F463545

General Info

Members Datasets Scaffolds Average Seq Length
559 304 1118 124

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100784894|Ga0068863_1007848942
Length 141
Sequence MSDDRIAGPSRPSMASEALGLLPGEFTAFRQRMNERILAEDNQVVRRFFALDTQTYKDGALDVKTKEMLGLVASLVLRCDDCISYHVAQCKDAGVKRDEFFEVFSVGLVVGGSIVIPHLRRAVDFLDKVEGGGETASEAKL

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
177 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
178 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
179 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
180 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
181 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
182 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
183 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
184 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
189 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
190 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
191 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
249 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
281 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
282 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
285 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
286 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
287 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
292 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
293 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
294 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
295 2734482264 Dyella sp. AD052 Isolate Unclassified
296 2738543009 Luteibacter sp. OK325 Isolate Unclassified
297 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
298 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
299 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
300 2919085039 Luteibacter sp. 1214 Isolate Unclassified
301 2919404418 Luteibacter sp. 3190 Isolate Unclassified
302 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
303 2941471342 Luteibacter sp. 621 Isolate Unclassified
304 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0.72
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 0
Rhizoplane 2.15
Rhizosphere 82.65
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100784894 3300005841 Bacteria 949
2 JGI24740J21852_10174049 3300001979 Bacteria 534
3 JGI24738J21930_10059907 3300002075 Bacteria 781
4 JGI24744J21845_10015342 3300002077 Bacteria 1531
5 JGI25156J39149_1011621 3300002705 Bacteria 1981
6 JGI25164J39214_1001086 3300002772 Bacteria 7901
7 JGI25165J46597_1004623 3300003214 Bacteria 2889
8 Ga0006562J51391_1073321 3300003578 Bacteria 6500
9 Ga0006562J51391_1073322 3300003578 Bacteria 5760
10 Ga0055539_1001755 3300003752 Bacteria 3759
11 Ga0055533_1013385 3300003756 Bacteria 845
12 Ga0055527_1000082 3300003760 Bacteria 75048
13 Ga0055535_1000143 3300003761 Bacteria 75049
14 Ga0055542_1000190 3300003762 Bacteria 75049
15 Ga0055529_1000217 3300003763 Bacteria 75049
16 Ga0065165_1000028 3300005262 Bacteria 224430
17 Ga0065707_10916251 3300005295 Bacteria 562
18 Ga0070658_10001446 3300005327 Bacteria 20260
19 Ga0070658_10260004 3300005327 Bacteria 1474
20 Ga0070683_100465561 3300005329 Bacteria 1207
21 Ga0070690_101468300 3300005330 Bacteria 550
22 Ga0070666_10000007 3300005335 Bacteria 293732
23 Ga0070666_10008334 3300005335 Bacteria 6429
24 Ga0070680_100348622 3300005336 Bacteria 1259
25 Ga0070682_100092289 3300005337 Bacteria 1983
26 Ga0070682_100750858 3300005337 Bacteria 788
27 Ga0070660_100104837 3300005339 Bacteria 2243
28 Ga0070660_100297180 3300005339 Bacteria 1323
29 Ga0070661_100046195 3300005344 Bacteria 3185
30 Ga0070661_100232873 3300005344 Bacteria 1416
31 Ga0070661_100394503 3300005344 Bacteria 1093
32 Ga0070668_100431163 3300005347 Bacteria 1130
33 Ga0070675_100595125 3300005354 Bacteria 1003
34 Ga0070671_100817703 3300005355 Bacteria 812
35 Ga0070674_100170543 3300005356 Bacteria 1659
36 Ga0070659_100021966 3300005366 Bacteria 4868
37 Ga0070659_100141151 3300005366 Bacteria 1961
38 Ga0070659_100331704 3300005366 Bacteria 1273
39 Ga0070667_100087948 3300005367 Bacteria 2667
40 Ga0070667_100221091 3300005367 Bacteria 1686
41 Ga0070714_100007668 3300005435 Bacteria 8404
42 Ga0070713_100248395 3300005436 Bacteria 1622
43 Ga0070711_100615740 3300005439 Bacteria 907
44 Ga0070663_100057755 3300005455 Bacteria 2785
45 Ga0070663_100069357 3300005455 Bacteria 2561
46 Ga0070663_100152507 3300005455 Bacteria 1773
47 Ga0070678_101235400 3300005456 Bacteria 694
48 Ga0070662_100074458 3300005457 Bacteria 2512
49 Ga0070662_100707460 3300005457 Bacteria 852
50 Ga0070681_10003594 3300005458 Bacteria 14536
51 Ga0070681_10142129 3300005458 Bacteria 2329
52 Ga0070681_10202353 3300005458 Bacteria 1904
53 Ga0070699_100824449 3300005518 Bacteria 849
54 Ga0070679_100446724 3300005530 Bacteria 1238
55 Ga0070684_100458044 3300005535 Bacteria 1179
56 Ga0068853_100000139 3300005539 Bacteria 49652
57 Ga0068853_100028883 3300005539 Bacteria 4669
58 Ga0068853_100215811 3300005539 Bacteria 1750
59 Ga0068853_100379696 3300005539 Bacteria 1319
60 Ga0068853_100415511 3300005539 Bacteria 1261
61 Ga0068853_102158053 3300005539 Bacteria 540
62 Ga0070686_100841070 3300005544 Bacteria 743
63 Ga0070696_100032116 3300005546 Bacteria 3601
64 Ga0070696_100456702 3300005546 Bacteria 1009
65 Ga0070696_100628279 3300005546 Bacteria 868
