F463551

General Info

Members Datasets Scaffolds Average Seq Length
559 302 1118 299

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10052599|Ga0105238_100525994
Length 351
Sequence MVAWFQNYTPKLCCTTLLEAHKRLPLTKQKLKSGNCKLGTDILFVFPEDLALAQQKFNVGLIQMSTTPDPDKNLQRAIDKIHQASARGAHIVCLPELFQTQYFCQRQDANLFDLAEPIPSPVTNRLATLAKQLRIVLIASLFEKRAPGVYHNTAVIFDADGSLRGLYRKMHIPDDPLYYEKYYFTPGDLGYRAFDTAVGRVGTLVCWDQWYPEGARLTALQGAQILFYPTAIGWHPSEKAEFGQAQHDAWRTIQRAHAIANGVYVAVVNRVGHETGDIRGNAVAGDGLEFWGASFLCDPFGRVTAEASHDKEEVLIGEVDFRVVEDVRRNWPFLRDRRIDSYGAITNRLSD

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
134 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
195 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
196 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
252 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
255 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
269 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
275 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
276 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
277 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
278 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
279 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
280 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
281 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
282 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
283 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
284 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
285 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
286 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
287 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
288 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
289 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
290 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
291 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
292 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
293 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
294 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
295 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
296 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
297 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
298 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
299 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
300 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
301 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
302 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.1
Metatranscriptomes 0.72
Isolates 5.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0.89
Rhizoplane 3.22
Rhizosphere 88.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10052599 3300009551 Bacteria 4094
2 Ga0006562J51391_1006967 3300003578 Bacteria 972
3 Ga0065714_10004146 3300005288 Bacteria 5965
4 Ga0065714_10066564 3300005288 Bacteria 6644
5 Ga0065714_10069104 3300005288 Bacteria 4368
6 Ga0065714_10077319 3300005288 Bacteria 2701
7 Ga0065712_10116560 3300005290 Bacteria 1734
8 Ga0065715_10109837 3300005293 Bacteria 2649
9 Ga0070658_10306633 3300005327 Bacteria 1354
10 Ga0070683_100089029 3300005329 Bacteria 2897
11 Ga0070683_100142852 3300005329 Bacteria 2267
12 Ga0070683_100308101 3300005329 Bacteria 1507
13 Ga0068869_100285342 3300005334 Bacteria 1329
14 Ga0068869_100330994 3300005334 Bacteria 1237
15 Ga0070666_10092117 3300005335 Bacteria 2083
16 Ga0070680_100046697 3300005336 Bacteria 3524
17 Ga0070682_100007246 3300005337 Bacteria 6249
18 Ga0068868_100004905 3300005338 Bacteria 9396
19 Ga0068868_100179453 3300005338 Bacteria 1756
20 Ga0070660_100053497 3300005339 Bacteria 3114
21 Ga0070689_100092621 3300005340 Bacteria 2384
22 Ga0070691_10004988 3300005341 Bacteria 6038
23 Ga0070673_100247586 3300005364 Bacteria 1552
24 Ga0070659_100052298 3300005366 Bacteria 3212
25 Ga0070667_100052802 3300005367 Bacteria 3430
26 Ga0070709_10077486 3300005434 Bacteria 2161
27 Ga0070709_10114134 3300005434 Bacteria 1820
28 Ga0070709_10134806 3300005434 Bacteria 1690
29 Ga0070714_100062522 3300005435 Bacteria 3200
30 Ga0070714_100160752 3300005435 Bacteria 2032
31 Ga0070713_100000671 3300005436 Bacteria 21916
32 Ga0070713_100044503 3300005436 Bacteria 3634
33 Ga0070713_100055770 3300005436 Bacteria 3285
34 Ga0070713_100205524 3300005436 Bacteria 1780
35 Ga0070711_100005278 3300005439 Bacteria 7711
36 Ga0070711_100364363 3300005439 Bacteria 1165
37 Ga0070705_100091310 3300005440 Bacteria 1898
38 Ga0070708_100033387 3300005445 Bacteria 4471
39 Ga0070708_100065359 3300005445 Bacteria 3262
40 Ga0070708_100181214 3300005445 Bacteria 1969
41 Ga0070663_100016186 3300005455 Bacteria 4834
42 Ga0070663_100017583 3300005455 Bacteria 4670
43 Ga0070681_10016992 3300005458 Bacteria 7270
44 Ga0070681_10020317 3300005458 Bacteria 6657
45 Ga0070681_10099687 3300005458 Bacteria 2851
46 Ga0068867_100070565 3300005459 Bacteria 2612
47 Ga0070706_100010274 3300005467 Bacteria 8697
48 Ga0070706_100013873 3300005467 Bacteria 7450
49 Ga0070706_100051944 3300005467 Bacteria 3784
50 Ga0070706_100440219 3300005467 Bacteria 1213
51 Ga0070707_100030715 3300005468 Bacteria 5117
52 Ga0070707_100068123 3300005468 Bacteria 3424
53 Ga0070707_100623873 3300005468 Bacteria 1040
54 Ga0070698_100420296 3300005471 Bacteria 1271
55 Ga0070699_100014010 3300005518 Bacteria 6898
56 Ga0070699_100067938 3300005518 Bacteria 3095
57 Ga0070699_100095156 3300005518 Bacteria 2607
