075 3300025919 Bacteria 93163
323 Ga0207649_10068772 3300025920 Bacteria 2253
324 Ga0207652_10007731 3300025921 Bacteria 8636
325 Ga0207652_10261607 3300025921 Bacteria 1561
326 Ga0207652_11643277 3300025921 Bacteria 547
327 Ga0207646_10021999 3300025922 Bacteria 5883
328 Ga0207646_10037432 3300025922 Bacteria 4374
329 Ga0207646_10046805 3300025922 Bacteria 3881
330 Ga0207646_10666687 3300025922 Bacteria 931
331 Ga0207646_10743759 3300025922 Unclassified 875
332 Ga0207646_11388132 3300025922 Bacteria 611
333 Ga0207681_10036136 3300025923 Bacteria 3258
334 Ga0207681_10140503 3300025923 Bacteria 1798
335 Ga0207694_10003799 3300025924 Bacteria 11949
336 Ga0207694_10372138 3300025924 Bacteria 1185
337 Ga0207694_11163789 3300025924 Bacteria 653
338 Ga0207650_10189998 3300025925 Bacteria 1640
339 Ga0207650_10322470 3300025925 Bacteria 1265
340 Ga0207650_11295506 3300025925 Bacteria 620
341 Ga0207644_10105684 3300025931 Bacteria 2121
342 Ga0207706_10003924 3300025933 Bacteria 14114
343 Ga0207706_10639958 3300025933 Bacteria 911
344 Ga0207686_10296825 3300025934 Bacteria 1199
345 Ga0207709_10138584 3300025935 Bacteria 1669
346 Ga0207709_10173133 3300025935 Bacteria 1517
347 Ga0207709_10207944 3300025935 Bacteria 1402
348 Ga0207709_10822470 3300025935 Bacteria 751
349 Ga0207670_10052235 3300025936 Bacteria 2748
350 Ga0207670_10062889 3300025936 Bacteria 2538
351 Ga0207669_10277437 3300025937 Bacteria 1262
352 Ga0207669_10717411 3300025937 Bacteria 823
353 Ga0207691_10033343 3300025940 Bacteria 4794
354 Ga0207691_10539499 3300025940 Bacteria 989
355 Ga0207711_10130353 3300025941 Bacteria 2254
356 Ga0207711_10162024 3300025941 Unclassified 2025
357 Ga0207711_10362913 3300025941 Unclassified 1342
358 Ga0207689_10000765 3300025942 Bacteria 30859
359 Ga0207689_10279771 3300025942 Bacteria 1382
360 Ga0207679_10000932 3300025945 Bacteria 18689
361 Ga0207679_10246225 3300025945 Bacteria 1517
362 Ga0207679_10472815 3300025945 Bacteria 1115
363 Ga0207667_10000005 3300025949 Bacteria 715503
364 Ga0207667_10961263 3300025949 Bacteria 843
365 Ga0207651_10011730 3300025960 Bacteria 4919
366 Ga0207651_10050131 3300025960 Bacteria 2833
367 Ga0207712_10021658 3300025961 Bacteria 4222
368 Ga0207712_10042441 3300025961 Bacteria 3132
369 Ga0207712_10141344 3300025961 Bacteria 1848
370 Ga0207712_10325718 3300025961 Bacteria 1269
371 Ga0207712_11160548 3300025961 Unclassified 688
372 Ga0207640_10537732 3300025981 Bacteria 980
373 Ga0207658_10275931 3300025986 Bacteria 1439
374 Ga0207658_11945325 3300025986 Bacteria 535
375 Ga0207677_10159564 3300026023 Bacteria 1750
376 Ga0207703_11090023 3300026035 Bacteria 767
377 Ga0207639_10021814 3300026041 Bacteria 4604
378 Ga0207678_10002465 3300026067 Bacteria 16817
379 Ga0207678_10119172 3300026067 Bacteria 2252
380 Ga0207678_10288931 3300026067 Bacteria 1408
381 Ga0207708_10399104 3300026075 Bacteria 1137
382 Ga0207708_10548969 3300026075 Bacteria 974
383 Ga0207708_10730731 3300026075 Bacteria 848
384 Ga0207708_11766174 3300026075 Unclassified 543
385 Ga0207702_10058349 3300026078 Bacteria 3284
386 Ga0207641_10252097 3300026088 Bacteria 1649
387 Ga0207641_10317196 3300026088 Bacteria 1477
388 Ga0207641_10847138 3300026088 Bacteria 906
389 Ga0207648_10005013 3300026089 Bacteria 13448
390 Ga0207648_11210891 3300026089 Bacteria 709
391 Ga0207648_11430407 3300026089 Bacteria 650
392 Ga0207648_11614943 3300026089 Bacteria 609
393 Ga0207676_10034286 3300026095 Bacteria 3843
394 Ga0207676_10051354 3300026095 Bacteria 3219
395 Ga0207676_10095008 3300026095 Bacteria 2457
396 Ga0207676_10175752 3300026095 Bacteria 1870
397 Ga0207676_10180681 3300026095 Bacteria 1847
398 Ga0207674_10000630 3300026116 Bacteria 45952
399 Ga0207674_10026641 3300026116 Bacteria 6133
400 Ga0207674_10210604 3300026116 Bacteria 1893
401 Ga0207674_11500050 3300026116 Unclassified 643
402 Ga0207675_100000630 3300026118 Bacteria 34562
403 Ga0207675_100079916 3300026118 Bacteria 3065
404 Ga0207675_100156438 3300026118 Bacteria 2172
405 Ga0207675_100184113 3300026118 Bacteria 2001
406 Ga0207675_100350911 3300026118 Bacteria 1446
407 Ga0207675_100730611 3300026118 Bacteria 1000
408 Ga0207683_10181862 3300026121 Bacteria 1906
409 Ga0207698_10000001 3300026142 Bacteria 625389
410 Ga0207698_10052784 3300026142 Bacteria 3117
411 Ga0207698_11180205 3300026142 Bacteria 779
412 Ga0209813_10016296 3300027866 Bacteria 2027
413 Ga0209813_10036715 3300027866 Bacteria 1473
414 Ga0209813_10167690 3300027866 Bacteria 796
415 Ga0209974_10027709 3300027876 Bacteria 1874
416 Ga0268265_10062644 3300028380 Bacteria 2858
417 Ga0268265_10089200 3300028380 Bacteria 2459
418 Ga0268265_10114627 3300028380 Bacteria 2207
419 Ga0268264_10062224 3300028381 Bacteria 3133
420 Ga0268264_10063187 3300028381 Bacteria 3111
421 Ga0268264_10236387 3300028381 Bacteria 1690
422 Ga0268264_10705844 3300028381 Bacteria 1002
423 Ga0268264_12067293 3300028381 Bacteria 578
424 Ga0316183_1010662 3300030742 Bacteria 1076
425 Ga0307513_10974088 3300031456 Unclassified 557
426 Ga0316577_10238253 3300031733 Bacteria 1029
427 Ga0307410_12051895 3300031852 Bacteria 511
428 Ga0326468_10050442 3300031889 Bacteria 629
429 Ga0307407_10403924 3300031903 Bacteria 981
430 Ga0307409_102114053 3300031995 Bacteria 593
431 Ga0307416_102480629 3300032002 Bacteria 617
432 Ga0373950_0020393 3300034818 Bacteria 1165
433 Ga0373950_0039000 3300034818 Bacteria 904
434 Ga0373951_0013355 3300035091 Bacteria 1847
435 Ga0373952_0176159 3300035092 Bacteria 614
436 Ga0373932_0053187 3300035112 Bacteria 1208
437 Ga0373932_0192183 3300035112 Bacteria 722
438 Ga0373939_0010449 3300035114 Bacteria 2322
439 Ga0373939_0457101 3300035114 Bacteria 538
440 Ga0373956_0409192 3300035119 Bacteria 647
441 Ga0373960_0017516 3300035121 Bacteria 1858
442 Ga0373961_0086455 3300035241 Bacteria 995
443 Ga0373962_0309754 3300035242 Bacteria 562