66 Ga0070693_100033651 3300005547 Bacteria 2830
67 Ga0070693_100037313 3300005547 Bacteria 2709
68 Ga0070665_100005386 3300005548 Bacteria 13205
69 Ga0070665_100006815 3300005548 Bacteria 11617
70 Ga0070665_100272192 3300005548 Bacteria 1695
71 Ga0068855_100000186 3300005563 Bacteria 79655
72 Ga0068855_100007864 3300005563 Bacteria 12884
73 Ga0068857_100212506 3300005577 Bacteria 1765
74 Ga0068857_100260932 3300005577 Bacteria 1590
75 Ga0068857_100728563 3300005577 Bacteria 943
76 Ga0068854_100026233 3300005578 Bacteria 4003
77 Ga0068856_100011969 3300005614 Bacteria 8401
78 Ga0068856_100038837 3300005614 Bacteria 4673
79 Ga0068856_100182347 3300005614 Bacteria 2113
80 Ga0068856_100215296 3300005614 Bacteria 1936
81 Ga0068852_100087251 3300005616 Bacteria 2783
82 Ga0068852_100113207 3300005616 Bacteria 2470
83 Ga0068852_100179005 3300005616 Bacteria 1992
84 Ga0068852_100241952 3300005616 Bacteria 1725
85 Ga0068859_100056601 3300005617 Bacteria 3948
86 Ga0068864_100074532 3300005618 Bacteria 2961
87 Ga0068864_100098322 3300005618 Bacteria 2592
88 Ga0068863_100044942 3300005841 Bacteria 4192
89 Ga0068863_100054389 3300005841 Bacteria 3792
90 Ga0068863_100090217 3300005841 Bacteria 2906
91 Ga0068858_100090101 3300005842 Bacteria 2854
92 Ga0068858_100213548 3300005842 Bacteria 1826
93 Ga0068860_100003573 3300005843 Bacteria 15984
94 Ga0068860_100009355 3300005843 Bacteria 9737
95 Ga0068860_100218111 3300005843 Bacteria 1852
96 Ga0068860_100372058 3300005843 Bacteria 1409
97 Ga0068860_100629450 3300005843 Bacteria 1080
98 Ga0068862_100178674 3300005844 Bacteria 1904
99 Ga0068862_101696206 3300005844 Bacteria 640
100 Ga0070712_100537656 3300006175 Bacteria 983
101 Ga0097621_100155073 3300006237 Bacteria 1965
102 Ga0097621_100254391 3300006237 Bacteria 1539
103 Ga0068871_100023400 3300006358 Bacteria 4778
104 Ga0068871_100882756 3300006358 Bacteria 828
105 Ga0075428_100730358 3300006844 Bacteria 1054
106 Ga0075433_10603840 3300006852 Bacteria 963
107 Ga0075429_100203871 3300006880 Bacteria 1733
108 Ga0068865_100051301 3300006881 Bacteria 2855
109 Ga0068865_100241278 3300006881 Bacteria 1422
110 Ga0097620_100056601 3300006931 Bacteria 3948
111 Ga0105240_10023606 3300009093 Bacteria 8125
112 Ga0105240_10659590 3300009093 Bacteria 1146
113 Ga0111539_10002218 3300009094 Bacteria 25946
114 Ga0105245_10102171 3300009098 Bacteria 2655
115 Ga0105245_12032415 3300009098 Bacteria 628
116 Ga0105245_13158569 3300009098 Bacteria 511
117 Ga0105247_10286136 3300009101 Bacteria 1139
118 Ga0105243_10371187 3300009148 Bacteria 1320
119 Ga0105241_10009561 3300009174 Bacteria 7126
120 Ga0105241_10959841 3300009174 Bacteria 797
121 Ga0105242_10017183 3300009176 Bacteria 5633
122 Ga0105242_10275535 3300009176 Bacteria 1526
123 Ga0105242_10613184 3300009176 Bacteria 1053
124 Ga0105248_10037032 3300009177 Bacteria 5455
125 Ga0105248_10667066 3300009177 Bacteria 1173
126 Ga0105248_11487512 3300009177 Bacteria 767
127 Ga0105248_12863982 3300009177 Bacteria 550
128 Ga0105237_10038334 3300009545 Bacteria 4839
129 Ga0105237_10653241 3300009545 Bacteria 1058
130 Ga0105237_11045689 3300009545 Bacteria 823
131 Ga0105238_10000972 3300009551 Bacteria 29340
132 Ga0105238_10004618 3300009551 Bacteria 13631
133 Ga0105238_10209973 3300009551 Bacteria 1923
134 Ga0105249_10084753 3300009553 Bacteria 2951
135 Ga0105249_10182736 3300009553 Bacteria 2041
136 Ga0105249_10546295 3300009553 Bacteria 1209
137 Ga0105239_10013394 3300010375 Bacteria 9111
138 Ga0105239_10022375 3300010375 Bacteria 6969
139 Ga0105239_10047052 3300010375 Bacteria 4726
140 Ga0105239_10146472 3300010375 Bacteria 2634
141 Ga0105239_10224424 3300010375 Bacteria 2107
142 Ga0105239_10406279 3300010375 Bacteria 1541
143 Ga0105239_10902616 3300010375 Bacteria 1014
144 Ga0105239_12832956 3300010375 Bacteria 566
145 Ga0105246_10070636 3300011119 Bacteria 2456
146 Ga0157371_10181349 3300013102 Bacteria 1506
147 Ga0157370_10107504 3300013104 Bacteria 2609
148 Ga0157370_10251550 3300013104 Bacteria 1634
149 Ga0157370_10369029 3300013104 Bacteria 1323
150 Ga0157369_10006929 3300013105 Bacteria 13076
151 Ga0157369_10019475 3300013105 Bacteria 7592
152 Ga0157369_10233503 3300013105 Bacteria 1922
153 Ga0157374_11170401 3300013296 Bacteria 790
154 Ga0157378_10029176 3300013297 Bacteria 4870
155 Ga0157378_10288542 3300013297 Bacteria 1584
156 Ga0163162_10010474 3300013306 Bacteria 9014
157 Ga0163162_10010824 3300013306 Bacteria 8875
158 Ga0163162_10379841 3300013306 Bacteria 1546
159 Ga0163162_11084009 3300013306 Bacteria 907
160 Ga0157372_10003531 3300013307 Bacteria 16847
161 Ga0157372_10062647 3300013307 Bacteria 4168
162 Ga0157372_11967464 3300013307 Bacteria 672
163 Ga0157375_10001312 3300013308 Bacteria 21447
164 Ga0157375_10124721 3300013308 Bacteria 2689
165 Ga0157375_10169352 3300013308 Bacteria 2331
166 Ga0163163_10000168 3300014325 Bacteria 68808
167 Ga0163163_10001009 3300014325 Bacteria 23814
168 Ga0163163_10028802 3300014325 Bacteria 5338
169 Ga0163163_10135895 3300014325 Bacteria 2500
170 Ga0182008_10001813 3300014497 Bacteria 13925
171 Ga0182008_10098115 3300014497 Bacteria 1446
172 Ga0182008_10290651 3300014497 Bacteria 853
173 Ga0157379_10011655 3300014968 Bacteria 7676
174 Ga0157379_10599198 3300014968 Bacteria 1028
175 Ga0157376_10067528 3300014969 Bacteria 3025
176 Ga0182006_1000072 3300015261 Bacteria 133681
177 Ga0182006_1014700 3300015261 Bacteria 3370