58 Ga0070699_100098316 3300005518 Bacteria 2564
59 Ga0070679_100054386 3300005530 Bacteria 3985
60 Ga0070684_100030327 3300005535 Bacteria 4593
61 Ga0070684_100153703 3300005535 Bacteria 2086
62 Ga0070697_100000056 3300005536 Bacteria 86619
63 Ga0070697_100003325 3300005536 Bacteria 12350
64 Ga0070697_100014354 3300005536 Bacteria 6222
65 Ga0070697_100037446 3300005536 Bacteria 3919
66 Ga0070697_100140395 3300005536 Bacteria 2032
67 Ga0070697_100366207 3300005536 Bacteria 1246
68 Ga0070695_100083942 3300005545 Bacteria 2112
69 Ga0070696_100003740 3300005546 Bacteria 10162
70 Ga0070696_100089873 3300005546 Bacteria 2184
71 Ga0070665_100000059 3300005548 Bacteria 224560
72 Ga0070665_100026102 3300005548 Bacteria 5882
73 Ga0070704_100117018 3300005549 Bacteria 2039
74 Ga0068855_100005496 3300005563 Bacteria 15463
75 Ga0070664_100102415 3300005564 Bacteria 2491
76 Ga0068857_100094948 3300005577 Bacteria 2670
77 Ga0068857_100139584 3300005577 Bacteria 2190
78 Ga0068854_100001808 3300005578 Bacteria 13009
79 Ga0068856_100021190 3300005614 Bacteria 6313
80 Ga0068856_100054304 3300005614 Bacteria 3951
81 Ga0068856_100392361 3300005614 Bacteria 1408
82 Ga0068852_100060005 3300005616 Bacteria 3300
83 Ga0068859_100207493 3300005617 Bacteria 2045
84 Ga0068864_100387604 3300005618 Bacteria 1326
85 Ga0068866_10082389 3300005718 Bacteria 1731
86 Ga0068858_100011173 3300005842 Bacteria 8489
87 Ga0068860_100032066 3300005843 Bacteria 5051
88 Ga0068860_100131493 3300005843 Bacteria 2402
89 Ga0070717_10014279 3300006028 Bacteria 6108
90 Ga0070717_10091306 3300006028 Bacteria 2571
91 Ga0075364_10198911 3300006051 Bacteria 1358
92 Ga0070716_100075269 3300006173 Bacteria 1997
93 Ga0070712_100012345 3300006175 Bacteria 5429
94 Ga0070712_100248550 3300006175 Bacteria 1420
95 Ga0097621_100033259 3300006237 Bacteria 4104
96 Ga0097621_100137625 3300006237 Bacteria 2084
97 Ga0068871_100000746 3300006358 Bacteria 22033
98 Ga0075428_100002951 3300006844 Bacteria 18545
99 Ga0075428_100092022 3300006844 Bacteria 3307
100 Ga0075428_100278158 3300006844 Bacteria 1801
101 Ga0075431_100027400 3300006847 Bacteria 5846
102 Ga0075434_100263666 3300006871 Bacteria 1742
103 Ga0075429_100339995 3300006880 Bacteria 1314
104 Ga0068865_100046255 3300006881 Bacteria 2985
105 Ga0068865_100363607 3300006881 Bacteria 1176
106 Ga0075436_100000786 3300006914 Bacteria 21067
107 Ga0075436_100021569 3300006914 Bacteria 4421
108 Ga0075436_100035931 3300006914 Bacteria 3418
109 Ga0097620_100207490 3300006931 Bacteria 2045
110 Ga0099824_1009165 3300006942 Bacteria 12295
111 Ga0079104_1000179 3300006946 Bacteria 90381
112 Ga0099826_10039471 3300006948 Bacteria 3302
113 Ga0075435_100233244 3300007076 Bacteria 1564
114 Ga0105244_10000004 3300009036 Bacteria 492478
115 Ga0105240_10002067 3300009093 Bacteria 32884
116 Ga0105240_10288550 3300009093 Bacteria 1882
117 Ga0105240_10364574 3300009093 Bacteria 1635
118 Ga0105240_10684781 3300009093 Bacteria 1121
119 Ga0105240_10859012 3300009093 Bacteria 979
120 Ga0105245_10016053 3300009098 Bacteria 6524
121 Ga0105245_10137523 3300009098 Bacteria 2297
122 Ga0105247_10112348 3300009101 Bacteria 1755
123 Ga0105247_10186241 3300009101 Bacteria 1388
124 Ga0114129_10030396 3300009147 Bacteria 7642
125 Ga0114129_10068234 3300009147 Bacteria 4958
126 Ga0114129_10359478 3300009147 Bacteria 1927
127 Ga0105241_10008113 3300009174 Bacteria 7729
128 Ga0105241_10009152 3300009174 Bacteria 7290
129 Ga0105242_10018631 3300009176 Bacteria 5430
130 Ga0105242_10072894 3300009176 Bacteria 2854
131 Ga0105242_10153815 3300009176 Bacteria 2008
132 Ga0105242_10211059 3300009176 Bacteria 1730
133 Ga0105248_10022854 3300009177 Bacteria 6943
134 Ga0105248_10074776 3300009177 Bacteria 3807
135 Ga0105248_10303248 3300009177 Bacteria 1799
136 Ga0105237_10120283 3300009545 Bacteria 2620
137 Ga0105237_10126899 3300009545 Bacteria 2545
138 Ga0105237_10401164 3300009545 Bacteria 1376
139 Ga0105238_10069401 3300009551 Bacteria 3525
140 Ga0105238_10607154 3300009551 Bacteria 1102
141 Ga0105249_10146928 3300009553 Bacteria 2266
142 Ga0105239_10132220 3300010375 Bacteria 2776
143 Ga0105239_10569768 3300010375 Bacteria 1290
144 Ga0105246_10163332 3300011119 Bacteria 1699
145 Ga0105246_10229509 3300011119 Bacteria 1461
146 Ga0157373_10000002 3300013100 Bacteria 750094
147 Ga0157371_10008727 3300013102 Bacteria 8045
148 Ga0157370_10001033 3300013104 Bacteria 35017
149 Ga0157370_10003309 3300013104 Bacteria 19002
150 Ga0157370_10012803 3300013104 Bacteria 8672
151 Ga0157370_10013108 3300013104 Bacteria 8555
152 Ga0157370_10026706 3300013104 Bacteria 5697
153 Ga0157370_10275536 3300013104 Bacteria 1554
154 Ga0157370_10311689 3300013104 Bacteria 1452
155 Ga0157369_10075607 3300013105 Bacteria 3610
156 Ga0157369_10214531 3300013105 Bacteria 2016
157 Ga0157369_10349089 3300013105 Bacteria 1537
158 Ga0157374_10027875 3300013296 Bacteria 5099
159 Ga0157374_10038456 3300013296 Bacteria 4398
160 Ga0157374_10203970 3300013296 Bacteria 1937
161 Ga0157378_10001165 3300013297 Bacteria 23923
162 Ga0157378_10002118 3300013297 Bacteria 17654
163 Ga0157378_10195401 3300013297 Bacteria 1911
164 Ga0157378_10349689 3300013297 Bacteria 1444
165 Ga0163162_10004350 3300013306 Bacteria 13633
166 Ga0163162_10052708 3300013306 Bacteria 4086
167 Ga0163162_10189777 3300013306 Bacteria 2182
168 Ga0163162_10200284 3300013306 Bacteria 2125
169 Ga0157372_10023921 3300013307 Bacteria 6628