444 Ga0373931_0025751 3300035691 Bacteria 2988
445 Ga0373937_0955106 3300036401 Bacteria 806
446 Ga0373925_0609485 3300037068 Bacteria 899
447 Ga0395901_0493807 3300038443 Bacteria 1247
448 Ga0451791_0782963 3300041451 Bacteria 811
449 Ga0451793_0840228 3300041452 Bacteria 628
450 Ga0451802_2112260 3300041460 Bacteria 594
451 Ga0451833_0308510 3300041491 Bacteria 586
452 Ga0451853_2607694 3300041512 Bacteria 1198
453 Ga0439448_0073714 3300042005 Bacteria 1139
454 Ga0439455_0006232 3300042012 Bacteria 2466
455 Ga0439456_031792 3300042013 Bacteria 1132
456 Ga0439456_047289 3300042013 Bacteria 938
457 Ga0450892_039088 3300042130 Bacteria 518
458 Ga0439459_0012562 3300042438 Bacteria 1510
459 Ga0439464_0165104 3300042439 Bacteria 697
460 Ga0439464_0192062 3300042439 Bacteria 649
461 Ga0451577_0012441 3300042876 Bacteria 7992
462 Ga0451577_0262520 3300042876 Bacteria 1564
463 Ga0451577_0285290 3300042876 Bacteria 1496
464 Ga0451577_0816135 3300042876 Bacteria 842
465 Ga0453684_0022875 3300044712 Bacteria 9249
466 Ga0453684_0119769 3300044712 Bacteria 3181
467 Ga0453684_1097966 3300044712 Bacteria 840
468 Ga0451576_0006062 3300045051 Bacteria 14919
469 Ga0451576_0121918 3300045051 Bacteria 2715
470 Ga0451576_0300680 3300045051 Bacteria 1678
471 Ga0451576_0326318 3300045051 Bacteria 1606
472 Ga0451576_1044489 3300045051 Bacteria 856
473 Ga0451576_1782830 3300045051 Bacteria 636
474 Ga0495603_0324341 3300046455 Bacteria 884
475 Ga0495638_0001361 3300046460 Bacteria 22420
476 Ga0495638_0008536 3300046460 Bacteria 7254
477 Ga0495580_0009047 3300046472 Bacteria 7857
478 Ga0495669_0097506 3300046684 Unclassified 1363
479 Ga0495581_0881842 3300047315 Bacteria 511
480 Ga0496100_0332500 3300048903 Bacteria 1144
481 Ga0496102_0007253 3300048905 Bacteria 9463
482 Ga0496106_0289919 3300048909 Bacteria 1312
483 Ga0496106_1563402 3300048909 Bacteria 506
484 Ga0496110_0757077 3300048913 Bacteria 875
485 Ga0496112_0616484 3300048915 Bacteria 1016
486 Ga0496115_0000001 3300048918 Bacteria 367230
487 Ga0496125_0265116 3300048928 Bacteria 1074
488 Ga0501040_0176367 3300049576 Bacteria 1514
489 Ga0501042_0392801 3300049578 Bacteria 1005
490 Ga0501046_0088681 3300049580 Bacteria 2382
491 Ga0501048_0840749 3300049582 Bacteria 660
492 Ga0501074_0661244 3300049590 Bacteria 738
493 Ga0501075_1313349 3300049591 Unclassified 548
494 Ga0501079_1030713 3300049741 Bacteria 648
495 Ga0501081_0446115 3300049743 Unclassified 961
496 Ga0501081_0719864 3300049743 Bacteria 750
497 Ga0501081_1262265 3300049743 Bacteria 560
498 Ga0501083_1074976 3300049744 Bacteria 524
499 Ga0501045_0323109 3300049824 Unclassified 1148
500 Ga0501045_0457689 3300049824 Bacteria 948
501 nmdc:mga03683_27546_c1 3300050489 Bacteria 2252
502 nmdc:mga03683_567842_c1 3300050489 Bacteria 553
503 nmdc:mga03n38_164654_c1 3300050490 Bacteria 1125
504 nmdc:mga00v17_18257_c1 3300050491 Bacteria 3981
505 nmdc:mga00v17_34002_c1 3300050491 Bacteria 3025
506 nmdc:mga00v17_35165_c1 3300050491 Bacteria 2980
507 nmdc:mga00v17_4026_c1 3300050491 Bacteria 7593
508 nmdc:mga00v17_5751_c1 3300050491 Bacteria 6550
509 nmdc:mga0yw44_131595_c1 3300050492 Unclassified 1620
510 nmdc:mga0yw44_216530_c1 3300050492 Bacteria 1268
511 nmdc:mga0yw44_41784_c1 3300050492 Bacteria 2731
512 nmdc:mga0yw44_460535_c1 3300050492 Bacteria 862
513 nmdc:mga0yw44_758426_c1 3300050492 Bacteria 659
514 nmdc:mga0k408_154467_c1 3300050493 Bacteria 1367
515 nmdc:mga0k408_159689_c1 3300050493 Bacteria 1343
516 nmdc:mga0k408_23789_c1 3300050493 Bacteria 3460
517 nmdc:mga0k408_270415_c1 3300050493 Bacteria 1015
518 nmdc:mga0k408_9265_c1 3300050493 Bacteria 5305
519 nmdc:mga06z11_245688_c1 3300050494 Bacteria 1052
520 nmdc:mga06z11_256641_c1 3300050494 Bacteria 1031
521 nmdc:mga06z11_4261_c1 3300050494 Bacteria 5614
522 nmdc:mga06z11_49291_c1 3300050494 Bacteria 2148
523 nmdc:mga06z11_56655_c1 3300050494 Bacteria 2028
524 nmdc:mga04h51_157076_c1 3300050495 Bacteria 873
525 nmdc:mga04h51_43814_c1 3300050495 Bacteria 1473
526 nmdc:mga04h51_57803_c1 3300050495 Bacteria 1321
527 nmdc:mga07m45_11933_c1 3300050496 Bacteria 4578
528 nmdc:mga07m45_6979_c1 3300050496 Bacteria 5743
529 nmdc:mga05p37_2168_c1 3300050507 Bacteria 22889
530 nmdc:mga05p37_486070_c1 3300050507 Bacteria 1421
531 nmdc:mga05p37_62712_c1 3300050507 Bacteria 4574
532 nmdc:mga09592_255000_c1 3300050508 Bacteria 1521
533 nmdc:mga09592_272885_c1 3300050508 Bacteria 1467
534 nmdc:mga09592_712189_c1 3300050508 Bacteria 854
535 nmdc:mga0qj67_4458_c1 3300050509 Bacteria 10142
536 nmdc:mga0qj67_847667_c1 3300050509 Unclassified 722
537 nmdc:mga06r32_1080969_c1 3300050510 Bacteria 752
538 nmdc:mga06r32_225819_c1 3300050510 Unclassified 1861
539 nmdc:mga06r32_29267_c1 3300050510 Bacteria 5161
540 nmdc:mga06r32_783530_c1 3300050510 Unclassified 915
541 nmdc:mga08y16_358242_c1 3300050511 Unclassified 1498
542 nmdc:mga08y16_676_c1 3300050511 Bacteria 32217
543 nmdc:mga0n895_21302_c1 3300050512 Bacteria 6058
544 nmdc:mga0n895_61451_c1 3300050512 Bacteria 3709
545 nmdc:mga0rr50_30398_c1 3300050513 Bacteria 3824
546 nmdc:mga0rr50_600840_c1 3300050513 Bacteria 938
547 nmdc:mga0rr50_66837_c1 3300050513 Unclassified 2729
548 nmdc:mga0rr50_91639_c1 3300050513 Unclassified 2368
549 nmdc:mga0a205_352070_c1 3300050515 Bacteria 1340
550 nmdc:mga0a205_49700_c1 3300050515 Bacteria 4049
551 nmdc:mga0a205_59031_c1 3300050515 Bacteria 3706
552 nmdc:mga0a205_741132_c1 3300050515 Bacteria 831
553 nmdc:mga0a205_786937_c1 3300050515 Bacteria 799
554 nmdc:mga0sz30_276270_c1 3300050516 Bacteria 748
555 Ga0500555_000009 3300053103 Bacteria 263998
556 Ga0500556_0103082 3300053104 Bacteria 1100
557 Ga0501084_0025996 3300054114 Bacteria 4883
558 Ga0590071_045347 3300059421 Bacteria 1061
559 Ga0501082_0497814 3300060353 Bacteria 1065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100123755 Ga0070708_1001237553 106
2 3300005563 Ga0068855_100000002 Ga0068855_100000002371 121