178 Ga0182007_10003436 3300015262 Bacteria 7464
179 Ga0182007_10048943 3300015262 Bacteria 1397
180 Ga0182007_10090847 3300015262 Bacteria 1006
181 Ga0182007_10139647 3300015262 Bacteria 819
182 Ga0182005_1000080 3300015265 Bacteria 76011
183 Ga0182005_1004229 3300015265 Bacteria 4686
184 Ga0182005_1008595 3300015265 Bacteria 3003
185 Ga0163161_10002457 3300017792 Bacteria 13228
186 Ga0163161_10023223 3300017792 Bacteria 4373
187 Ga0197907_11481889 3300020069 Bacteria 1119
188 Ga0206355_1403764 3300020076 Bacteria 883
189 Ga0209674_100119 3300025226 Bacteria 135468
190 Ga0209674_100426 3300025226 Bacteria 20351
191 Ga0209674_102261 3300025226 Bacteria 4260
192 Ga0209672_100016 3300025228 Bacteria 522604
193 Ga0207427_100334 3300025231 Bacteria 31251
194 Ga0209437_100139 3300025233 Bacteria 172506
195 Ga0209258_100012 3300025242 Bacteria 825544
196 Ga0209677_116022 3300025253 Bacteria 969
197 Ga0209148_1000014 3300025254 Bacteria 925277
198 Ga0209759_1005589 3300025256 Bacteria 4364
199 Ga0209233_1000083 3300025261 Bacteria 336016
200 Ga0209233_1000191 3300025261 Bacteria 127938
201 Ga0209455_1000014 3300025272 Bacteria 806601
202 Ga0209455_1000338 3300025272 Bacteria 44594
203 Ga0209673_1117922 3300025273 Bacteria 545
204 Ga0209256_1004462 3300025299 Bacteria 8764
205 Ga0209051_1037076 3300025303 Bacteria 1793
206 Ga0207710_10024201 3300025900 Bacteria 2614
207 Ga0207680_10000002 3300025903 Bacteria 1018646
208 Ga0207680_10008319 3300025903 Bacteria 5083
209 Ga0207647_10000029 3300025904 Bacteria 109732
210 Ga0207647_10001205 3300025904 Bacteria 19905
211 Ga0207647_10067789 3300025904 Bacteria 2161
212 Ga0207705_10008424 3300025909 Bacteria 7529
213 Ga0207705_10040657 3300025909 Bacteria 3336
214 Ga0207705_10204906 3300025909 Bacteria 1495
215 Ga0207654_10000072 3300025911 Bacteria 66188
216 Ga0207654_10054698 3300025911 Bacteria 2308
217 Ga0207707_10164066 3300025912 Bacteria 1942
218 Ga0207707_10389183 3300025912 Bacteria 1198
219 Ga0207695_10000256 3300025913 Bacteria 135850
220 Ga0207695_10003762 3300025913 Bacteria 21057
221 Ga0207671_10004173 3300025914 Bacteria 13960
222 Ga0207671_10600912 3300025914 Bacteria 877
223 Ga0207671_11108444 3300025914 Bacteria 621
224 Ga0207693_10474804 3300025915 Bacteria 977
225 Ga0207663_10482091 3300025916 Bacteria 961
226 Ga0207660_10030205 3300025917 Bacteria 3724
227 Ga0207662_10474321 3300025918 Bacteria 859
228 Ga0207657_10204814 3300025919 Bacteria 1585
229 Ga0207657_10279886 3300025919 Bacteria 1324
230 Ga0207649_10001367 3300025920 Bacteria 14474
231 Ga0207649_10088430 3300025920 Bacteria 2023
232 Ga0207649_10122482 3300025920 Bacteria 1755
233 Ga0207649_10678523 3300025920 Bacteria 798
234 Ga0207652_10266346 3300025921 Bacteria 1546
235 Ga0207694_10000470 3300025924 Bacteria 36877
236 Ga0207694_10225229 3300025924 Bacteria 1530
237 Ga0207687_10050737 3300025927 Bacteria 2889
238 Ga0207687_10089002 3300025927 Bacteria 2247
239 Ga0207687_11049395 3300025927 Bacteria 699
240 Ga0207700_10977203 3300025928 Bacteria 758
241 Ga0207664_10000239 3300025929 Bacteria 41739
242 Ga0207664_10006000 3300025929 Bacteria 8319
243 Ga0207664_10025617 3300025929 Bacteria 4447
244 Ga0207644_10570153 3300025931 Bacteria 938
245 Ga0207644_11452705 3300025931 Bacteria 576
246 Ga0207690_10000448 3300025932 Bacteria 26681
247 Ga0207690_10000586 3300025932 Bacteria 23543
248 Ga0207690_10044195 3300025932 Bacteria 2935
249 Ga0207690_10110331 3300025932 Bacteria 1980
250 Ga0207706_10246472 3300025933 Bacteria 1561
251 Ga0207686_10342964 3300025934 Bacteria 1122
252 Ga0207709_11576128 3300025935 Bacteria 545
253 Ga0207669_10384927 3300025937 Bacteria 1094
254 Ga0207704_10345391 3300025938 Bacteria 1157
255 Ga0207704_10442880 3300025938 Bacteria 1035
256 Ga0207711_10299119 3300025941 Bacteria 1484
257 Ga0207667_10015167 3300025949 Bacteria 8762
258 Ga0207667_10017940 3300025949 Bacteria 7953
259 Ga0207667_10080089 3300025949 Bacteria 3384
260 Ga0207667_10125646 3300025949 Bacteria 2642
261 Ga0207712_10326375 3300025961 Bacteria 1268
262 Ga0207712_10339919 3300025961 Bacteria 1244
263 Ga0207668_10766201 3300025972 Bacteria 852
264 Ga0207640_10364707 3300025981 Bacteria 1165
265 Ga0207658_10182141 3300025986 Bacteria 1739
266 Ga0207658_10197722 3300025986 Bacteria 1676
267 Ga0207658_10324780 3300025986 Bacteria 1333
268 Ga0207703_10250730 3300026035 Bacteria 1595
269 Ga0207703_11122377 3300026035 Bacteria 755
270 Ga0207703_11869879 3300026035 Bacteria 576
271 Ga0207639_10000931 3300026041 Bacteria 19788
272 Ga0207639_10015505 3300026041 Bacteria 5379
273 Ga0207639_10038167 3300026041 Bacteria 3571
274 Ga0207639_10039740 3300026041 Bacteria 3507
275 Ga0207639_10095285 3300026041 Bacteria 2392
276 Ga0207639_10399634 3300026041 Bacteria 1238
277 Ga0207639_12211288 3300026041 Bacteria 511
278 Ga0207678_10009391 3300026067 Bacteria 8606
279 Ga0207678_10074977 3300026067 Bacteria 2898
280 Ga0207678_10162477 3300026067 Bacteria 1907
281 Ga0207678_10289904 3300026067 Bacteria 1406
282 Ga0207702_10001547 3300026078 Bacteria 22753
283 Ga0207702_10006329 3300026078 Bacteria 10226
284 Ga0207702_10012695 3300026078 Bacteria 7010
285 Ga0207702_10154401 3300026078 Bacteria 2091
286 Ga0207702_10248275 3300026078 Bacteria 1670
287 Ga0207641_10011588 3300026088 Bacteria 7237
288 Ga0207641_10017887 3300026088 Bacteria 5806
289 Ga0207641_10034940 3300026088 Bacteria 4184
290 Ga0207641_10453211 3300026088 Bacteria 1240