170 Ga0157372_10037501 3300013307 Bacteria 5348
171 Ga0157372_10038635 3300013307 Bacteria 5267
172 Ga0157372_10055773 3300013307 Bacteria 4413
173 Ga0157372_10104628 3300013307 Bacteria 3236
174 Ga0157372_10195713 3300013307 Bacteria 2342
175 Ga0157372_10370739 3300013307 Bacteria 1668
176 Ga0157375_10282395 3300013308 Bacteria 1823
177 Ga0157375_10672267 3300013308 Bacteria 1190
178 Ga0163163_10013381 3300014325 Bacteria 7511
179 Ga0163163_10052875 3300014325 Bacteria 4008
180 Ga0163163_10058448 3300014325 Bacteria 3813
181 Ga0157380_10035500 3300014326 Bacteria 3852
182 Ga0157380_10160624 3300014326 Bacteria 1953
183 Ga0157379_10002234 3300014968 Bacteria 16113
184 Ga0157379_10008944 3300014968 Bacteria 8728
185 Ga0157376_10025610 3300014969 Bacteria 4649
186 Ga0157376_10091405 3300014969 Bacteria 2636
187 Ga0182006_1017349 3300015261 Bacteria 3060
188 Ga0163161_10000007 3300017792 Bacteria 301614
189 Ga0213875_10000103 3300021388 Bacteria 96738
190 Ga0213875_10007340 3300021388 Bacteria 5700
191 Ga0213875_10045127 3300021388 Bacteria 2069
192 Ga0224712_10139236 3300022467 Bacteria 1066
193 Ga0228598_1003984 3300024227 Bacteria 3144
194 Ga0207656_10082372 3300025321 Bacteria 1448
195 Ga0207655_1000008 3300025728 Bacteria 734289
196 Ga0207642_10028907 3300025899 Bacteria 2289
197 Ga0207710_10062168 3300025900 Bacteria 1696
198 Ga0207699_10025061 3300025906 Bacteria 3271
199 Ga0207699_10042227 3300025906 Bacteria 2640
200 Ga0207645_10012241 3300025907 Bacteria 5826
201 Ga0207705_10014739 3300025909 Bacteria 5620
202 Ga0207684_10017495 3300025910 Bacteria 6149
203 Ga0207684_10076720 3300025910 Bacteria 2841
204 Ga0207654_10034275 3300025911 Bacteria 2820
205 Ga0207654_10047212 3300025911 Bacteria 2460
206 Ga0207695_10005671 3300025913 Bacteria 16476
207 Ga0207695_10007205 3300025913 Bacteria 14226
208 Ga0207695_10010371 3300025913 Bacteria 11404
209 Ga0207695_10081279 3300025913 Bacteria 3280
210 Ga0207695_10501107 3300025913 Bacteria 1096
211 Ga0207671_10038421 3300025914 Bacteria 3548
212 Ga0207657_10009793 3300025919 Bacteria 9608
213 Ga0207657_10041434 3300025919 Bacteria 4072
214 Ga0207646_10000016 3300025922 Bacteria 337048
215 Ga0207646_10068113 3300025922 Bacteria 3179
216 Ga0207646_10209126 3300025922 Bacteria 1762
217 Ga0207694_10002979 3300025924 Bacteria 13589
218 Ga0207694_10058190 3300025924 Bacteria 3006
219 Ga0207694_10097675 3300025924 Bacteria 2324
220 Ga0207687_10002547 3300025927 Bacteria 12373
221 Ga0207687_10109316 3300025927 Bacteria 2048
222 Ga0207700_10001522 3300025928 Bacteria 13124
223 Ga0207700_10007378 3300025928 Bacteria 6717
224 Ga0207700_10119628 3300025928 Bacteria 2133
225 Ga0207700_10272033 3300025928 Bacteria 1454
226 Ga0207700_10351261 3300025928 Bacteria 1284
227 Ga0207664_10010105 3300025929 Bacteria 6654
228 Ga0207664_10066868 3300025929 Bacteria 2882
229 Ga0207706_10000075 3300025933 Bacteria 102980
230 Ga0207686_10016208 3300025934 Bacteria 4178
231 Ga0207686_10048624 3300025934 Bacteria 2628
232 Ga0207686_10085014 3300025934 Bacteria 2074
233 Ga0207670_10083325 3300025936 Bacteria 2243
234 Ga0207704_10019331 3300025938 Bacteria 3575
235 Ga0207704_10141428 3300025938 Bacteria 1684
236 Ga0207704_10247698 3300025938 Bacteria 1335
237 Ga0207711_10147898 3300025941 Bacteria 2118
238 Ga0207689_10042747 3300025942 Bacteria 3747
239 Ga0207689_10071125 3300025942 Bacteria 2857
240 Ga0207689_10090770 3300025942 Bacteria 2510
241 Ga0207661_10064568 3300025944 Bacteria 2968
242 Ga0207661_10426764 3300025944 Bacteria 1205
243 Ga0207667_10001499 3300025949 Bacteria 29319
244 Ga0207667_10007732 3300025949 Bacteria 12851
245 Ga0207667_10046952 3300025949 Bacteria 4572
246 Ga0207712_10043421 3300025961 Bacteria 3101
247 Ga0207668_10004334 3300025972 Bacteria 8331
248 Ga0207640_10012867 3300025981 Bacteria 4780
249 Ga0207703_10147289 3300026035 Bacteria 2049
250 Ga0207678_10000103 3300026067 Bacteria 69649
251 Ga0207678_10026135 3300026067 Bacteria 5094
252 Ga0207708_10079088 3300026075 Bacteria 2525
253 Ga0207641_10027453 3300026088 Bacteria 4701
254 Ga0207641_10244565 3300026088 Bacteria 1673
255 Ga0207648_10006119 3300026089 Bacteria 11996
256 Ga0207648_10009044 3300026089 Bacteria 9581
257 Ga0207674_10009982 3300026116 Bacteria 10806
258 Ga0207674_10101224 3300026116 Bacteria 2862
259 Ga0207674_10137495 3300026116 Bacteria 2404
260 Ga0207674_10711082 3300026116 Bacteria 970
261 Ga0207675_100010887 3300026118 Bacteria 8520
262 Ga0207675_100017027 3300026118 Bacteria 6792
263 Ga0207683_10069806 3300026121 Bacteria 3103
264 Ga0207683_10111174 3300026121 Bacteria 2453
265 Ga0207683_10340208 3300026121 Bacteria 1376
266 Ga0209281_1000116 3300027111 Bacteria 209707
267 Ga0209282_1032878 3300027666 Bacteria 3166
268 Ga0268266_10124559 3300028379 Bacteria 2298
269 Ga0268266_10192144 3300028379 Bacteria 1864
270 Ga0268266_10247871 3300028379 Bacteria 1647
271 Ga0268264_10100482 3300028381 Bacteria 2512
272 Ga0268264_10117162 3300028381 Bacteria 2342
273 Ga0265337_1039542 3300028556 Bacteria 1363
274 Ga0265326_10010989 3300028558 Bacteria 2678
275 Ga0265334_10006298 3300028573 Bacteria 5124
276 Ga0265334_10057252 3300028573 Bacteria 1478
277 Ga0265318_10000224 3300028577 Bacteria 48801
278 Ga0265318_10008554 3300028577 Bacteria 4548
279 Ga0265323_10002895 3300028653 Bacteria 7698
280 Ga0265323_10016687 3300028653 Bacteria 2861
281 Ga0265323_10048631 3300028653 Bacteria 1512
282 Ga0265336_10013437 3300028666 Bacteria 2730