3 3300005577 Ga0068857_100009095 Ga0068857_1000090959 121
4 3300005616 Ga0068852_100000001 Ga0068852_100000001373 121
5 3300006038 Ga0075365_10094007 Ga0075365_100940074 121
6 3300009093 Ga0105240_10687802 Ga0105240_106878022 121
7 3300009545 Ga0105237_10000002 Ga0105237_10000002270 121
8 3300009551 Ga0105238_10001532 Ga0105238_1000153211 121
9 3300010375 Ga0105239_12986691 Ga0105239_129866912 121
10 3300025914 Ga0207671_10000008 Ga0207671_10000008372 121
11 3300025924 Ga0207694_10003799 Ga0207694_1000379911 121
12 3300025949 Ga0207667_10000005 Ga0207667_10000005481 121
13 3300026116 Ga0207674_10026641 Ga0207674_100266412 121
14 3300026142 Ga0207698_10000001 Ga0207698_10000001325 121
15 3300048903 Ga0496100_0332500 Ga0496100_0332500_396_764 121
16 3300048928 Ga0496125_0265116 Ga0496125_0265116_335_703 121
17 3300050492 nmdc:mga0yw44_216530_c1 nmdc:mga0yw44_216530_c1_879_1247 121
18 3300053104 Ga0500556_0103082 Ga0500556_0103082_336_704 121
19 3300006844 Ga0075428_100008676 Ga0075428_10000867610 122
20 3300009093 Ga0105240_10002413 Ga0105240_100024135 122
21 3300009176 Ga0105242_10354900 Ga0105242_103549003 122
22 3300009987 Ga0105030_116120 Ga0105030_1161202 122
23 3300009993 Ga0105028_101548 Ga0105028_1015483 122
24 3300025910 Ga0207684_11122078 Ga0207684_111220782 122
25 3300025913 Ga0207695_10008799 Ga0207695_100087995 122
26 3300031456 Ga0307513_10974088 Ga0307513_109740881 122
27 3300042013 Ga0439456_031792 Ga0439456_031792_683_1054 122
28 3300045051 Ga0451576_1044489 Ga0451576_1044489_234_605 122
29 3300053103 Ga0500555_000009 Ga0500555_000009_118815_119186 122
30 3300026088 Ga0207641_10317196 Ga0207641_103171962 123
31 3300031852 Ga0307410_12051895 Ga0307410_120518951 123
32 3300048918 Ga0496115_0000001 Ga0496115_0000001_65728_66102 123
33 3300005467 Ga0070706_100255223 Ga0070706_1002552232 124
34 3300005471 Ga0070698_100043197 Ga0070698_1000431973 124
35 3300006038 Ga0075365_10056071 Ga0075365_100560714 124
36 3300030742 Ga0316183_1010662 Ga0316183_10106622 124
37 3300046460 Ga0495638_0001361 Ga0495638_0001361_15960_16343 124
38 3300035119 Ga0373956_0409192 Ga0373956_0409192_215_592 125
39 3300036401 Ga0373937_0955106 Ga0373937_0955106_392_769 125
40 3300037068 Ga0373925_0609485 Ga0373925_0609485_317_694 125
41 3300042013 Ga0439456_047289 Ga0439456_047289_375_755 125
42 3300042439 Ga0439464_0165104 Ga0439464_0165104_192_572 125
43 3300042439 Ga0439464_0192062 Ga0439464_0192062_211_591 125
44 3300046455 Ga0495603_0324341 Ga0495603_0324341_418_795 125
45 3300047315 Ga0495581_0881842 Ga0495581_0881842_48_425 125
46 3300049578 Ga0501042_0392801 Ga0501042_0392801_456_836 125
47 3300049744 Ga0501083_1074976 Ga0501083_1074976_39_419 125
48 3300005330 Ga0070690_100206809 Ga0070690_1002068091 126
49 3300005331 Ga0070670_100203953 Ga0070670_1002039532 126
50 3300005333 Ga0070677_10123588 Ga0070677_101235882 126
51 3300005336 Ga0070680_100085930 Ga0070680_1000859303 126
52 3300005341 Ga0070691_10092435 Ga0070691_100924353 126
53 3300005343 Ga0070687_100657793 Ga0070687_1006577931 126
54 3300005345 Ga0070692_10202611 Ga0070692_102026112 126
55 3300005345 Ga0070692_10429999 Ga0070692_104299992 126
56 3300005354 Ga0070675_100226825 Ga0070675_1002268252 126
57 3300005355 Ga0070671_100026220 Ga0070671_1000262203 126
58 3300005356 Ga0070674_100565580 Ga0070674_1005655802 126
59 3300005364 Ga0070673_100267348 Ga0070673_1002673482 126
60 3300005367 Ga0070667_100244676 Ga0070667_1002446762 126
61 3300005406 Ga0070703_10048157 Ga0070703_100481573 126
62 3300005440 Ga0070705_100002138 Ga0070705_1000021384 126
63 3300005440 Ga0070705_100011402 Ga0070705_1000114026 126
64 3300005440 Ga0070705_100025632 Ga0070705_1000256322 126
65 3300005441 Ga0070700_100180644 Ga0070700_1001806443 126
66 3300005444 Ga0070694_100120513 Ga0070694_1001205133 126
67 3300005444 Ga0070694_100260256 Ga0070694_1002602563 126
68 3300005445 Ga0070708_100035879 Ga0070708_1000358793 126
69 3300005445 Ga0070708_100305083 Ga0070708_1003050831 126
70 3300005455 Ga0070663_100060002 Ga0070663_1000600022 126
71 3300005455 Ga0070663_100102237 Ga0070663_1001022372 126
72 3300005459 Ga0068867_101430717 Ga0068867_1014307172 126
73 3300005467 Ga0070706_100617294 Ga0070706_1006172942 126
74 3300005468 Ga0070707_100023904 Ga0070707_1000239042 126
75 3300005471 Ga0070698_101547185 Ga0070698_1015471851 126
76 3300005518 Ga0070699_100222511 Ga0070699_1002225112 126
77 3300005536 Ga0070697_100614277 Ga0070697_1006142771 126
78 3300005543 Ga0070672_100703482 Ga0070672_1007034822 126
79 3300005544 Ga0070686_101321382 Ga0070686_1013213821 126
80 3300005545 Ga0070695_100005992 Ga0070695_1000059923 126
81 3300005546 Ga0070696_100021012 Ga0070696_1000210123 126
82 3300005548 Ga0070665_100051283 Ga0070665_1000512832 126
83 3300005548 Ga0070665_100250577 Ga0070665_1002505772 126
84 3300005548 Ga0070665_101801174 Ga0070665_1018011742 126
85 3300005549 Ga0070704_100062074 Ga0070704_1000620743 126
86 3300005549 Ga0070704_100124787 Ga0070704_1001247872 126
87 3300005564 Ga0070664_100030512 Ga0070664_1000305122 126
88 3300005577 Ga0068857_100025547 Ga0068857_1000255471 126
89 3300005577 Ga0068857_100851923 Ga0068857_1008519231 126
90 3300005615 Ga0070702_100154757 Ga0070702_1001547572 126
91 3300005615 Ga0070702_100649862 Ga0070702_1006498622 126
92 3300005618 Ga0068864_100009574 Ga0068864_1000095746 126
93 3300005718 Ga0068866_10757139 Ga0068866_107571391 126
94 3300005719 Ga0068861_100182717 Ga0068861_1001827172 126
95 3300005719 Ga0068861_100936273 Ga0068861_1009362732 126
96 3300005841 Ga0068863_100942608 Ga0068863_1009426081 126
97 3300005843 Ga0068860_101224393 Ga0068860_1012243932 126
98 3300006038 Ga0075365_10318842 Ga0075365_103188422 126
99 3300006042 Ga0075368_10022900 Ga0075368_100229002 126
100 3300006178 Ga0075367_10016394 Ga0075367_100163943 126
101 3300006195 Ga0075366_10003514 Ga0075366_100035147 126