291 Ga0207676_10019164 3300026095 Bacteria 4986
292 Ga0207676_10346839 3300026095 Bacteria 1372
293 Ga0207674_10115469 3300026116 Bacteria 2656
294 Ga0207674_10472425 3300026116 Bacteria 1212
295 Ga0207674_10570972 3300026116 Bacteria 1093
296 Ga0207674_10851693 3300026116 Bacteria 879
297 Ga0207675_102625450 3300026118 Bacteria 513
298 Ga0207683_10138081 3300026121 Bacteria 2195
299 Ga0207683_10227822 3300026121 Bacteria 1699
300 Ga0207698_10017149 3300026142 Bacteria 4906
301 Ga0207698_10060220 3300026142 Bacteria 2952
302 Ga0207698_10265152 3300026142 Bacteria 1580
303 Ga0209969_1030384 3300027360 Bacteria 825
304 Ga0268266_10000004 3300028379 Bacteria 1495817
305 Ga0268266_10046248 3300028379 Bacteria 3726
306 Ga0268266_10398226 3300028379 Bacteria 1301
307 Ga0268265_10804010 3300028380 Bacteria 917
308 Ga0268264_10005680 3300028381 Bacteria 10575
309 Ga0268264_10013949 3300028381 Bacteria 6606
310 Ga0268264_10057271 3300028381 Bacteria 3260
311 Ga0268264_10410559 3300028381 Bacteria 1303
312 Ga0268264_12046471 3300028381 Bacteria 581
313 Ga0307408_101952232 3300031548 Bacteria 564
314 Ga0316575_10005122 3300031665 Bacteria 4653
315 Ga0307516_10104907 3300031730 Bacteria 2638
316 Ga0307405_10110686 3300031731 Bacteria 1860
317 Ga0307413_10579183 3300031824 Bacteria 915
318 Ga0307410_11564944 3300031852 Bacteria 582
319 Ga0307412_10008807 3300031911 Bacteria 5778
320 Ga0307409_100052564 3300031995 Bacteria 3125
321 Ga0307409_100152459 3300031995 Bacteria 2009
322 Ga0307416_100061464 3300032002 Bacteria 3066
323 Ga0307415_101439690 3300032126 Unclassified 657
324 Ga0307510_10000770 3300033180 Bacteria 33082
325 Ga0373944_0113939 3300035089 Bacteria 926
326 Ga0373923_0123727 3300035111 Bacteria 1158
327 Ga0373957_0154264 3300035120 Bacteria 944
328 Ga0373947_0251575 3300035725 Bacteria 1169
329 Ga0395899_0047597 3300037312 Bacteria 3192
330 Ga0395900_0206167 3300037418 Bacteria 1987
331 Ga0395898_0001311 3300037466 Bacteria 36213
332 Ga0395901_0000816 3300038443 Bacteria 34537
333 Ga0395901_0843432 3300038443 Bacteria 902
334 Ga0395901_1677047 3300038443 Bacteria 587
335 Ga0436363_0890279 3300039450 Bacteria 595
336 Ga0439436_0000099 3300041404 Bacteria 20537
337 Ga0439465_0003612 3300041413 Bacteria 5047
338 Ga0451787_003194 3300041441 Bacteria 1313
339 Ga0451787_108926 3300041441 Bacteria 1768
340 Ga0451791_0262041 3300041451 Bacteria 787
341 Ga0451793_1434546 3300041452 Bacteria 1654
342 Ga0451797_1213514 3300041453 Bacteria 857
343 Ga0451802_0511048 3300041460 Bacteria 5068
344 Ga0451833_0775520 3300041491 Bacteria 2287
345 Ga0451833_0823068 3300041491 Bacteria 697
346 Ga0451833_1492982 3300041491 Bacteria 605
347 Ga0451837_0859325 3300041494 Bacteria 1072
348 Ga0451837_1101813 3300041494 Bacteria 2018
349 Ga0451841_1038888 3300041498 Bacteria 1081
350 Ga0451843_0311453 3300041509 Bacteria 948
351 Ga0451853_0913553 3300041512 Bacteria 1865
352 Ga0439445_0012742 3300042004 Bacteria 2025
353 Ga0439432_030621 3300042006 Bacteria 1744
354 Ga0439451_040265 3300042009 Unclassified 938
355 Ga0450897_040655 3300042128 Bacteria 546
356 Ga0450894_037729 3300042131 Bacteria 688
357 Ga0450908_002471 3300042184 Bacteria 3615
358 Ga0466969_0001632 3300044656 Bacteria 12024
359 Ga0466989_0020593 3300044663 Bacteria 3802
360 Ga0466966_0039686 3300044684 Bacteria 3031
361 Ga0466961_0025286 3300044693 Bacteria 3818
362 Ga0466961_0487929 3300044693 Bacteria 744
363 Ga0466963_0255153 3300044694 Bacteria 1231
364 Ga0466971_0088792 3300044719 Bacteria 1414
365 Ga0466968_0001115 3300044735 Bacteria 9513
366 Ga0466970_0024169 3300044765 Bacteria 3176
367 Ga0466959_0252405 3300045049 Bacteria 1216
368 Ga0466958_0087539 3300045836 Bacteria 1923
369 Ga0466958_0183193 3300045836 Bacteria 1329
370 Ga0495617_000117 3300046452 Bacteria 54105
371 Ga0495617_009842 3300046452 Bacteria 3278
372 Ga0495638_0000153 3300046460 Bacteria 109155
373 Ga0495638_0063908 3300046460 Bacteria 2268
374 Ga0495651_0471692 3300046462 Bacteria 808
375 Ga0495650_0000271 3300046471 Bacteria 98894
376 Ga0495650_0003006 3300046471 Bacteria 12745
377 Ga0495650_0165229 3300046471 Bacteria 786
378 Ga0495639_0060953 3300046475 Bacteria 1729
379 Ga0495585_0001084 3300046492 Bacteria 22416
380 Ga0495607_0000120 3300046501 Bacteria 82667
381 Ga0495583_0385049 3300046506 Bacteria 551
382 Ga0495606_0001210 3300046507 Bacteria 36218
383 Ga0495606_0002719 3300046507 Bacteria 19946
384 Ga0495606_0025920 3300046507 Bacteria 4187
385 Ga0495610_0002124 3300046512 Bacteria 16863
386 Ga0495610_0030866 3300046512 Bacteria 2801
387 Ga0495616_0080241 3300046513 Bacteria 1562
388 Ga0495620_0005183 3300046515 Bacteria 7292
389 Ga0495631_0000029 3300046518 Bacteria 86555
390 Ga0495631_0001826 3300046518 Bacteria 12579
391 Ga0495632_0000004 3300046519 Bacteria 381372
392 Ga0495632_0088872 3300046519 Bacteria 1467
393 Ga0495643_0094780 3300046522 Bacteria 1536
394 Ga0495648_0001512 3300046524 Bacteria 22781
395 Ga0495648_0013046 3300046524 Bacteria 6165
396 Ga0495609_0005899 3300046538 Bacteria 6332
397 Ga0495611_0000001 3300046648 Bacteria 2628469
398 Ga0495611_0000060 3300046648 Bacteria 77971
399 Ga0495625_0000022 3300046660 Bacteria 278823
400 Ga0495625_0029807 3300046660 Bacteria 4077
401 Ga0495625_0154886 3300046660 Bacteria 1538
402 Ga0495625_0161202 3300046660 Bacteria 1502
403 Ga0495661_0000438 3300046665 Bacteria 44026