283 Ga0307515_10135185 3300028794 Bacteria 2686
284 Ga0265338_10000016 3300028800 Bacteria 347424
285 Ga0265338_10002506 3300028800 Bacteria 27353
286 Ga0265338_10008201 3300028800 Bacteria 12730
287 Ga0265338_10076627 3300028800 Bacteria 2831
288 Ga0265338_10187940 3300028800 Bacteria 1568
289 Ga0265324_10000022 3300029957 Bacteria 167667
290 Ga0265324_10000063 3300029957 Bacteria 91952
291 Ga0265324_10008096 3300029957 Bacteria 4209
292 Ga0265324_10014546 3300029957 Bacteria 2910
293 Ga0265760_10002015 3300031090 Archaea 5976
294 Ga0265330_10000849 3300031235 Bacteria 19161
295 Ga0265330_10002397 3300031235 Bacteria 10239
296 Ga0265330_10002939 3300031235 Bacteria 9072
297 Ga0265330_10004876 3300031235 Bacteria 6761
298 Ga0265330_10015239 3300031235 Bacteria 3557
299 Ga0265330_10024850 3300031235 Bacteria 2716
300 Ga0265332_10000044 3300031238 Bacteria 114444
301 Ga0265332_10000686 3300031238 Bacteria 21713
302 Ga0265328_10008323 3300031239 Bacteria 4284
303 Ga0265328_10010390 3300031239 Bacteria 3750
304 Ga0265320_10004323 3300031240 Bacteria 9328
305 Ga0265320_10005189 3300031240 Bacteria 8403
306 Ga0265320_10118840 3300031240 Bacteria 1207
307 Ga0265325_10001540 3300031241 Bacteria 16132
308 Ga0265329_10000251 3300031242 Bacteria 28670
309 Ga0265329_10003082 3300031242 Bacteria 7380
310 Ga0265329_10005817 3300031242 Bacteria 4949
311 Ga0265340_10000916 3300031247 Bacteria 16739
312 Ga0265340_10017650 3300031247 Bacteria 3691
313 Ga0265340_10048214 3300031247 Bacteria 2072
314 Ga0265339_10000010 3300031249 Bacteria 214721
315 Ga0265339_10015894 3300031249 Bacteria 4500
316 Ga0265339_10031038 3300031249 Bacteria 3022
317 Ga0265331_10000076 3300031250 Bacteria 145884
318 Ga0265331_10046058 3300031250 Bacteria 2103
319 Ga0265316_10000006 3300031344 Bacteria 289686
320 Ga0265316_10000054 3300031344 Bacteria 124687
321 Ga0265316_10002763 3300031344 Bacteria 17979
322 Ga0265316_10004322 3300031344 Bacteria 14176
323 Ga0265316_10022719 3300031344 Bacteria 5281
324 Ga0265316_10027939 3300031344 Bacteria 4661
325 Ga0265316_10035082 3300031344 Bacteria 4069
326 Ga0265316_10080641 3300031344 Bacteria 2495
327 Ga0265316_10296707 3300031344 Bacteria 1178
328 Ga0307509_10123494 3300031507 Bacteria 2561
329 Ga0307408_100002894 3300031548 Bacteria 11896
330 Ga0265313_10003719 3300031595 Bacteria 12147
331 Ga0265313_10028980 3300031595 Bacteria 2869
332 Ga0265314_10000017 3300031711 Bacteria 340498
333 Ga0265314_10000056 3300031711 Bacteria 171647
334 Ga0265314_10003050 3300031711 Bacteria 16520
335 Ga0265314_10004948 3300031711 Bacteria 12160
336 Ga0265314_10103444 3300031711 Bacteria 1825
337 Ga0265314_10138984 3300031711 Bacteria 1504
338 Ga0265314_10207558 3300031711 Bacteria 1153
339 Ga0265342_10000128 3300031712 Bacteria 84420
340 Ga0265342_10000368 3300031712 Bacteria 49570
341 Ga0265342_10012423 3300031712 Bacteria 5769
342 Ga0265342_10026968 3300031712 Bacteria 3597
343 Ga0265342_10058307 3300031712 Bacteria 2282
344 Ga0265342_10141794 3300031712 Bacteria 1340
345 Ga0316576_10130815 3300031727 Bacteria 1888
346 Ga0307413_10003912 3300031824 Bacteria 6375
347 Ga0307410_10000115 3300031852 Bacteria 28127
348 Ga0307410_10004592 3300031852 Bacteria 7166
349 Ga0307406_10000111 3300031901 Bacteria 46791
350 Ga0307407_10008551 3300031903 Bacteria 4708
351 Ga0307407_10126718 3300031903 Bacteria 1627
352 Ga0307414_10000001 3300032004 Bacteria 1352954
353 Ga0307414_10121444 3300032004 Bacteria 2009
354 Ga0307414_10282008 3300032004 Bacteria 1396
355 Ga0307411_10000013 3300032005 Bacteria 145335
356 Ga0307411_10002284 3300032005 Bacteria 8393
357 Ga0307411_10214715 3300032005 Bacteria 1488
358 Ga0373959_0006217 3300034820 Bacteria 1976
359 Ga0373926_0003601 3300035083 Bacteria 5025
360 Ga0373926_0009181 3300035083 Bacteria 3300
361 Ga0373926_0014350 3300035083 Bacteria 2693
362 Ga0373926_0019795 3300035083 Bacteria 2322
363 Ga0373929_0006477 3300035085 Bacteria 2117
364 Ga0373923_0022455 3300035111 Bacteria 2475
365 Ga0373923_0161770 3300035111 Bacteria 1021
366 Ga0373932_0046409 3300035112 Bacteria 1274
367 Ga0373936_0000679 3300035113 Bacteria 11833
368 Ga0373936_0063037 3300035113 Bacteria 1517
369 Ga0373953_0041548 3300035117 Bacteria 1830
370 Ga0373956_0003328 3300035119 Bacteria 6473
371 Ga0373956_0054175 3300035119 Bacteria 1807
372 Ga0373943_0184738 3300035170 Bacteria 1147
373 Ga0373955_0002990 3300035172 Bacteria 7405
374 Ga0373942_0014620 3300035207 Bacteria 1903
375 Ga0373924_0013101 3300035410 Bacteria 3111
376 Ga0373931_0029780 3300035691 Bacteria 2806
377 Ga0373935_0056029 3300035692 Bacteria 2512
378 Ga0373935_0117773 3300035692 Bacteria 1771
379 Ga0373927_0004452 3300035695 Bacteria 9815
380 Ga0373927_0004743 3300035695 Bacteria 9472
381 Ga0373927_0009837 3300035695 Bacteria 6409
382 Ga0373933_0095011 3300035724 Bacteria 1844
383 Ga0373933_0116569 3300035724 Bacteria 1670
384 Ga0373947_0044626 3300035725 Bacteria 2650
385 Ga0373937_0046658 3300036401 Bacteria 3962
386 Ga0373937_0326650 3300036401 Bacteria 1452
387 Ga0373925_0061915 3300037068 Bacteria 2812
388 Ga0373925_0298449 3300037068 Bacteria 1300
389 Ga0395898_0137759 3300037466 Bacteria 2337
390 Ga0395905_0263386 3300037471 Bacteria 1609
391 Ga0436364_0658052 3300037853 Bacteria 2452
392 Ga0436364_0822356 3300037853 Bacteria 1276
393 Ga0436364_1188517 3300037853 Bacteria 3709
394 Ga0436364_1306996 3300037853 Bacteria 3732
395 Ga0436365_0073490 3300039437 Bacteria 1206