102 3300006237 Ga0097621_101209941 Ga0097621_1012099412 126
103 3300006881 Ga0068865_100340549 Ga0068865_1003405492 126
104 3300009011 Ga0105251_10183957 Ga0105251_101839572 126
105 3300009094 Ga0111539_10475102 Ga0111539_104751022 126
106 3300009148 Ga0105243_10159431 Ga0105243_101594313 126
107 3300009148 Ga0105243_10196867 Ga0105243_101968672 126
108 3300009148 Ga0105243_10595502 Ga0105243_105955022 126
109 3300009177 Ga0105248_10142073 Ga0105248_101420733 126
110 3300009551 Ga0105238_10326328 Ga0105238_103263282 126
111 3300009553 Ga0105249_10144715 Ga0105249_101447153 126
112 3300009553 Ga0105249_11226986 Ga0105249_112269862 126
113 3300011119 Ga0105246_10635709 Ga0105246_106357091 126
114 3300014325 Ga0163163_10221216 Ga0163163_102212162 126
115 3300014326 Ga0157380_11510442 Ga0157380_115104422 126
116 3300014745 Ga0157377_11127487 Ga0157377_111274871 126
117 3300014968 Ga0157379_10415400 Ga0157379_104154002 126
118 3300017792 Ga0163161_11278990 Ga0163161_112789901 126
119 3300025885 Ga0207653_10052981 Ga0207653_100529812 126
120 3300025893 Ga0207682_10030464 Ga0207682_100304642 126
121 3300025908 Ga0207643_10031131 Ga0207643_100311312 126
122 3300025908 Ga0207643_10042700 Ga0207643_100427002 126
123 3300025917 Ga0207660_10025790 Ga0207660_100257901 126
124 3300025918 Ga0207662_10091402 Ga0207662_100914022 126
125 3300025921 Ga0207652_11643277 Ga0207652_116432771 126
126 3300025922 Ga0207646_10021999 Ga0207646_100219994 126
127 3300025924 Ga0207694_10372138 Ga0207694_103721381 126
128 3300025925 Ga0207650_10322470 Ga0207650_103224702 126
129 3300025931 Ga0207644_10105684 Ga0207644_101056842 126
130 3300025934 Ga0207686_10296825 Ga0207686_102968253 126
131 3300025935 Ga0207709_10207944 Ga0207709_102079443 126
132 3300025935 Ga0207709_10822470 Ga0207709_108224701 126
133 3300025937 Ga0207669_10277437 Ga0207669_102774372 126
134 3300025937 Ga0207669_10717411 Ga0207669_107174112 126
135 3300025940 Ga0207691_10033343 Ga0207691_100333432 126
136 3300025940 Ga0207691_10539499 Ga0207691_105394992 126
137 3300025941 Ga0207711_10130353 Ga0207711_101303532 126
138 3300025945 Ga0207679_10246225 Ga0207679_102462252 126
139 3300025945 Ga0207679_10472815 Ga0207679_104728152 126
140 3300025960 Ga0207651_10050131 Ga0207651_100501312 126
141 3300025961 Ga0207712_10325718 Ga0207712_103257183 126
142 3300025961 Ga0207712_11160548 Ga0207712_111605482 126
143 3300025981 Ga0207640_10537732 Ga0207640_105377322 126
144 3300025986 Ga0207658_10275931 Ga0207658_102759311 126
145 3300026067 Ga0207678_10119172 Ga0207678_101191722 126
146 3300026067 Ga0207678_10288931 Ga0207678_102889312 126
147 3300026075 Ga0207708_10399104 Ga0207708_103991042 126
148 3300026075 Ga0207708_10730731 Ga0207708_107307312 126
149 3300026089 Ga0207648_11210891 Ga0207648_112108911 126
150 3300026089 Ga0207648_11430407 Ga0207648_114304072 126
151 3300026095 Ga0207676_10175752 Ga0207676_101757522 126
152 3300026116 Ga0207674_10210604 Ga0207674_102106041 126
153 3300026116 Ga0207674_11500050 Ga0207674_115000501 126
154 3300026118 Ga0207675_100350911 Ga0207675_1003509112 126
155 3300026118 Ga0207675_100730611 Ga0207675_1007306111 126
156 3300026121 Ga0207683_10181862 Ga0207683_101818622 126
157 3300026142 Ga0207698_11180205 Ga0207698_111802052 126
158 3300027866 Ga0209813_10167690 Ga0209813_101676902 126
159 3300031889 Ga0326468_10050442 Ga0326468_100504422 126
160 3300031903 Ga0307407_10403924 Ga0307407_104039242 126
161 3300031995 Ga0307409_102114053 Ga0307409_1021140532 126
162 3300032002 Ga0307416_102480629 Ga0307416_1024806292 126
163 3300041451 Ga0451791_0782963 Ga0451791_0782963_111_494 126
164 3300041452 Ga0451793_0840228 Ga0451793_0840228_178_561 126
165 3300041460 Ga0451802_2112260 Ga0451802_2112260_97_480 126
166 3300041491 Ga0451833_0308510 Ga0451833_0308510_193_576 126
167 3300041512 Ga0451853_2607694 Ga0451853_2607694_629_1012 126
168 3300042130 Ga0450892_039088 Ga0450892_039088_100_483 126
169 3300045051 Ga0451576_1782830 Ga0451576_1782830_89_472 126
170 3300046460 Ga0495638_0008536 Ga0495638_0008536_2061_2441 126
171 3300048909 Ga0496106_1563402 Ga0496106_1563402_57_440 126
172 3300048913 Ga0496110_0757077 Ga0496110_0757077_129_512 126
173 3300050489 nmdc:mga03683_567842_c1 nmdc:mga03683_567842_c1_125_508 126
174 3300050492 nmdc:mga0yw44_758426_c1 nmdc:mga0yw44_758426_c1_209_592 126
175 3300050493 nmdc:mga0k408_159689_c1 nmdc:mga0k408_159689_c1_417_800 126
176 3300050493 nmdc:mga0k408_270415_c1 nmdc:mga0k408_270415_c1_324_707 126
177 3300050494 nmdc:mga06z11_245688_c1 nmdc:mga06z11_245688_c1_624_1004 126
178 3300050494 nmdc:mga06z11_256641_c1 nmdc:mga06z11_256641_c1_463_846 126
179 3300050495 nmdc:mga04h51_157076_c1 nmdc:mga04h51_157076_c1_194_577 126
180 3300050511 nmdc:mga08y16_358242_c1 nmdc:mga08y16_358242_c1_269_649 126
181 3300050516 nmdc:mga0sz30_276270_c1 nmdc:mga0sz30_276270_c1_15_398 126
182 3300005336 Ga0070680_101130324 Ga0070680_1011303241 127
183 3300005367 Ga0070667_101320983 Ga0070667_1013209831 127
184 3300005471 Ga0070698_100619447 Ga0070698_1006194471 127
185 3300005530 Ga0070679_100004203 Ga0070679_10000420315 127
186 3300005617 Ga0068859_100114427 Ga0068859_1001144272 127
187 3300005719 Ga0068861_100055106 Ga0068861_1000551062 127
188 3300005985 Ga0081539_10072664 Ga0081539_100726642 127
189 3300006038 Ga0075365_10034505 Ga0075365_100345052 127
190 3300006038 Ga0075365_10051807 Ga0075365_100518071 127
191 3300006038 Ga0075365_10464707 Ga0075365_104647072 127
192 3300006042 Ga0075368_10033496 Ga0075368_100334963 127
193 3300006042 Ga0075368_10094787 Ga0075368_100947872 127
194 3300006042 Ga0075368_10110099 Ga0075368_101100992 127
195 3300006051 Ga0075364_10000716 Ga0075364_100007164 127
196 3300006051 Ga0075364_10031160 Ga0075364_100311603 127
197 3300006051 Ga0075364_10035947 Ga0075364_100359472 127
198 3300006051 Ga0075364_10207491 Ga0075364_102074911 127