404 Ga0495647_0056370 3300046681 Bacteria 1540
405 Ga0495670_0005573 3300046691 Bacteria 6178
406 Ga0495670_0038632 3300046691 Bacteria 2380
407 Ga0495671_0024804 3300046692 Bacteria 3119
408 Ga0495649_0008445 3300046694 Bacteria 6197
409 Ga0495589_0000237 3300046794 Bacteria 46023
410 Ga0495660_0000092 3300046810 Bacteria 96197
411 Ga0495660_0004103 3300046810 Bacteria 8885
412 Ga0495674_0222044 3300047319 Bacteria 1562
413 Ga0495679_000004 3300047446 Bacteria 748056
414 Ga0495673_0000004 3300047469 Bacteria 1354526
415 Ga0495673_0001152 3300047469 Bacteria 22486
416 Ga0495673_0001469 3300047469 Bacteria 18680
417 Ga0495686_0000017 3300047472 Bacteria 435554
418 Ga0495686_0011096 3300047472 Bacteria 6365
419 Ga0495686_0105700 3300047472 Bacteria 1693
420 Ga0496100_0028387 3300048903 Bacteria 3451
421 Ga0496101_0001374 3300048904 Bacteria 14578
422 Ga0496102_0387398 3300048905 Bacteria 1315
423 Ga0496106_0000309 3300048909 Bacteria 34373
424 Ga0496106_0921086 3300048909 Bacteria 690
425 Ga0496108_0670168 3300048911 Bacteria 901
426 Ga0496116_0116936 3300048919 Bacteria 1553
427 Ga0496117_0027842 3300048920 Bacteria 4390
428 Ga0496117_0083891 3300048920 Bacteria 2081
429 Ga0496117_0129266 3300048920 Bacteria 1534
430 Ga0496118_0000429 3300048921 Bacteria 69699
431 Ga0496118_0002637 3300048921 Bacteria 23784
432 Ga0496118_0092608 3300048921 Bacteria 2073
433 Ga0496118_0503770 3300048921 Bacteria 601
434 Ga0496118_0528659 3300048921 Bacteria 580
435 Ga0496119_0071853 3300048922 Bacteria 2024
436 Ga0496120_0073946 3300048923 Bacteria 1863
437 Ga0496121_0000045 3300048924 Bacteria 336130
438 Ga0496121_0006695 3300048924 Bacteria 14165
439 Ga0496121_0062715 3300048924 Bacteria 3042
440 Ga0496121_0181665 3300048924 Bacteria 1517
441 Ga0496121_0422672 3300048924 Bacteria 867
442 Ga0496121_0869874 3300048924 Bacteria 522
443 Ga0496122_0181748 3300048925 Bacteria 1253
444 Ga0496123_0017670 3300048926 Bacteria 5722
445 Ga0496124_0373776 3300048927 Bacteria 999
446 Ga0496125_0010765 3300048928 Bacteria 9213
447 Ga0496126_0058598 3300048929 Bacteria 3471
448 Ga0496126_0183782 3300048929 Bacteria 1774
449 Ga0496126_0404230 3300048929 Bacteria 1107
450 Ga0496126_0409263 3300048929 Bacteria 1099
451 Ga0495678_001379 3300049459 Bacteria 19361
452 Ga0495682_0006075 3300049460 Bacteria 4924
453 Ga0495682_0064224 3300049460 Bacteria 1323
454 Ga0501032_0078774 3300049569 Bacteria 2193
455 Ga0501033_0090845 3300049570 Bacteria 2234
456 Ga0501033_0145115 3300049570 Bacteria 1714
457 Ga0501034_0000793 3300049571 Bacteria 47013
458 Ga0501034_0109115 3300049571 Bacteria 2758
459 Ga0501034_0130865 3300049571 Bacteria 2492
460 Ga0501036_0069503 3300049572 Bacteria 2979
461 Ga0501036_0128624 3300049572 Bacteria 2138
462 Ga0501037_0049477 3300049573 Bacteria 3077
463 Ga0501037_0080609 3300049573 Bacteria 2361
464 Ga0501037_0099898 3300049573 Bacteria 2095
465 Ga0501038_0019255 3300049574 Bacteria 6157
466 Ga0501038_0092547 3300049574 Bacteria 2531
467 Ga0501038_0188325 3300049574 Bacteria 1661
468 Ga0501039_0442581 3300049575 Bacteria 1020
469 Ga0501039_1142464 3300049575 Bacteria 603
470 Ga0501039_1314004 3300049575 Bacteria 558
471 Ga0501040_0082914 3300049576 Bacteria 2223
472 Ga0501042_0103574 3300049578 Bacteria 2048
473 Ga0501042_0201136 3300049578 Bacteria 1436
474 Ga0501043_0083946 3300049579 Bacteria 2504
475 Ga0501043_0142203 3300049579 Bacteria 1878
476 Ga0501043_0158133 3300049579 Bacteria 1771
477 Ga0501043_0532668 3300049579 Bacteria 874
478 Ga0501046_0045202 3300049580 Bacteria 3499
479 Ga0501046_0274745 3300049580 Bacteria 1235
480 Ga0501046_0652919 3300049580 Bacteria 743
481 Ga0501047_0004130 3300049581 Bacteria 13665
482 Ga0501047_0015205 3300049581 Bacteria 7328
483 Ga0501048_0531137 3300049582 Bacteria 844
484 Ga0501067_0002557 3300049583 Bacteria 10044
485 Ga0501067_0026091 3300049583 Bacteria 3238
486 Ga0501067_0071925 3300049583 Bacteria 1915
487 Ga0501068_0001290 3300049584 Bacteria 13290
488 Ga0501068_0027723 3300049584 Bacteria 3346
489 Ga0501068_0036301 3300049584 Bacteria 2945
490 Ga0501069_0002046 3300049585 Bacteria 10122
491 Ga0501069_0003785 3300049585 Bacteria 7782
492 Ga0501070_0009793 3300049586 Bacteria 8107
493 Ga0501070_0338365 3300049586 Bacteria 1222
494 Ga0501070_0350274 3300049586 Bacteria 1198
495 Ga0501070_0602574 3300049586 Bacteria 875
496 Ga0501071_0001781 3300049587 Bacteria 12700
497 Ga0501072_0002275 3300049588 Bacteria 14353
498 Ga0501072_0002562 3300049588 Bacteria 13621
499 Ga0501072_0085757 3300049588 Bacteria 2498
500 Ga0501073_0009229 3300049589 Bacteria 7272
501 Ga0501073_0134798 3300049589 Bacteria 1711
502 Ga0501073_0435375 3300049589 Bacteria 906
503 Ga0501073_0855445 3300049589 Bacteria 626
504 Ga0501074_0001030 3300049590 Bacteria 18099
505 Ga0501074_0017328 3300049590 Bacteria 5225
506 Ga0501074_0182821 3300049590 Bacteria 1495
507 Ga0501079_0099275 3300049741 Bacteria 2256
508 Ga0501079_0233063 3300049741 Bacteria 1438
509 Ga0501079_0751556 3300049741 Bacteria 767
510 Ga0501080_0038840 3300049742 Bacteria 4442
511 Ga0501080_0061917 3300049742 Bacteria 3482
512 Ga0501080_0063050 3300049742 Bacteria 3449
513 Ga0501080_0257466 3300049742 Bacteria 1590
514 Ga0501080_0437437 3300049742 Bacteria 1174
515 Ga0501083_0009264 3300049744 Bacteria 6950
516 Ga0501083_0031037 3300049744 Bacteria 3667
517 Ga0501083_0052844 3300049744 Bacteria 2728
518 Ga0501035_0162785 3300049822 Bacteria 1930