396 Ga0436365_0998318 3300039437 Bacteria 1350
397 Ga0436360_0490098 3300039438 Bacteria 1674
398 Ga0436362_0306584 3300039453 Bacteria 2306
399 Ga0436362_0442697 3300039453 Bacteria 3279
400 Ga0436362_1032274 3300039453 Bacteria 4257
401 Ga0439447_002257 3300041407 Bacteria 7068
402 Ga0439466_0002554 3300041411 Bacteria 7128
403 Ga0451837_0054513 3300041494 Bacteria 2187
404 Ga0439446_0005985 3300042156 Bacteria 3151
405 Ga0439435_0021925 3300042436 Bacteria 1663
406 Ga0451577_0000173 3300042876 Bacteria 142333
407 Ga0451577_0000531 3300042876 Bacteria 63238
408 Ga0451577_0003545 3300042876 Bacteria 17247
409 Ga0451577_0004786 3300042876 Bacteria 14151
410 Ga0451577_0030222 3300042876 Bacteria 4895
411 Ga0451577_0041603 3300042876 Bacteria 4124
412 Ga0451577_0089705 3300042876 Bacteria 2743
413 Ga0451577_0098319 3300042876 Bacteria 2614
414 Ga0451577_0166528 3300042876 Bacteria 1986
415 Ga0451577_0374375 3300042876 Bacteria 1292
416 Ga0453683_0000548 3300044673 Bacteria 41756
417 Ga0453683_0013874 3300044673 Bacteria 5241
418 Ga0453683_0042311 3300044673 Bacteria 2860
419 Ga0466963_0000193 3300044694 Bacteria 25611
420 Ga0453684_0000324 3300044712 Bacteria 201431
421 Ga0453684_0000968 3300044712 Bacteria 94634
422 Ga0453684_0001343 3300044712 Bacteria 72090
423 Ga0453684_0001454 3300044712 Bacteria 67293
424 Ga0453684_0019540 3300044712 Bacteria 10302
425 Ga0453684_0049970 3300044712 Bacteria 5506
426 Ga0453684_0470204 3300044712 Bacteria 1396
427 Ga0466959_0135539 3300045049 Bacteria 1743
428 Ga0451576_0000613 3300045051 Bacteria 74967
429 Ga0451576_0005720 3300045051 Bacteria 15490
430 Ga0451576_0147833 3300045051 Bacteria 2450
431 Ga0466967_0001058 3300045976 Bacteria 15165
432 Ga0466967_0098432 3300045976 Bacteria 2671
433 Ga0466967_0652805 3300045976 Bacteria 1040
434 Ga0495580_0006268 3300046472 Bacteria 9724
435 Ga0495580_0026885 3300046472 Bacteria 4191
436 Ga0495580_0029553 3300046472 Bacteria 3976
437 Ga0495580_0039807 3300046472 Bacteria 3363
438 Ga0495580_0112870 3300046472 Bacteria 1887
439 Ga0495580_0317473 3300046472 Bacteria 1059
440 Ga0495582_0000591 3300046473 Bacteria 20062
441 Ga0495582_0014082 3300046473 Bacteria 4401
442 Ga0495608_0036263 3300046511 Bacteria 3320
443 Ga0495630_0248695 3300046517 Bacteria 1358
444 Ga0495665_0001144 3300046531 Bacteria 14085
445 Ga0495586_0014687 3300046535 Bacteria 4162
446 Ga0495633_0142313 3300046558 Bacteria 1109
447 Ga0495623_0027200 3300046679 Bacteria 3678
448 Ga0495646_0003801 3300046680 Bacteria 9441
449 Ga0495658_0084803 3300046683 Bacteria 1866
450 Ga0495613_0160644 3300046689 Bacteria 1599
451 Ga0495624_0006840 3300046690 Bacteria 8048
452 Ga0495581_0106821 3300047315 Bacteria 1627
453 Ga0495674_0007702 3300047319 Bacteria 10289
454 Ga0495674_0055000 3300047319 Bacteria 3492
455 Ga0495674_0159009 3300047319 Bacteria 1891
456 Ga0495675_0019902 3300047444 Bacteria 4264
457 Ga0495675_0198504 3300047444 Bacteria 1222
458 Ga0495684_0027401 3300047471 Bacteria 4375
459 Ga0495684_0058713 3300047471 Bacteria 2930
460 Ga0495593_0009089 3300047673 Bacteria 5766
461 Ga0496100_0100742 3300048903 Bacteria 1990
462 Ga0496102_0002570 3300048905 Bacteria 15469
463 Ga0496102_0116928 3300048905 Bacteria 2488
464 Ga0496102_0567567 3300048905 Bacteria 1057
465 Ga0496103_0016516 3300048906 Bacteria 4405
466 Ga0496103_0085927 3300048906 Bacteria 1982
467 Ga0496104_0026550 3300048907 Bacteria 5350
468 Ga0496104_0146919 3300048907 Bacteria 2264
469 Ga0496104_0245552 3300048907 Bacteria 1703
470 Ga0496104_0266991 3300048907 Bacteria 1624
471 Ga0496107_0092997 3300048910 Bacteria 2205
472 Ga0496109_0212553 3300048912 Bacteria 1819
473 Ga0496109_0381514 3300048912 Bacteria 1331
474 Ga0496112_0035758 3300048915 Bacteria 4841
475 Ga0496112_0141920 3300048915 Bacteria 2371
476 Ga0496112_0182016 3300048915 Bacteria 2065
477 Ga0496113_0222835 3300048916 Bacteria 1503
478 Ga0496115_0316274 3300048918 Bacteria 1278
479 Ga0496116_0000047 3300048919 Bacteria 315121
480 Ga0496118_0075921 3300048921 Bacteria 2393
481 Ga0496121_0009482 3300048924 Bacteria 11176
482 Ga0496124_0024755 3300048927 Bacteria 5450
483 Ga0496124_0152485 3300048927 Bacteria 1811
484 Ga0496125_0000050 3300048928 Bacteria 286703
485 Ga0496126_0005294 3300048929 Bacteria 14809
486 Ga0501323_013347 3300049539 Bacteria 1015
487 Ga0501031_0075344 3300049568 Bacteria 2197
488 Ga0501034_0022373 3300049571 Bacteria 6443
489 Ga0501039_0122677 3300049575 Bacteria 2037
490 Ga0501041_0105516 3300049577 Bacteria 1746
491 Ga0501042_0081683 3300049578 Bacteria 2316
492 Ga0501046_0000028 3300049580 Bacteria 194675
493 Ga0501047_0100734 3300049581 Bacteria 2768
494 Ga0501048_0070562 3300049582 Bacteria 2467
495 Ga0501048_0211690 3300049582 Bacteria 1375
496 Ga0501071_0058745 3300049587 Bacteria 2781
497 Ga0501073_0041528 3300049589 Bacteria 3250
498 Ga0501075_0041214 3300049591 Bacteria 3460
499 Ga0501077_0011246 3300049593 Bacteria 5585
500 Ga0501249_000033 3300049679 Bacteria 73096
501 Ga0501249_001379 3300049679 Bacteria 5013
502 Ga0501257_039613 3300049686 Bacteria 1154
503 Ga0501080_0111597 3300049742 Bacteria 2535
504 Ga0501266_000005 3300049763 Bacteria 346750
505 Ga0501269_012482 3300049766 Bacteria 1037
506 Ga0501035_0071779 3300049822 Bacteria 3065
507 Ga0501035_0248099 3300049822 Bacteria 1513
508 Ga0501044_0004275 3300049823 Bacteria 16022
509 Ga0501044_0045900 3300049823 Bacteria 4525
510 Ga0501045_0108415 3300049824 Bacteria 2058