199 3300006177 Ga0075362_10005563 Ga0075362_100055632 127
200 3300006178 Ga0075367_10006867 Ga0075367_100068672 127
201 3300006178 Ga0075367_10033051 Ga0075367_100330515 127
202 3300006195 Ga0075366_10006558 Ga0075366_100065584 127
203 3300006195 Ga0075366_10321783 Ga0075366_103217832 127
204 3300006353 Ga0075370_10009539 Ga0075370_100095392 127
205 3300006353 Ga0075370_10021358 Ga0075370_100213583 127
206 3300006353 Ga0075370_10790077 Ga0075370_107900771 127
207 3300006880 Ga0075429_100377162 Ga0075429_1003771622 127
208 3300006931 Ga0097620_100114434 Ga0097620_1001144342 127
209 3300009147 Ga0114129_10045009 Ga0114129_100450093 127
210 3300009553 Ga0105249_10639201 Ga0105249_106392012 127
211 3300025917 Ga0207660_10359603 Ga0207660_103596032 127
212 3300025921 Ga0207652_10261607 Ga0207652_102616072 127
213 3300025925 Ga0207650_11295506 Ga0207650_112955062 127
214 3300025986 Ga0207658_11945325 Ga0207658_119453252 127
215 3300026118 Ga0207675_100079916 Ga0207675_1000799162 127
216 3300027866 Ga0209813_10016296 Ga0209813_100162962 127
217 3300027866 Ga0209813_10036715 Ga0209813_100367152 127
218 3300049576 Ga0501040_0176367 Ga0501040_0176367_283_669 127
219 3300049580 Ga0501046_0088681 Ga0501046_0088681_693_1079 127
220 3300049582 Ga0501048_0840749 Ga0501048_0840749_206_592 127
221 3300049590 Ga0501074_0661244 Ga0501074_0661244_182_568 127
222 3300049591 Ga0501075_1313349 Ga0501075_1313349_103_489 127
223 3300049741 Ga0501079_1030713 Ga0501079_1030713_63_449 127
224 3300049743 Ga0501081_0446115 Ga0501081_0446115_402_788 127
225 3300049743 Ga0501081_0719864 Ga0501081_0719864_297_683 127
226 3300049743 Ga0501081_1262265 Ga0501081_1262265_132_515 127
227 3300049824 Ga0501045_0323109 Ga0501045_0323109_401_787 127
228 3300049824 Ga0501045_0457689 Ga0501045_0457689_94_480 127
229 3300050489 nmdc:mga03683_27546_c1 nmdc:mga03683_27546_c1_668_1063 127
230 3300050490 nmdc:mga03n38_164654_c1 nmdc:mga03n38_164654_c1_498_893 127
231 3300050491 nmdc:mga00v17_18257_c1 nmdc:mga00v17_18257_c1_1738_2124 127
232 3300050491 nmdc:mga00v17_34002_c1 nmdc:mga00v17_34002_c1_662_1048 127
233 3300050491 nmdc:mga00v17_35165_c1 nmdc:mga00v17_35165_c1_1234_1629 127
234 3300050491 nmdc:mga00v17_4026_c1 nmdc:mga00v17_4026_c1_4568_4963 127
235 3300050491 nmdc:mga00v17_5751_c1 nmdc:mga00v17_5751_c1_4065_4460 127
236 3300050492 nmdc:mga0yw44_131595_c1 nmdc:mga0yw44_131595_c1_1165_1560 127
237 3300050492 nmdc:mga0yw44_41784_c1 nmdc:mga0yw44_41784_c1_1958_2353 127
238 3300050492 nmdc:mga0yw44_460535_c1 nmdc:mga0yw44_460535_c1_258_644 127
239 3300050493 nmdc:mga0k408_154467_c1 nmdc:mga0k408_154467_c1_588_983 127
240 3300050493 nmdc:mga0k408_23789_c1 nmdc:mga0k408_23789_c1_2617_3003 127
241 3300050493 nmdc:mga0k408_9265_c1 nmdc:mga0k408_9265_c1_2025_2420 127
242 3300050494 nmdc:mga06z11_4261_c1 nmdc:mga06z11_4261_c1_3791_4186 127
243 3300050494 nmdc:mga06z11_49291_c1 nmdc:mga06z11_49291_c1_569_955 127
244 3300050494 nmdc:mga06z11_56655_c1 nmdc:mga06z11_56655_c1_1613_2008 127
245 3300050495 nmdc:mga04h51_43814_c1 nmdc:mga04h51_43814_c1_613_1008 127
246 3300050495 nmdc:mga04h51_57803_c1 nmdc:mga04h51_57803_c1_167_562 127
247 3300050496 nmdc:mga07m45_11933_c1 nmdc:mga07m45_11933_c1_3196_3591 127
248 3300050496 nmdc:mga07m45_6979_c1 nmdc:mga07m45_6979_c1_2443_2829 127
249 3300050507 nmdc:mga05p37_62712_c1 nmdc:mga05p37_62712_c1_2629_3024 127
250 3300050508 nmdc:mga09592_272885_c1 nmdc:mga09592_272885_c1_318_713 127
251 3300059421 Ga0590071_045347 Ga0590071_045347_335_718 127
252 3300005290 Ga0065712_10131026 Ga0065712_101310261 128
253 3300005293 Ga0065715_10200651 Ga0065715_102006512 128
254 3300005295 Ga0065707_10095295 Ga0065707_100952952 128
255 3300005328 Ga0070676_10004994 Ga0070676_100049942 128
256 3300005330 Ga0070690_100287112 Ga0070690_1002871123 128
257 3300005331 Ga0070670_100016475 Ga0070670_1000164753 128
258 3300005334 Ga0068869_100012194 Ga0068869_1000121943 128
259 3300005334 Ga0068869_100993356 Ga0068869_1009933561 128
260 3300005334 Ga0068869_101050600 Ga0068869_1010506001 128
261 3300005335 Ga0070666_11287886 Ga0070666_112878861 128
262 3300005336 Ga0070680_100057339 Ga0070680_1000573392 128
263 3300005337 Ga0070682_100000209 Ga0070682_10000020943 128
264 3300005338 Ga0068868_100188185 Ga0068868_1001881853 128
265 3300005339 Ga0070660_100000889 Ga0070660_1000008896 128
266 3300005340 Ga0070689_100040262 Ga0070689_1000402622 128
267 3300005340 Ga0070689_100286529 Ga0070689_1002865291 128
268 3300005341 Ga0070691_10709998 Ga0070691_107099981 128
269 3300005343 Ga0070687_100025254 Ga0070687_1000252543 128
270 3300005343 Ga0070687_100293384 Ga0070687_1002933842 128
271 3300005343 Ga0070687_101037994 Ga0070687_1010379941 128
272 3300005344 Ga0070661_100099572 Ga0070661_1000995722 128
273 3300005345 Ga0070692_10002653 Ga0070692_1000265310 128
274 3300005347 Ga0070668_102167651 Ga0070668_1021676511 128
275 3300005353 Ga0070669_100021355 Ga0070669_1000213551 128
276 3300005353 Ga0070669_100148512 Ga0070669_1001485123 128
277 3300005353 Ga0070669_100158895 Ga0070669_1001588952 128
278 3300005355 Ga0070671_100200890 Ga0070671_1002008902 128
279 3300005364 Ga0070673_100146487 Ga0070673_1001464872 128
280 3300005365 Ga0070688_100329446 Ga0070688_1003294462 128
281 3300005366 Ga0070659_100081193 Ga0070659_1000811932 128
282 3300005406 Ga0070703_10011031 Ga0070703_100110314 128
283 3300005438 Ga0070701_10199906 Ga0070701_101999062 128
284 3300005440 Ga0070705_100092807 Ga0070705_1000928075 128
285 3300005441 Ga0070700_100357991 Ga0070700_1003579912 128
286 3300005441 Ga0070700_101193630 Ga0070700_1011936301 128
287 3300005444 Ga0070694_100035346 Ga0070694_1000353464 128
288 3300005444 Ga0070694_100094820 Ga0070694_1000948202 128
289 3300005444 Ga0070694_100209059 Ga0070694_1002090592 128
290 3300005444 Ga0070694_100227937 Ga0070694_1002279373 128
291 3300005445 Ga0070708_100280173 Ga0070708_1002801732 128