519 Ga0501035_0174850 3300049822 Bacteria 1853
520 Ga0501035_0274329 3300049822 Bacteria 1426
521 Ga0501035_0368490 3300049822 Bacteria 1199
522 Ga0501044_0005623 3300049823 Bacteria 13924
523 Ga0501044_0014313 3300049823 Bacteria 8563
524 Ga0501044_0150088 3300049823 Bacteria 2313
525 Ga0501044_0550473 3300049823 Bacteria 1051
526 nmdc:mga05p37_580783_c1 3300050507 Bacteria 1269
527 nmdc:mga09592_276946_c1 3300050508 Bacteria 1455
528 nmdc:mga06r32_1657111_c1 3300050510 Bacteria 577
529 nmdc:mga06r32_379284_c1 3300050510 Bacteria 1397
530 nmdc:mga08y16_2398_c1 3300050511 Bacteria 19250
531 Ga0500610_0017213 3300053079 Bacteria 3466
532 Ga0500643_000108 3300053087 Bacteria 86547
533 Ga0500646_0027234 3300053090 Bacteria 1554
534 Ga0500651_0060273 3300053093 Bacteria 2372
535 Ga0500555_000942 3300053103 Bacteria 10118
536 Ga0500588_0317910 3300053146 Bacteria 590
537 Ga0500637_0549292 3300053178 Unclassified 560
538 Ga0500645_002222 3300053730 Bacteria 8853
539 Ga0501084_0012052 3300054114 Bacteria 7160
540 Ga0501084_0107983 3300054114 Bacteria 2338
541 Ga0501084_0474579 3300054114 Bacteria 1057
542 Ga0500661_009297 3300055283 Bacteria 1802
543 Ga0501082_0017987 3300060353 Bacteria 6087
544 Ga0501082_0043888 3300060353 Bacteria 3857
545 Ga0501082_0088743 3300060353 Bacteria 2668
546 2595451761 2593339239 Bacteria 4124669
547 2643894148 2643221577 Bacteria 3710843
548 2644476351 2643221685 Bacteria 3673288
549 2721026615 2718218334 Bacteria 4765486
550 2735833389 2734482264 Unclassified 5014763
551 2739229386 2738543009 Bacteria 4944499
552 2842919774 2842918807 Bacteria 4289178
553 2884341382 2884338543 Bacteria 4610696
554 2895396936 2895395659 Bacteria 3983269
555 2919087588 2919085039 Bacteria 4532964
556 2919404841 2919404418 Bacteria 4232372
557 2939614260 2939611941 Bacteria 3892017
558 2941472840 2941471342 Bacteria 5018624
559 2953995073 2953994433 Bacteria 4303959
560 Ga0068863_100784894
561 JGI24740J21852_10174049
562 JGI24738J21930_10059907
563 JGI24744J21845_10015342
564 JGI25156J39149_1011621
565 JGI25164J39214_1001086
566 JGI25165J46597_1004623
567 Ga0006562J51391_1073321
568 Ga0006562J51391_1073322
569 Ga0055539_1001755
570 Ga0055533_1013385
571 Ga0055527_1000082
572 Ga0055535_1000143
573 Ga0055542_1000190
574 Ga0055529_1000217
575 Ga0065165_1000028
576 Ga0065707_10916251
577 Ga0070658_10001446
578 Ga0070658_10260004
579 Ga0070683_100465561
580 Ga0070690_101468300
581 Ga0070666_10000007
582 Ga0070666_10008334
583 Ga0070680_100348622
584 Ga0070682_100092289
585 Ga0070682_100750858
586 Ga0070660_100104837
587 Ga0070660_100297180
588 Ga0070661_100046195
589 Ga0070661_100232873
590 Ga0070661_100394503
591 Ga0070668_100431163
592 Ga0070675_100595125
593 Ga0070671_100817703
594 Ga0070674_100170543
595 Ga0070659_100021966
596 Ga0070659_100141151
597 Ga0070659_100331704
598 Ga0070667_100087948
599 Ga0070667_100221091
600 Ga0070714_100007668
601 Ga0070713_100248395
602 Ga0070711_100615740
603 Ga0070663_100057755
604 Ga0070663_100069357
605 Ga0070663_100152507
606 Ga0070678_101235400
607 Ga0070662_100074458
608 Ga0070662_100707460
609 Ga0070681_10003594
610 Ga0070681_10142129
611 Ga0070681_10202353
612 Ga0070699_100824449
613 Ga0070679_100446724
614 Ga0070684_100458044
615 Ga0068853_100000139
616 Ga0068853_100028883
617 Ga0068853_100215811
618 Ga0068853_100379696
619 Ga0068853_100415511
620 Ga0068853_102158053
621 Ga0070686_100841070
622 Ga0070696_100032116
623 Ga0070696_100456702
624 Ga0070696_100628279
625 Ga0070693_100033651
626 Ga0070693_100037313
627 Ga0070665_100005386
628 Ga0070665_100006815
629 Ga0070665_100272192
630 Ga0068855_100000186
631 Ga0068855_100007864
632 Ga0068857_100212506
633 Ga0068857_100260932
634 Ga0068857_100728563
635 Ga0068854_100026233
636 Ga0068856_100011969
637 Ga0068856_100038837
638 Ga0068856_100182347
639 Ga0068856_100215296
640 Ga0068852_100087251
641 Ga0068852_100113207
642 Ga0068852_100179005
643 Ga0068852_100241952
644 Ga0068859_100056601
645 Ga0068864_100074532
646 Ga0068864_100098322
647 Ga0068863_100044942
648 Ga0068863_100054389
649 Ga0068863_100090217
650 Ga0068858_100090101
651 Ga0068858_100213548
652 Ga0068860_100003573
653 Ga0068860_100009355
654 Ga0068860_100218111
655 Ga0068860_100372058
656 Ga0068860_100629450
657 Ga0068862_100178674
658 Ga0068862_101696206
659 Ga0070712_100537656
660 Ga0097621_100155073
661 Ga0097621_100254391
662 Ga0068871_100023400
663 Ga0068871_100882756
664 Ga0075428_100730358
665 Ga0075433_10603840
666 Ga0075429_100203871
667 Ga0068865_100051301
668 Ga0068865_100241278
669 Ga0097620_100056601
670 Ga0105240_10023606
671 Ga0105240_10659590
672 Ga0111539_10002218
673 Ga0105245_10102171
674 Ga0105245_12032415
675 Ga0105245_13158569
676 Ga0105247_10286136
677 Ga0105243_10371187
678 Ga0105241_10009561
679 Ga0105241_10959841
680 Ga0105242_10017183
681 Ga0105242_10275535
682 Ga0105242_10613184
683 Ga0105248_10037032
684 Ga0105248_10667066
685 Ga0105248_11487512
686 Ga0105248_12863982
687 Ga0105237_10038334
688 Ga0105237_10653241
689 Ga0105237_11045689
690 Ga0105238_10000972
691 Ga0105238_10004618
692 Ga0105238_10209973
693 Ga0105249_10084753
694 Ga0105249_10182736
695 Ga0105249_10546295
696 Ga0105239_10013394
697 Ga0105239_10022375
698 Ga0105239_10047052
699 Ga0105239_10146472
700 Ga0105239_10224424
701 Ga0105239_10406279
702 Ga0105239_10902616
703 Ga0105239_12832956
704 Ga0105246_10070636