511 nmdc:mga00v17_290599_c1 3300050491 Bacteria 1061
512 nmdc:mga05p37_35920_c1 3300050507 Bacteria 6081
513 nmdc:mga09592_329509_c1 3300050508 Bacteria 1322
514 nmdc:mga0qj67_8316_c1 3300050509 Bacteria 7690
515 nmdc:mga06r32_15116_c1 3300050510 Bacteria 7009
516 nmdc:mga0n895_127273_c1 3300050512 Bacteria 2571
517 nmdc:mga0n895_166621_c1 3300050512 Bacteria 2235
518 nmdc:mga0rr50_216449_c1 3300050513 Bacteria 1580
519 nmdc:mga0rr50_314450_c1 3300050513 Bacteria 1312
520 nmdc:mga08x19_10402_c1 3300050514 Bacteria 5585
521 nmdc:mga08x19_17930_c1 3300050514 Bacteria 4335
522 nmdc:mga08x19_555_c2 3300050514 Bacteria 19623
523 Ga0495619_0055744 3300053085 Bacteria 2619
524 Ga0500646_0003732 3300053090 Bacteria 3901
525 Ga0500641_0000027 3300053096 Bacteria 106908
526 Ga0500641_0002278 3300053096 Bacteria 6808
527 Ga0500658_0000021 3300053134 Bacteria 133042
528 Ga0500559_0052890 3300053136 Bacteria 1796
529 Ga0501084_0140321 3300054114 Bacteria 2035
530 Ga0501082_0134860 3300060353 Bacteria 2142
531 2513236411 2513020052 Bacteria 5120511
532 2520878842 2519899754 Bacteria 5336938
533 2644011445 2643221600 Bacteria 5530138
534 2644369848 2643221667 Bacteria 5627472
535 2644642308 2643221716 Bacteria 4986332
536 2644685238 2643221725 Bacteria 5087956
537 2738731963 2738541279 Bacteria 6149495
538 2738764528 2738541285 Bacteria 6150075
539 2739213543 2738543007 Bacteria 6149845
540 2740000812 2739367857 Bacteria 5433684
541 2740005628 2739367858 Bacteria 5432813
542 2802654152 2802428842 Bacteria 4926114
543 2817415821 2816332280 Bacteria 5109718
544 2833643088 2833640130 Bacteria 4858325
545 2857614558 2857613821 Bacteria 4917088
546 2857619060 2857618242 Bacteria 5635925
547 2881360466 2881359912 Bacteria 4935907
548 2903898609 2903895155 Bacteria 5258610
549 2904419845 2904419702 Bacteria 5166287
550 2904556633 2904555929 Bacteria 5218588
551 2919194038 2919191525 Bacteria 5765973
552 2919687800 2919683626 Bacteria 5534354
553 2929153061 2929150217 Bacteria 5462483
554 2958460881 2958458903 Bacteria 5301041
555 2977269732 2977268062 Bacteria 5243061
556 8054308205 8054307821 Bacteria 5212224
557 8055421499 8055419101 Bacteria 5289643
558 8055594027 8055592153 Bacteria 5961247
559 8056442923 8056440228 Bacteria 4946504
560 Ga0105238_10052599
561 Ga0006562J51391_1006967
562 Ga0065714_10004146
563 Ga0065714_10066564
564 Ga0065714_10069104
565 Ga0065714_10077319
566 Ga0065712_10116560
567 Ga0065715_10109837
568 Ga0070658_10306633
569 Ga0070683_100089029
570 Ga0070683_100142852
571 Ga0070683_100308101
572 Ga0068869_100285342
573 Ga0068869_100330994
574 Ga0070666_10092117
575 Ga0070680_100046697
576 Ga0070682_100007246
577 Ga0068868_100004905
578 Ga0068868_100179453
579 Ga0070660_100053497
580 Ga0070689_100092621
581 Ga0070691_10004988
582 Ga0070673_100247586
583 Ga0070659_100052298
584 Ga0070667_100052802
585 Ga0070709_10077486
586 Ga0070709_10114134
587 Ga0070709_10134806
588 Ga0070714_100062522
589 Ga0070714_100160752
590 Ga0070713_100000671
591 Ga0070713_100044503
592 Ga0070713_100055770
593 Ga0070713_100205524
594 Ga0070711_100005278
595 Ga0070711_100364363
596 Ga0070705_100091310
597 Ga0070708_100033387
598 Ga0070708_100065359
599 Ga0070708_100181214
600 Ga0070663_100016186
601 Ga0070663_100017583
602 Ga0070681_10016992
603 Ga0070681_10020317
604 Ga0070681_10099687
605 Ga0068867_100070565
606 Ga0070706_100010274
607 Ga0070706_100013873
608 Ga0070706_100051944
609 Ga0070706_100440219
610 Ga0070707_100030715
611 Ga0070707_100068123
612 Ga0070707_100623873
613 Ga0070698_100420296
614 Ga0070699_100014010
615 Ga0070699_100067938
616 Ga0070699_100095156
617 Ga0070699_100098316
618 Ga0070679_100054386
619 Ga0070684_100030327
620 Ga0070684_100153703
621 Ga0070697_100000056
622 Ga0070697_100003325
623 Ga0070697_100014354
624 Ga0070697_100037446
625 Ga0070697_100140395
626 Ga0070697_100366207
627 Ga0070695_100083942
628 Ga0070696_100003740
629 Ga0070696_100089873
630 Ga0070665_100000059
631 Ga0070665_100026102
632 Ga0070704_100117018
633 Ga0068855_100005496
634 Ga0070664_100102415
635 Ga0068857_100094948
636 Ga0068857_100139584
637 Ga0068854_100001808
638 Ga0068856_100021190
639 Ga0068856_100054304
640 Ga0068856_100392361
641 Ga0068852_100060005
642 Ga0068859_100207493
643 Ga0068864_100387604
644 Ga0068866_10082389
645 Ga0068858_100011173
646 Ga0068860_100032066
647 Ga0068860_100131493
648 Ga0070717_10014279
649 Ga0070717_10091306
650 Ga0075364_10198911
651 Ga0070716_100075269
652 Ga0070712_100012345
653 Ga0070712_100248550
654 Ga0097621_100033259
655 Ga0097621_100137625
656 Ga0068871_100000746
657 Ga0075428_100002951
658 Ga0075428_100092022
659 Ga0075428_100278158
660 Ga0075431_100027400
661 Ga0075434_100263666
662 Ga0075429_100339995
663 Ga0068865_100046255
664 Ga0068865_100363607
665 Ga0075436_100000786
666 Ga0075436_100021569
667 Ga0075436_100035931
668 Ga0097620_100207490
669 Ga0099824_1009165
670 Ga0079104_1000179
671 Ga0099826_10039471
672 Ga0075435_100233244
673 Ga0105244_10000004
674 Ga0105240_10002067
675 Ga0105240_10288550
676 Ga0105240_10364574
677 Ga0105240_10684781
678 Ga0105240_10859012
679 Ga0105245_10016053
680 Ga0105245_10137523
681 Ga0105247_10112348
682 Ga0105247_10186241
683 Ga0114129_10030396
684 Ga0114129_10068234
685 Ga0114129_10359478
686 Ga0105241_10008113
687 Ga0105241_10009152
688 Ga0105242_10018631
689 Ga0105242_10072894
690 Ga0105242_10153815
691 Ga0105242_10211059
692 Ga0105248_10022854
693 Ga0105248_10074776
694 Ga0105248_10303248