292 3300005445 Ga0070708_100389728 Ga0070708_1003897281 128
293 3300005455 Ga0070663_100133778 Ga0070663_1001337783 128
294 3300005457 Ga0070662_100001887 Ga0070662_1000018879 128
295 3300005458 Ga0070681_10040550 Ga0070681_100405503 128
296 3300005459 Ga0068867_100008628 Ga0068867_1000086285 128
297 3300005466 Ga0070685_10454361 Ga0070685_104543611 128
298 3300005467 Ga0070706_100013629 Ga0070706_1000136292 128
299 3300005467 Ga0070706_100053816 Ga0070706_1000538164 128
300 3300005467 Ga0070706_100501723 Ga0070706_1005017231 128
301 3300005467 Ga0070706_101350701 Ga0070706_1013507011 128
302 3300005468 Ga0070707_100047594 Ga0070707_1000475944 128
303 3300005468 Ga0070707_100059927 Ga0070707_1000599272 128
304 3300005468 Ga0070707_100384178 Ga0070707_1003841782 128
305 3300005468 Ga0070707_100437103 Ga0070707_1004371031 128
306 3300005471 Ga0070698_101114574 Ga0070698_1011145742 128
307 3300005518 Ga0070699_100050293 Ga0070699_1000502934 128
308 3300005518 Ga0070699_100421370 Ga0070699_1004213703 128
309 3300005518 Ga0070699_101752322 Ga0070699_1017523221 128
310 3300005530 Ga0070679_100085634 Ga0070679_1000856343 128
311 3300005536 Ga0070697_100398636 Ga0070697_1003986362 128
312 3300005536 Ga0070697_100497201 Ga0070697_1004972012 128
313 3300005536 Ga0070697_101593930 Ga0070697_1015939301 128
314 3300005539 Ga0068853_100000779 Ga0068853_10000077919 128
315 3300005544 Ga0070686_100065099 Ga0070686_1000650992 128
316 3300005544 Ga0070686_100255128 Ga0070686_1002551282 128
317 3300005544 Ga0070686_100486083 Ga0070686_1004860832 128
318 3300005545 Ga0070695_100027123 Ga0070695_1000271236 128
319 3300005545 Ga0070695_100359264 Ga0070695_1003592642 128
320 3300005545 Ga0070695_101599704 Ga0070695_1015997041 128
321 3300005546 Ga0070696_100098996 Ga0070696_1000989962 128
322 3300005546 Ga0070696_100262259 Ga0070696_1002622592 128
323 3300005546 Ga0070696_100282831 Ga0070696_1002828312 128
324 3300005546 Ga0070696_101062794 Ga0070696_1010627942 128
325 3300005547 Ga0070693_100009061 Ga0070693_1000090612 128
326 3300005549 Ga0070704_100000295 Ga0070704_1000002954 128
327 3300005549 Ga0070704_100019748 Ga0070704_1000197485 128
328 3300005549 Ga0070704_100034310 Ga0070704_1000343102 128
329 3300005549 Ga0070704_100225909 Ga0070704_1002259092 128
330 3300005563 Ga0068855_100043065 Ga0068855_1000430655 128
331 3300005564 Ga0070664_100022654 Ga0070664_1000226546 128
332 3300005577 Ga0068857_100136677 Ga0068857_1001366774 128
333 3300005577 Ga0068857_100953571 Ga0068857_1009535712 128
334 3300005578 Ga0068854_100010618 Ga0068854_1000106187 128
335 3300005614 Ga0068856_100000353 Ga0068856_10000035330 128
336 3300005615 Ga0070702_100688644 Ga0070702_1006886442 128
337 3300005616 Ga0068852_100192609 Ga0068852_1001926092 128
338 3300005617 Ga0068859_100017951 Ga0068859_1000179515 128
339 3300005617 Ga0068859_100190985 Ga0068859_1001909853 128
340 3300005617 Ga0068859_100242326 Ga0068859_1002423262 128
341 3300005617 Ga0068859_100243780 Ga0068859_1002437802 128
342 3300005617 Ga0068859_100731954 Ga0068859_1007319543 128
343 3300005617 Ga0068859_101553907 Ga0068859_1015539072 128
344 3300005618 Ga0068864_100078861 Ga0068864_1000788612 128
345 3300005618 Ga0068864_100167270 Ga0068864_1001672703 128
346 3300005618 Ga0068864_100320052 Ga0068864_1003200522 128
347 3300005719 Ga0068861_100001021 Ga0068861_10000102113 128
348 3300005719 Ga0068861_100202572 Ga0068861_1002025722 128
349 3300005719 Ga0068861_100305929 Ga0068861_1003059292 128
350 3300005834 Ga0068851_10045297 Ga0068851_100452972 128
351 3300005840 Ga0068870_10290714 Ga0068870_102907142 128
352 3300005841 Ga0068863_100094380 Ga0068863_1000943804 128
353 3300005841 Ga0068863_100380576 Ga0068863_1003805762 128
354 3300005843 Ga0068860_100020511 Ga0068860_1000205119 128
355 3300005843 Ga0068860_100047048 Ga0068860_1000470482 128
356 3300005843 Ga0068860_100345006 Ga0068860_1003450062 128
357 3300005843 Ga0068860_100444247 Ga0068860_1004442472 128
358 3300005843 Ga0068860_102502402 Ga0068860_1025024021 128
359 3300005844 Ga0068862_100005272 Ga0068862_1000052726 128
360 3300005844 Ga0068862_100009388 Ga0068862_1000093888 128
361 3300005844 Ga0068862_100100047 Ga0068862_1001000472 128
362 3300005844 Ga0068862_101329047 Ga0068862_1013290471 128
363 3300005981 Ga0081538_10050547 Ga0081538_100505473 128
364 3300005981 Ga0081538_10179358 Ga0081538_101793582 128
365 3300006028 Ga0070717_11538424 Ga0070717_115384241 128
366 3300006058 Ga0075432_10244444 Ga0075432_102444442 128
367 3300006173 Ga0070716_101206920 Ga0070716_1012069202 128
368 3300006237 Ga0097621_100473703 Ga0097621_1004737032 128
369 3300006358 Ga0068871_100763965 Ga0068871_1007639652 128
370 3300006844 Ga0075428_100052001 Ga0075428_1000520013 128
371 3300006846 Ga0075430_100230940 Ga0075430_1002309402 128
372 3300006846 Ga0075430_100584089 Ga0075430_1005840892 128
373 3300006847 Ga0075431_100120025 Ga0075431_1001200252 128
374 3300006847 Ga0075431_100205701 Ga0075431_1002057012 128
375 3300006847 Ga0075431_100378638 Ga0075431_1003786383 128
376 3300006847 Ga0075431_101882101 Ga0075431_1018821012 128
377 3300006852 Ga0075433_10013130 Ga0075433_100131305 128
378 3300006852 Ga0075433_10021975 Ga0075433_100219753 128
379 3300006852 Ga0075433_10251709 Ga0075433_102517092 128
380 3300006852 Ga0075433_10377984 Ga0075433_103779842 128
381 3300006871 Ga0075434_100001560 Ga0075434_1000015601 128
382 3300006871 Ga0075434_100052542 Ga0075434_1000525423 128
383 3300006871 Ga0075434_100245755 Ga0075434_1002457552 128
384 3300006871 Ga0075434_101028548 Ga0075434_1010285482 128
385 3300006871 Ga0075434_101335628 Ga0075434_1013356282 128
386 3300006871 Ga0075434_101463595 Ga0075434_1014635952 128
387 3300006880 Ga0075429_100029640 Ga0075429_1000296402 128
388 3300006880 Ga0075429_100478824 Ga0075429_1004788242 128