705 Ga0157371_10181349
706 Ga0157370_10107504
707 Ga0157370_10251550
708 Ga0157370_10369029
709 Ga0157369_10006929
710 Ga0157369_10019475
711 Ga0157369_10233503
712 Ga0157374_11170401
713 Ga0157378_10029176
714 Ga0157378_10288542
715 Ga0163162_10010474
716 Ga0163162_10010824
717 Ga0163162_10379841
718 Ga0163162_11084009
719 Ga0157372_10003531
720 Ga0157372_10062647
721 Ga0157372_11967464
722 Ga0157375_10001312
723 Ga0157375_10124721
724 Ga0157375_10169352
725 Ga0163163_10000168
726 Ga0163163_10001009
727 Ga0163163_10028802
728 Ga0163163_10135895
729 Ga0182008_10001813
730 Ga0182008_10098115
731 Ga0182008_10290651
732 Ga0157379_10011655
733 Ga0157379_10599198
734 Ga0157376_10067528
735 Ga0182006_1000072
736 Ga0182006_1014700
737 Ga0182007_10003436
738 Ga0182007_10048943
739 Ga0182007_10090847
740 Ga0182007_10139647
741 Ga0182005_1000080
742 Ga0182005_1004229
743 Ga0182005_1008595
744 Ga0163161_10002457
745 Ga0163161_10023223
746 Ga0197907_11481889
747 Ga0206355_1403764
748 Ga0209674_100119
749 Ga0209674_100426
750 Ga0209674_102261
751 Ga0209672_100016
752 Ga0207427_100334
753 Ga0209437_100139
754 Ga0209258_100012
755 Ga0209677_116022
756 Ga0209148_1000014
757 Ga0209759_1005589
758 Ga0209233_1000083
759 Ga0209233_1000191
760 Ga0209455_1000014
761 Ga0209455_1000338
762 Ga0209673_1117922
763 Ga0209256_1004462
764 Ga0209051_1037076
765 Ga0207710_10024201
766 Ga0207680_10000002
767 Ga0207680_10008319
768 Ga0207647_10000029
769 Ga0207647_10001205
770 Ga0207647_10067789
771 Ga0207705_10008424
772 Ga0207705_10040657
773 Ga0207705_10204906
774 Ga0207654_10000072
775 Ga0207654_10054698
776 Ga0207707_10164066
777 Ga0207707_10389183
778 Ga0207695_10000256
779 Ga0207695_10003762
780 Ga0207671_10004173
781 Ga0207671_10600912
782 Ga0207671_11108444
783 Ga0207693_10474804
784 Ga0207663_10482091
785 Ga0207660_10030205
786 Ga0207662_10474321
787 Ga0207657_10204814
788 Ga0207657_10279886
789 Ga0207649_10001367
790 Ga0207649_10088430
791 Ga0207649_10122482
792 Ga0207649_10678523
793 Ga0207652_10266346
794 Ga0207694_10000470
795 Ga0207694_10225229
796 Ga0207687_10050737
797 Ga0207687_10089002
798 Ga0207687_11049395
799 Ga0207700_10977203
800 Ga0207664_10000239
801 Ga0207664_10006000
802 Ga0207664_10025617
803 Ga0207644_10570153
804 Ga0207644_11452705
805 Ga0207690_10000448
806 Ga0207690_10000586
807 Ga0207690_10044195
808 Ga0207690_10110331
809 Ga0207706_10246472
810 Ga0207686_10342964
811 Ga0207709_11576128
812 Ga0207669_10384927
813 Ga0207704_10345391
814 Ga0207704_10442880
815 Ga0207711_10299119
816 Ga0207667_10015167
817 Ga0207667_10017940
818 Ga0207667_10080089
819 Ga0207667_10125646
820 Ga0207712_10326375
821 Ga0207712_10339919
822 Ga0207668_10766201
823 Ga0207640_10364707
824 Ga0207658_10182141
825 Ga0207658_10197722
826 Ga0207658_10324780
827 Ga0207703_10250730
828 Ga0207703_11122377
829 Ga0207703_11869879
830 Ga0207639_10000931
831 Ga0207639_10015505
832 Ga0207639_10038167
833 Ga0207639_10039740
834 Ga0207639_10095285
835 Ga0207639_10399634
836 Ga0207639_12211288
837 Ga0207678_10009391
838 Ga0207678_10074977
839 Ga0207678_10162477
840 Ga0207678_10289904
841 Ga0207702_10001547
842 Ga0207702_10006329
843 Ga0207702_10012695
844 Ga0207702_10154401
845 Ga0207702_10248275
846 Ga0207641_10011588
847 Ga0207641_10017887
848 Ga0207641_10034940
849 Ga0207641_10453211
850 Ga0207676_10019164
851 Ga0207676_10346839
852 Ga0207674_10115469
853 Ga0207674_10472425
854 Ga0207674_10570972
855 Ga0207674_10851693
856 Ga0207675_102625450
857 Ga0207683_10138081
858 Ga0207683_10227822
859 Ga0207698_10017149
860 Ga0207698_10060220
861 Ga0207698_10265152
862 Ga0209969_1030384
863 Ga0268266_10000004
864 Ga0268266_10046248
865 Ga0268266_10398226
866 Ga0268265_10804010
867 Ga0268264_10005680
868 Ga0268264_10013949
869 Ga0268264_10057271
870 Ga0268264_10410559
871 Ga0268264_12046471
872 Ga0307408_101952232
873 Ga0316575_10005122
874 Ga0307516_10104907
875 Ga0307405_10110686
876 Ga0307413_10579183
877 Ga0307410_11564944
878 Ga0307412_10008807
879 Ga0307409_100052564
880 Ga0307409_100152459
881 Ga0307416_100061464
882 Ga0307415_101439690
883 Ga0307510_10000770
884 Ga0373944_0113939
885 Ga0373923_0123727
886 Ga0373957_0154264
887 Ga0373947_0251575
888 Ga0395899_0047597
889 Ga0395900_0206167
890 Ga0395898_0001311
891 Ga0395901_0000816
892 Ga0395901_0843432
893 Ga0395901_1677047
894 Ga0436363_0890279
895 Ga0439436_0000099
896 Ga0439465_0003612
897 Ga0451787_003194
898 Ga0451787_108926
899 Ga0451791_0262041
900 Ga0451793_1434546
901 Ga0451797_1213514
902 Ga0451802_0511048
903 Ga0451833_0775520
904 Ga0451833_0823068
905 Ga0451833_1492982
906 Ga0451837_0859325
907 Ga0451837_1101813
908 Ga0451841_1038888
909 Ga0451843_0311453
910 Ga0451853_0913553
911 Ga0439445_0012742
912 Ga0439432_030621
913 Ga0439451_040265
914 Ga0450897_040655
915 Ga0450894_037729
916 Ga0450908_002471
917 Ga0466969_0001632
918 Ga0466989_0020593
919 Ga0466966_0039686
920 Ga0466961_0025286
921 Ga0466961_0487929
922 Ga0466963_0255153
923 Ga0466971_0088792
924 Ga0466968_0001115
925 Ga0466970_0024169
926 Ga0466959_0252405
927 Ga0466958_0087539
928 Ga0466958_0183193
929 Ga0495617_000117
930 Ga0495617_009842
931 Ga0495638_0000153
932 Ga0495638_0063908
933 Ga0495651_0471692
934 Ga0495650_0000271
935 Ga0495650_0003006
936 Ga0495650_0165229
937 Ga0495639_0060953
938 Ga0495585_0001084
939 Ga0495607_0000120
940 Ga0495583_0385049
941 Ga0495606_0001210
942 Ga0495606_0002719
943 Ga0495606_0025920