695 Ga0105237_10120283
696 Ga0105237_10126899
697 Ga0105237_10401164
698 Ga0105238_10069401
699 Ga0105238_10607154
700 Ga0105249_10146928
701 Ga0105239_10132220
702 Ga0105239_10569768
703 Ga0105246_10163332
704 Ga0105246_10229509
705 Ga0157373_10000002
706 Ga0157371_10008727
707 Ga0157370_10001033
708 Ga0157370_10003309
709 Ga0157370_10012803
710 Ga0157370_10013108
711 Ga0157370_10026706
712 Ga0157370_10275536
713 Ga0157370_10311689
714 Ga0157369_10075607
715 Ga0157369_10214531
716 Ga0157369_10349089
717 Ga0157374_10027875
718 Ga0157374_10038456
719 Ga0157374_10203970
720 Ga0157378_10001165
721 Ga0157378_10002118
722 Ga0157378_10195401
723 Ga0157378_10349689
724 Ga0163162_10004350
725 Ga0163162_10052708
726 Ga0163162_10189777
727 Ga0163162_10200284
728 Ga0157372_10023921
729 Ga0157372_10037501
730 Ga0157372_10038635
731 Ga0157372_10055773
732 Ga0157372_10104628
733 Ga0157372_10195713
734 Ga0157372_10370739
735 Ga0157375_10282395
736 Ga0157375_10672267
737 Ga0163163_10013381
738 Ga0163163_10052875
739 Ga0163163_10058448
740 Ga0157380_10035500
741 Ga0157380_10160624
742 Ga0157379_10002234
743 Ga0157379_10008944
744 Ga0157376_10025610
745 Ga0157376_10091405
746 Ga0182006_1017349
747 Ga0163161_10000007
748 Ga0213875_10000103
749 Ga0213875_10007340
750 Ga0213875_10045127
751 Ga0224712_10139236
752 Ga0228598_1003984
753 Ga0207656_10082372
754 Ga0207655_1000008
755 Ga0207642_10028907
756 Ga0207710_10062168
757 Ga0207699_10025061
758 Ga0207699_10042227
759 Ga0207645_10012241
760 Ga0207705_10014739
761 Ga0207684_10017495
762 Ga0207684_10076720
763 Ga0207654_10034275
764 Ga0207654_10047212
765 Ga0207695_10005671
766 Ga0207695_10007205
767 Ga0207695_10010371
768 Ga0207695_10081279
769 Ga0207695_10501107
770 Ga0207671_10038421
771 Ga0207657_10009793
772 Ga0207657_10041434
773 Ga0207646_10000016
774 Ga0207646_10068113
775 Ga0207646_10209126
776 Ga0207694_10002979
777 Ga0207694_10058190
778 Ga0207694_10097675
779 Ga0207687_10002547
780 Ga0207687_10109316
781 Ga0207700_10001522
782 Ga0207700_10007378
783 Ga0207700_10119628
784 Ga0207700_10272033
785 Ga0207700_10351261
786 Ga0207664_10010105
787 Ga0207664_10066868
788 Ga0207706_10000075
789 Ga0207686_10016208
790 Ga0207686_10048624
791 Ga0207686_10085014
792 Ga0207670_10083325
793 Ga0207704_10019331
794 Ga0207704_10141428
795 Ga0207704_10247698
796 Ga0207711_10147898
797 Ga0207689_10042747
798 Ga0207689_10071125
799 Ga0207689_10090770
800 Ga0207661_10064568
801 Ga0207661_10426764
802 Ga0207667_10001499
803 Ga0207667_10007732
804 Ga0207667_10046952
805 Ga0207712_10043421
806 Ga0207668_10004334
807 Ga0207640_10012867
808 Ga0207703_10147289
809 Ga0207678_10000103
810 Ga0207678_10026135
811 Ga0207708_10079088
812 Ga0207641_10027453
813 Ga0207641_10244565
814 Ga0207648_10006119
815 Ga0207648_10009044
816 Ga0207674_10009982
817 Ga0207674_10101224
818 Ga0207674_10137495
819 Ga0207674_10711082
820 Ga0207675_100010887
821 Ga0207675_100017027
822 Ga0207683_10069806
823 Ga0207683_10111174
824 Ga0207683_10340208
825 Ga0209281_1000116
826 Ga0209282_1032878
827 Ga0268266_10124559
828 Ga0268266_10192144
829 Ga0268266_10247871
830 Ga0268264_10100482
831 Ga0268264_10117162
832 Ga0265337_1039542
833 Ga0265326_10010989
834 Ga0265334_10006298
835 Ga0265334_10057252
836 Ga0265318_10000224
837 Ga0265318_10008554
838 Ga0265323_10002895
839 Ga0265323_10016687
840 Ga0265323_10048631
841 Ga0265336_10013437
842 Ga0307515_10135185
843 Ga0265338_10000016
844 Ga0265338_10002506
845 Ga0265338_10008201
846 Ga0265338_10076627
847 Ga0265338_10187940
848 Ga0265324_10000022
849 Ga0265324_10000063
850 Ga0265324_10008096
851 Ga0265324_10014546
852 Ga0265760_10002015
853 Ga0265330_10000849
854 Ga0265330_10002397
855 Ga0265330_10002939
856 Ga0265330_10004876
857 Ga0265330_10015239
858 Ga0265330_10024850
859 Ga0265332_10000044
860 Ga0265332_10000686
861 Ga0265328_10008323
862 Ga0265328_10010390
863 Ga0265320_10004323
864 Ga0265320_10005189
865 Ga0265320_10118840
866 Ga0265325_10001540
867 Ga0265329_10000251
868 Ga0265329_10003082
869 Ga0265329_10005817
870 Ga0265340_10000916
871 Ga0265340_10017650
872 Ga0265340_10048214
873 Ga0265339_10000010
874 Ga0265339_10015894
875 Ga0265339_10031038
876 Ga0265331_10000076
877 Ga0265331_10046058
878 Ga0265316_10000006
879 Ga0265316_10000054
880 Ga0265316_10002763
881 Ga0265316_10004322
882 Ga0265316_10022719
883 Ga0265316_10027939
884 Ga0265316_10035082
885 Ga0265316_10080641
886 Ga0265316_10296707
887 Ga0307509_10123494
888 Ga0307408_100002894
889 Ga0265313_10003719
890 Ga0265313_10028980
891 Ga0265314_10000017
892 Ga0265314_10000056
893 Ga0265314_10003050
894 Ga0265314_10004948
895 Ga0265314_10103444
896 Ga0265314_10138984
897 Ga0265314_10207558
898 Ga0265342_10000128
899 Ga0265342_10000368
900 Ga0265342_10012423
901 Ga0265342_10026968
902 Ga0265342_10058307
903 Ga0265342_10141794
904 Ga0316576_10130815
905 Ga0307413_10003912
906 Ga0307410_10000115
907 Ga0307410_10004592
908 Ga0307406_10000111
909 Ga0307407_10008551
910 Ga0307407_10126718
911 Ga0307414_10000001
912 Ga0307414_10121444
913 Ga0307414_10282008
914 Ga0307411_10000013
915 Ga0307411_10002284
916 Ga0307411_10214715
917 Ga0373959_0006217
918 Ga0373926_0003601
919 Ga0373926_0009181
920 Ga0373926_0014350
921 Ga0373926_0019795
922 Ga0373929_0006477
923 Ga0373923_0022455
924 Ga0373923_0161770
925 Ga0373932_0046409
926 Ga0373936_0000679
927 Ga0373936_0063037
928 Ga0373953_0041548
929 Ga0373956_0003328
930 Ga0373956_0054175
931 Ga0373943_0184738