389 3300006931 Ga0097620_100017952 Ga0097620_1000179525 128
390 3300006931 Ga0097620_100190989 Ga0097620_1001909892 128
391 3300006931 Ga0097620_100242350 Ga0097620_1002423502 128
392 3300006931 Ga0097620_100243760 Ga0097620_1002437602 128
393 3300006931 Ga0097620_100731941 Ga0097620_1007319413 128
394 3300006931 Ga0097620_101553791 Ga0097620_1015537912 128
395 3300007076 Ga0075435_100021755 Ga0075435_1000217553 128
396 3300007076 Ga0075435_100155524 Ga0075435_1001555243 128
397 3300007076 Ga0075435_100212503 Ga0075435_1002125032 128
398 3300007076 Ga0075435_100251781 Ga0075435_1002517812 128
399 3300007076 Ga0075435_102017571 Ga0075435_1020175711 128
400 3300007265 Ga0099794_10056271 Ga0099794_100562713 128
401 3300009094 Ga0111539_10004161 Ga0111539_100041618 128
402 3300009101 Ga0105247_10178512 Ga0105247_101785122 128
403 3300009147 Ga0114129_10001045 Ga0114129_1000104513 128
404 3300009147 Ga0114129_10034448 Ga0114129_100344484 128
405 3300009147 Ga0114129_10656463 Ga0114129_106564632 128
406 3300009147 Ga0114129_11820123 Ga0114129_118201232 128
407 3300009148 Ga0105243_11626083 Ga0105243_116260832 128
408 3300009174 Ga0105241_10068983 Ga0105241_100689832 128
409 3300009177 Ga0105248_10013019 Ga0105248_100130196 128
410 3300009177 Ga0105248_10078506 Ga0105248_100785066 128
411 3300009177 Ga0105248_10867634 Ga0105248_108676342 128
412 3300009177 Ga0105248_12622297 Ga0105248_126222971 128
413 3300009545 Ga0105237_11952644 Ga0105237_119526441 128
414 3300009553 Ga0105249_10029848 Ga0105249_100298482 128
415 3300009553 Ga0105249_10033653 Ga0105249_100336534 128
416 3300009553 Ga0105249_10275270 Ga0105249_102752703 128
417 3300009553 Ga0105249_10285798 Ga0105249_102857982 128
418 3300009553 Ga0105249_10309900 Ga0105249_103099002 128
419 3300009553 Ga0105249_10362215 Ga0105249_103622152 128
420 3300010375 Ga0105239_11184251 Ga0105239_111842512 128
421 3300013100 Ga0157373_10013084 Ga0157373_100130844 128
422 3300013104 Ga0157370_10796152 Ga0157370_107961522 128
423 3300013105 Ga0157369_11792160 Ga0157369_117921601 128
424 3300013306 Ga0163162_10343092 Ga0163162_103430922 128
425 3300013307 Ga0157372_10000063 Ga0157372_1000006354 128
426 3300013308 Ga0157375_11650608 Ga0157375_116506082 128
427 3300013308 Ga0157375_13149573 Ga0157375_131495731 128
428 3300014326 Ga0157380_10112988 Ga0157380_101129883 128
429 3300014326 Ga0157380_13240464 Ga0157380_132404641 128
430 3300014968 Ga0157379_10262895 Ga0157379_102628953 128
431 3300014968 Ga0157379_10614016 Ga0157379_106140162 128
432 3300025321 Ga0207656_10325893 Ga0207656_103258931 128
433 3300025885 Ga0207653_10008135 Ga0207653_100081353 128
434 3300025901 Ga0207688_10249888 Ga0207688_102498881 128
435 3300025903 Ga0207680_10102856 Ga0207680_101028562 128
436 3300025904 Ga0207647_10081260 Ga0207647_100812602 128
437 3300025910 Ga0207684_10029142 Ga0207684_100291423 128
438 3300025910 Ga0207684_10128793 Ga0207684_101287932 128
439 3300025910 Ga0207684_10371882 Ga0207684_103718822 128
440 3300025910 Ga0207684_10675346 Ga0207684_106753462 128
441 3300025911 Ga0207654_10040898 Ga0207654_100408982 128
442 3300025912 Ga0207707_10015145 Ga0207707_100151454 128
443 3300025917 Ga0207660_10000191 Ga0207660_100001912 128
444 3300025917 Ga0207660_11055593 Ga0207660_110555931 128
445 3300025918 Ga0207662_10027710 Ga0207662_100277103 128
446 3300025919 Ga0207657_10000075 Ga0207657_1000007554 128
447 3300025920 Ga0207649_10068772 Ga0207649_100687724 128
448 3300025921 Ga0207652_10007731 Ga0207652_100077312 128
449 3300025922 Ga0207646_10037432 Ga0207646_100374324 128
450 3300025922 Ga0207646_10046805 Ga0207646_100468053 128
451 3300025922 Ga0207646_10666687 Ga0207646_106666871 128
452 3300025922 Ga0207646_10743759 Ga0207646_107437592 128
453 3300025922 Ga0207646_11388132 Ga0207646_113881321 128
454 3300025923 Ga0207681_10036136 Ga0207681_100361362 128
455 3300025923 Ga0207681_10140503 Ga0207681_101405033 128
456 3300025924 Ga0207694_11163789 Ga0207694_111637891 128
457 3300025925 Ga0207650_10189998 Ga0207650_101899982 128
458 3300025933 Ga0207706_10003924 Ga0207706_1000392410 128
459 3300025933 Ga0207706_10639958 Ga0207706_106399582 128
460 3300025935 Ga0207709_10138584 Ga0207709_101385842 128
461 3300025935 Ga0207709_10173133 Ga0207709_101731332 128
462 3300025936 Ga0207670_10052235 Ga0207670_100522352 128
463 3300025936 Ga0207670_10062889 Ga0207670_100628892 128
464 3300025941 Ga0207711_10162024 Ga0207711_101620242 128
465 3300025941 Ga0207711_10362913 Ga0207711_103629132 128
466 3300025942 Ga0207689_10000765 Ga0207689_1000076520 128
467 3300025942 Ga0207689_10279771 Ga0207689_102797712 128
468 3300025945 Ga0207679_10000932 Ga0207679_1000093216 128
469 3300025949 Ga0207667_10961263 Ga0207667_109612631 128
470 3300025960 Ga0207651_10011730 Ga0207651_100117305 128
471 3300025961 Ga0207712_10021658 Ga0207712_100216582 128
472 3300025961 Ga0207712_10042441 Ga0207712_100424413 128
473 3300025961 Ga0207712_10141344 Ga0207712_101413442 128
474 3300026023 Ga0207677_10159564 Ga0207677_101595643 128
475 3300026035 Ga0207703_11090023 Ga0207703_110900231 128
476 3300026041 Ga0207639_10021814 Ga0207639_100218146 128
477 3300026067 Ga0207678_10002465 Ga0207678_100024655 128
478 3300026075 Ga0207708_10548969 Ga0207708_105489692 128
479 3300026075 Ga0207708_11766174 Ga0207708_117661741 128
480 3300026078 Ga0207702_10058349 Ga0207702_100583495 128
481 3300026088 Ga0207641_10252097 Ga0207641_102520972 128
482 3300026088 Ga0207641_10847138 Ga0207641_108471381 128
483 3300026089 Ga0207648_10005013 Ga0207648_1000501314 128
484 3300026089 Ga0207648_11614943 Ga0207648_116149431 128
485 3300026095 Ga0207676_10034286 Ga0207676_100342864 128
486 3300026095 Ga0207676_10051354 Ga0207676_100513543 128
487 3300026095 Ga0207676_10095008 Ga0207676_100950082 128
488 3300026095 Ga0207676_10180681 Ga0207676_101806812 128
489 3300026116 Ga0207674_10000630 Ga0207674_1000063052 128