944 Ga0495610_0002124
945 Ga0495610_0030866
946 Ga0495616_0080241
947 Ga0495620_0005183
948 Ga0495631_0000029
949 Ga0495631_0001826
950 Ga0495632_0000004
951 Ga0495632_0088872
952 Ga0495643_0094780
953 Ga0495648_0001512
954 Ga0495648_0013046
955 Ga0495609_0005899
956 Ga0495611_0000001
957 Ga0495611_0000060
958 Ga0495625_0000022
959 Ga0495625_0029807
960 Ga0495625_0154886
961 Ga0495625_0161202
962 Ga0495661_0000438
963 Ga0495647_0056370
964 Ga0495670_0005573
965 Ga0495670_0038632
966 Ga0495671_0024804
967 Ga0495649_0008445
968 Ga0495589_0000237
969 Ga0495660_0000092
970 Ga0495660_0004103
971 Ga0495674_0222044
972 Ga0495679_000004
973 Ga0495673_0000004
974 Ga0495673_0001152
975 Ga0495673_0001469
976 Ga0495686_0000017
977 Ga0495686_0011096
978 Ga0495686_0105700
979 Ga0496100_0028387
980 Ga0496101_0001374
981 Ga0496102_0387398
982 Ga0496106_0000309
983 Ga0496106_0921086
984 Ga0496108_0670168
985 Ga0496116_0116936
986 Ga0496117_0027842
987 Ga0496117_0083891
988 Ga0496117_0129266
989 Ga0496118_0000429
990 Ga0496118_0002637
991 Ga0496118_0092608
992 Ga0496118_0503770
993 Ga0496118_0528659
994 Ga0496119_0071853
995 Ga0496120_0073946
996 Ga0496121_0000045
997 Ga0496121_0006695
998 Ga0496121_0062715
999 Ga0496121_0181665
1000 Ga0496121_0422672
1001 Ga0496121_0869874
1002 Ga0496122_0181748
1003 Ga0496123_0017670
1004 Ga0496124_0373776
1005 Ga0496125_0010765
1006 Ga0496126_0058598
1007 Ga0496126_0183782
1008 Ga0496126_0404230
1009 Ga0496126_0409263
1010 Ga0495678_001379
1011 Ga0495682_0006075
1012 Ga0495682_0064224
1013 Ga0501032_0078774
1014 Ga0501033_0090845
1015 Ga0501033_0145115
1016 Ga0501034_0000793
1017 Ga0501034_0109115
1018 Ga0501034_0130865
1019 Ga0501036_0069503
1020 Ga0501036_0128624
1021 Ga0501037_0049477
1022 Ga0501037_0080609
1023 Ga0501037_0099898
1024 Ga0501038_0019255
1025 Ga0501038_0092547
1026 Ga0501038_0188325
1027 Ga0501039_0442581
1028 Ga0501039_1142464
1029 Ga0501039_1314004
1030 Ga0501040_0082914
1031 Ga0501042_0103574
1032 Ga0501042_0201136
1033 Ga0501043_0083946
1034 Ga0501043_0142203
1035 Ga0501043_0158133
1036 Ga0501043_0532668
1037 Ga0501046_0045202
1038 Ga0501046_0274745
1039 Ga0501046_0652919
1040 Ga0501047_0004130
1041 Ga0501047_0015205
1042 Ga0501048_0531137
1043 Ga0501067_0002557
1044 Ga0501067_0026091
1045 Ga0501067_0071925
1046 Ga0501068_0001290
1047 Ga0501068_0027723
1048 Ga0501068_0036301
1049 Ga0501069_0002046
1050 Ga0501069_0003785
1051 Ga0501070_0009793
1052 Ga0501070_0338365
1053 Ga0501070_0350274
1054 Ga0501070_0602574
1055 Ga0501071_0001781
1056 Ga0501072_0002275
1057 Ga0501072_0002562
1058 Ga0501072_0085757
1059 Ga0501073_0009229
1060 Ga0501073_0134798
1061 Ga0501073_0435375
1062 Ga0501073_0855445
1063 Ga0501074_0001030
1064 Ga0501074_0017328
1065 Ga0501074_0182821
1066 Ga0501079_0099275
1067 Ga0501079_0233063
1068 Ga0501079_0751556
1069 Ga0501080_0038840
1070 Ga0501080_0061917
1071 Ga0501080_0063050
1072 Ga0501080_0257466
1073 Ga0501080_0437437
1074 Ga0501083_0009264
1075 Ga0501083_0031037
1076 Ga0501083_0052844
1077 Ga0501035_0162785
1078 Ga0501035_0174850
1079 Ga0501035_0274329
1080 Ga0501035_0368490
1081 Ga0501044_0005623
1082 Ga0501044_0014313
1083 Ga0501044_0150088
1084 Ga0501044_0550473
1085 nmdc:mga05p37_580783_c1
1086 nmdc:mga09592_276946_c1
1087 nmdc:mga06r32_1657111_c1
1088 nmdc:mga06r32_379284_c1
1089 nmdc:mga08y16_2398_c1
1090 Ga0500610_0017213
1091 Ga0500643_000108
1092 Ga0500646_0027234
1093 Ga0500651_0060273
1094 Ga0500555_000942
1095 Ga0500588_0317910
1096 Ga0500637_0549292
1097 Ga0500645_002222
1098 Ga0501084_0012052
1099 Ga0501084_0107983
1100 Ga0501084_0474579
1101 Ga0500661_009297
1102 Ga0501082_0017987
1103 Ga0501082_0043888
1104 Ga0501082_0088743
1105 2595451761
1106 2643894148
1107 2644476351
1108 2721026615
1109 2735833389
1110 2739229386
1111 2842919774
1112 2884341382
1113 2895396936
1114 2919087588
1115 2919404841
1116 2939614260
1117 2941472840
1118 2953995073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

42

125

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vke-assembly1.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.9568 24 119
1p8c-assembly1.cif.gz_A crystal structure of tm1620 (apc4843) from thermotoga maritima 0.9534 15 119
1p8c-assembly1.cif.gz_B crystal structure of tm1620 (apc4843) from thermotoga maritima 0.9496 8 119
1vke-assembly1.cif.gz_A crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.9457 9 120
1vke-assembly1.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.9379 24 119
ID Description Score Start End Superfamily
1vkeC00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9705 26 120 1.20.1290.10
1vkeB00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9618 26 120 1.20.1290.10
1vkeF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9568 24 119 1.20.1290.10
1p8cB00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9496 8 119 1.20.1290.10
1vkeF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9379 24 119 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A3M1PWW5-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9998 46 115 GO:0051920
AF-A0A2R7P0P1-F1-model_v4 deleted 0.9985 38 116
AF-A0A7Z1R3G8-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9965 48 115 GO:0051920
AF-A0A4Y7U3X9-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9961 49 117 GO:0051920
AF-A0A520IVB4-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9957 40 114 GO:0051920

Map