932 Ga0373955_0002990
933 Ga0373942_0014620
934 Ga0373924_0013101
935 Ga0373931_0029780
936 Ga0373935_0056029
937 Ga0373935_0117773
938 Ga0373927_0004452
939 Ga0373927_0004743
940 Ga0373927_0009837
941 Ga0373933_0095011
942 Ga0373933_0116569
943 Ga0373947_0044626
944 Ga0373937_0046658
945 Ga0373937_0326650
946 Ga0373925_0061915
947 Ga0373925_0298449
948 Ga0395898_0137759
949 Ga0395905_0263386
950 Ga0436364_0658052
951 Ga0436364_0822356
952 Ga0436364_1188517
953 Ga0436364_1306996
954 Ga0436365_0073490
955 Ga0436365_0998318
956 Ga0436360_0490098
957 Ga0436362_0306584
958 Ga0436362_0442697
959 Ga0436362_1032274
960 Ga0439447_002257
961 Ga0439466_0002554
962 Ga0451837_0054513
963 Ga0439446_0005985
964 Ga0439435_0021925
965 Ga0451577_0000173
966 Ga0451577_0000531
967 Ga0451577_0003545
968 Ga0451577_0004786
969 Ga0451577_0030222
970 Ga0451577_0041603
971 Ga0451577_0089705
972 Ga0451577_0098319
973 Ga0451577_0166528
974 Ga0451577_0374375
975 Ga0453683_0000548
976 Ga0453683_0013874
977 Ga0453683_0042311
978 Ga0466963_0000193
979 Ga0453684_0000324
980 Ga0453684_0000968
981 Ga0453684_0001343
982 Ga0453684_0001454
983 Ga0453684_0019540
984 Ga0453684_0049970
985 Ga0453684_0470204
986 Ga0466959_0135539
987 Ga0451576_0000613
988 Ga0451576_0005720
989 Ga0451576_0147833
990 Ga0466967_0001058
991 Ga0466967_0098432
992 Ga0466967_0652805
993 Ga0495580_0006268
994 Ga0495580_0026885
995 Ga0495580_0029553
996 Ga0495580_0039807
997 Ga0495580_0112870
998 Ga0495580_0317473
999 Ga0495582_0000591
1000 Ga0495582_0014082
1001 Ga0495608_0036263
1002 Ga0495630_0248695
1003 Ga0495665_0001144
1004 Ga0495586_0014687
1005 Ga0495633_0142313
1006 Ga0495623_0027200
1007 Ga0495646_0003801
1008 Ga0495658_0084803
1009 Ga0495613_0160644
1010 Ga0495624_0006840
1011 Ga0495581_0106821
1012 Ga0495674_0007702
1013 Ga0495674_0055000
1014 Ga0495674_0159009
1015 Ga0495675_0019902
1016 Ga0495675_0198504
1017 Ga0495684_0027401
1018 Ga0495684_0058713
1019 Ga0495593_0009089
1020 Ga0496100_0100742
1021 Ga0496102_0002570
1022 Ga0496102_0116928
1023 Ga0496102_0567567
1024 Ga0496103_0016516
1025 Ga0496103_0085927
1026 Ga0496104_0026550
1027 Ga0496104_0146919
1028 Ga0496104_0245552
1029 Ga0496104_0266991
1030 Ga0496107_0092997
1031 Ga0496109_0212553
1032 Ga0496109_0381514
1033 Ga0496112_0035758
1034 Ga0496112_0141920
1035 Ga0496112_0182016
1036 Ga0496113_0222835
1037 Ga0496115_0316274
1038 Ga0496116_0000047
1039 Ga0496118_0075921
1040 Ga0496121_0009482
1041 Ga0496124_0024755
1042 Ga0496124_0152485
1043 Ga0496125_0000050
1044 Ga0496126_0005294
1045 Ga0501323_013347
1046 Ga0501031_0075344
1047 Ga0501034_0022373
1048 Ga0501039_0122677
1049 Ga0501041_0105516
1050 Ga0501042_0081683
1051 Ga0501046_0000028
1052 Ga0501047_0100734
1053 Ga0501048_0070562
1054 Ga0501048_0211690
1055 Ga0501071_0058745
1056 Ga0501073_0041528
1057 Ga0501075_0041214
1058 Ga0501077_0011246
1059 Ga0501249_000033
1060 Ga0501249_001379
1061 Ga0501257_039613
1062 Ga0501080_0111597
1063 Ga0501266_000005
1064 Ga0501269_012482
1065 Ga0501035_0071779
1066 Ga0501035_0248099
1067 Ga0501044_0004275
1068 Ga0501044_0045900
1069 Ga0501045_0108415
1070 nmdc:mga00v17_290599_c1
1071 nmdc:mga05p37_35920_c1
1072 nmdc:mga09592_329509_c1
1073 nmdc:mga0qj67_8316_c1
1074 nmdc:mga06r32_15116_c1
1075 nmdc:mga0n895_127273_c1
1076 nmdc:mga0n895_166621_c1
1077 nmdc:mga0rr50_216449_c1
1078 nmdc:mga0rr50_314450_c1
1079 nmdc:mga08x19_10402_c1
1080 nmdc:mga08x19_17930_c1
1081 nmdc:mga08x19_555_c2
1082 Ga0495619_0055744
1083 Ga0500646_0003732
1084 Ga0500641_0000027
1085 Ga0500641_0002278
1086 Ga0500658_0000021
1087 Ga0500559_0052890
1088 Ga0501084_0140321
1089 Ga0501082_0134860
1090 2513236411
1091 2520878842
1092 2644011445
1093 2644369848
1094 2644642308
1095 2644685238
1096 2738731963
1097 2738764528
1098 2739213543
1099 2740000812
1100 2740005628
1101 2802654152
1102 2817415821
1103 2833643088
1104 2857614558
1105 2857619060
1106 2881360466
1107 2903898609
1108 2904419845
1109 2904556633
1110 2919194038
1111 2919687800
1112 2929153061
1113 2958460881
1114 2977269732
1115 8054308205
1116 8055421499
1117 8055594027
1118 8056442923

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

58

329

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h8j-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9633 4 292
5h8i-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine 0.9595 4 293
5h8j-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9566 4 289
5h8l-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.9498 4 289
5h8k-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant 0.9496 4 289
ID Description Score Start End Superfamily
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9633 4 292 3.60.110.10
6mg6B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9437 5 294 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9353 4 292 3.60.110.10
6mg6B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9312 5 294 3.60.110.10
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9305 4 296 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A5S3QQQ3-F1-model_v4 deleted 0.9886 6 111
AF-A0A6J4MZV2-F1-model_v4 N-carbamoylputrescine amidase (EC 3.5.1.53) 0.9871 17 185 GO:0033388
GO:0050126
AF-A0A372GZC1-F1-model_v4 Acyltransferase 0.9869 4 295 GO:0016746
GO:0033388
GO:0050126
AF-A0A1K2IH76-F1-model_v4 N-carbamoylputrescine amidase 0.9865 5 295 GO:0033388
GO:0050126
AF-A0A7J4VEW5-F1-model_v4 Acyltransferase 0.9864 1 103 GO:0016746
GO:0033388
GO:0050126

Map