490 3300026118 Ga0207675_100000630 Ga0207675_10000063026 128
491 3300026118 Ga0207675_100156438 Ga0207675_1001564383 128
492 3300026118 Ga0207675_100184113 Ga0207675_1001841132 128
493 3300026142 Ga0207698_10052784 Ga0207698_100527845 128
494 3300027876 Ga0209974_10027709 Ga0209974_100277092 128
495 3300028380 Ga0268265_10062644 Ga0268265_100626442 128
496 3300028380 Ga0268265_10089200 Ga0268265_100892003 128
497 3300028380 Ga0268265_10114627 Ga0268265_101146272 128
498 3300028381 Ga0268264_10062224 Ga0268264_100622242 128
499 3300028381 Ga0268264_10063187 Ga0268264_100631873 128
500 3300028381 Ga0268264_10236387 Ga0268264_102363872 128
501 3300028381 Ga0268264_10705844 Ga0268264_107058442 128
502 3300028381 Ga0268264_12067293 Ga0268264_120672931 128
503 3300031733 Ga0316577_10238253 Ga0316577_102382532 128
504 3300034818 Ga0373950_0020393 Ga0373950_0020393_96_482 128
505 3300034818 Ga0373950_0039000 Ga0373950_0039000_207_596 128
506 3300035091 Ga0373951_0013355 Ga0373951_0013355_681_1067 128
507 3300035092 Ga0373952_0176159 Ga0373952_0176159_74_463 128
508 3300035112 Ga0373932_0053187 Ga0373932_0053187_163_552 128
509 3300035112 Ga0373932_0192183 Ga0373932_0192183_113_502 128
510 3300035114 Ga0373939_0010449 Ga0373939_0010449_1833_2222 128
511 3300035114 Ga0373939_0457101 Ga0373939_0457101_24_413 128
512 3300035121 Ga0373960_0017516 Ga0373960_0017516_1098_1484 128
513 3300035241 Ga0373961_0086455 Ga0373961_0086455_332_721 128
514 3300035242 Ga0373962_0309754 Ga0373962_0309754_17_406 128
515 3300035691 Ga0373931_0025751 Ga0373931_0025751_486_875 128
516 3300038443 Ga0395901_0493807 Ga0395901_0493807_729_1121 128
517 3300042005 Ga0439448_0073714 Ga0439448_0073714_701_1087 128
518 3300042012 Ga0439455_0006232 Ga0439455_0006232_158_544 128
519 3300042438 Ga0439459_0012562 Ga0439459_0012562_1005_1391 128
520 3300042876 Ga0451577_0012441 Ga0451577_0012441_4763_5149 128
521 3300042876 Ga0451577_0262520 Ga0451577_0262520_980_1369 128
522 3300042876 Ga0451577_0285290 Ga0451577_0285290_509_898 128
523 3300042876 Ga0451577_0816135 Ga0451577_0816135_73_462 128
524 3300044712 Ga0453684_0022875 Ga0453684_0022875_3067_3459 128
525 3300044712 Ga0453684_0119769 Ga0453684_0119769_1691_2080 128
526 3300044712 Ga0453684_1097966 Ga0453684_1097966_110_496 128
527 3300045051 Ga0451576_0006062 Ga0451576_0006062_4268_4654 128
528 3300045051 Ga0451576_0121918 Ga0451576_0121918_600_989 128
529 3300045051 Ga0451576_0300680 Ga0451576_0300680_1117_1506 128
530 3300045051 Ga0451576_0326318 Ga0451576_0326318_1147_1536 128
531 3300046472 Ga0495580_0009047 Ga0495580_0009047_4266_4655 128
532 3300046684 Ga0495669_0097506 Ga0495669_0097506_725_1114 128
533 3300048905 Ga0496102_0007253 Ga0496102_0007253_8827_9213 128
534 3300048909 Ga0496106_0289919 Ga0496106_0289919_33_419 128
535 3300048915 Ga0496112_0616484 Ga0496112_0616484_206_592 128
536 3300050507 nmdc:mga05p37_2168_c1 nmdc:mga05p37_2168_c1_18379_18768 128
537 3300050507 nmdc:mga05p37_486070_c1 nmdc:mga05p37_486070_c1_888_1277 128
538 3300050508 nmdc:mga09592_255000_c1 nmdc:mga09592_255000_c1_627_1016 128
539 3300050508 nmdc:mga09592_712189_c1 nmdc:mga09592_712189_c1_188_574 128
540 3300050509 nmdc:mga0qj67_4458_c1 nmdc:mga0qj67_4458_c1_5632_6021 128
541 3300050509 nmdc:mga0qj67_847667_c1 nmdc:mga0qj67_847667_c1_56_445 128
542 3300050510 nmdc:mga06r32_1080969_c1 nmdc:mga06r32_1080969_c1_155_541 128
543 3300050510 nmdc:mga06r32_225819_c1 nmdc:mga06r32_225819_c1_165_554 128
544 3300050510 nmdc:mga06r32_29267_c1 nmdc:mga06r32_29267_c1_4431_4820 128
545 3300050510 nmdc:mga06r32_783530_c1 nmdc:mga06r32_783530_c1_424_816 128
546 3300050511 nmdc:mga08y16_676_c1 nmdc:mga08y16_676_c1_156_545 128
547 3300050512 nmdc:mga0n895_21302_c1 nmdc:mga0n895_21302_c1_108_497 128
548 3300050512 nmdc:mga0n895_61451_c1 nmdc:mga0n895_61451_c1_811_1200 128
549 3300050513 nmdc:mga0rr50_30398_c1 nmdc:mga0rr50_30398_c1_1039_1428 128
550 3300050513 nmdc:mga0rr50_600840_c1 nmdc:mga0rr50_600840_c1_163_549 128
551 3300050513 nmdc:mga0rr50_66837_c1 nmdc:mga0rr50_66837_c1_212_601 128
552 3300050513 nmdc:mga0rr50_91639_c1 nmdc:mga0rr50_91639_c1_1849_2238 128
553 3300050515 nmdc:mga0a205_352070_c1 nmdc:mga0a205_352070_c1_286_672 128
554 3300050515 nmdc:mga0a205_49700_c1 nmdc:mga0a205_49700_c1_1356_1745 128
555 3300050515 nmdc:mga0a205_59031_c1 nmdc:mga0a205_59031_c1_810_1199 128
556 3300050515 nmdc:mga0a205_741132_c1 nmdc:mga0a205_741132_c1_263_652 128
557 3300050515 nmdc:mga0a205_786937_c1 nmdc:mga0a205_786937_c1_267_710 128
558 3300054114 Ga0501084_0025996 Ga0501084_0025996_221_628 128
559 3300060353 Ga0501082_0497814 Ga0501082_0497814_362_769 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

121

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9728 6 124
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9692 5 127
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9648 7 126
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9643 7 126
6rfv-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 ph 7 0.9615 6 124
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9777 7 86 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9693 7 86 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9684 5 86 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9676 7 90 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9674 5 86 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V0TZH8-F1-model_v4 Response regulator 0.9927 5 125 GO:0000160
AF-A0A2A4Y761-F1-model_v4 Response regulator 0.9878 5 123 GO:0000160
AF-A0A535M726-F1-model_v4 Response regulator 0.9875 5 125 GO:0000160
AF-A0A7V4MJN4-F1-model_v4 Response regulator 0.9875 5 126 GO:0000160
AF-A0A1Q7H0J7-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9871 4 126 GO:0000155
GO:0005886
GO:0009927

Feature Viewer

pLDDT pTM Quality
93.04 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map