F463553

General Info

Members Datasets Scaffolds Average Seq Length
559 250 1120 433

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10075800|Ga0157371_100758003
Length 469
Sequence LNIKKKFVSNNIVLSQQLIALMTDSQEVSFNNKYIIGISFISALGGYLFGFDFAVISGALPFLRSEFLLTPWWEGFLTGSLALGCIVXXXXAGKLSDRYGRKPGLLLSALIFAVSSFGMAFSGSLTMFIMMRFAAGIGVGMASMLSPMYIAEVSPAKVRGRNVAINQLTIVLGILITNLVNYGLADKGADAWRWMFGLGMVPSVLFLVGVLWLPESPRWLIKAGKPEEAKKILDKIGSAVFVENTISDINASLLGTTKLSYKAVFAKSVRPAVMVGIVLAAFQQLCGINVVFNYTSTIFESVGADLDRQLFETVSIGFVNLIFTLVAMWQVDKLGRRPLMLAGSLGLSIVYIILAILLQNQASPAFVSVFVLLAIAMYATSLAPVTWVLISEIFPNKIRGLASSVAVLSLWVSYFILVFTFPVLASKLGTYGPFYLYAGICILGFLFTKAKVRETKGKTLEEVEMVMAH

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
128 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
129 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
210 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
213 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
214 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
220 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
223 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
224 2738541278 Niastella sp. CF465 Isolate Unclassified
225 2738541283 Pedobacter sp. OK701 Isolate Unclassified
226 2738541284 Pedobacter sp. YR016 Isolate Unclassified
227 2739367656 Pedobacter sp. CF523 Isolate Unclassified
228 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
229 2818991437 Pedobacter terrae 518 Isolate Unclassified
230 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
231 2818991444 Filimonas endophytica 3197 Isolate Unclassified
232 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
233 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
234 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
235 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
236 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
237 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
238 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
239 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
240 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
241 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
242 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
243 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
244 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
245 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
246 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
247 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
248 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
249 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
250 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 0
Isolates 5.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.05
Nodule 0
Rhizoplane 0.18
Rhizosphere 80.68
Stem 0
Stem Tuber 0
Unclassified 7.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10075800 3300013102 Unclassified 2382
2 SwRhRL2b_contig_466296 2162886007 Bacteria 30659
3 JGI24737J22298_10002220 3300001990 Bacteria 6925
4 JGI24735J21928_10000044 3300002067 Bacteria 57824
5 JGI25162J39368_1000094 3300002737 Bacteria 98697
6 JGI25162J39368_1002229 3300002737 Bacteria 7941
7 JGI25165J46597_1001508 3300003214 Bacteria 11817
8 rootH1_10000027 3300003316 Bacteria 6016
9 rootH1_10000027 3300003323 Bacteria 5996
10 rootH1_10005913 3300003316 Bacteria 3162
11 rootH1_10028094 3300003316 Bacteria 13539
12 rootH1_10076092 3300003316 Bacteria 8003
13 rootH2_10001521 3300003320 Bacteria 67147
14 rootH2_10035311 3300003320 Bacteria 15199
15 rootH2_10096738 3300003320 Bacteria 3665
16 rootH2_10200132 3300003320 Bacteria 3510
17 rootH2_10257480 3300003320 Bacteria 2843
18 rootL2_10006460 3300003322 Bacteria 5443
19 rootL2_10108754 3300003322 Bacteria 2072
20 rootL2_10173107 3300003322 Bacteria 2481
21 rootL2_10193289 3300003322 Bacteria 5076
22 rootH1_10004461 3300003323 Bacteria 20456
23 rootH1_10005179 3300003316 Bacteria 7339
24 rootH1_10005179 3300003323 Bacteria 16526
25 rootH1_10100901 3300003323 Bacteria 3935
26 rootH1_10112412 3300003323 Bacteria 8915
27 rootH1_10157279 3300003323 Bacteria 3104
28 rootH1_10161604 3300003323 Bacteria 5670
29 JGI25160J50197_1000749 3300003354 Bacteria 17612
30 Ga0055535_1001493 3300003761 Bacteria 11659
31 Ga0055536_1000008 3300003781 Bacteria 335729
32 Ga0055530_10001780 3300003791 Bacteria 14983
33 Ga0055531_10000255 3300003794 Bacteria 56959
34 Ga0065714_10001936 3300005288 Bacteria 75145
35 Ga0065714_10002328 3300005288 Bacteria 46814
36 Ga0065714_10002329 3300005288 Bacteria 24237
37 Ga0065714_10003211 3300005288 Bacteria 8036
38 Ga0065714_10064438 3300005288 Bacteria 113441
39 Ga0065714_10079517 3300005288 Bacteria 2508
40 Ga0065704_10000199 3300005289 Bacteria 297176
41 Ga0065704_10088743 3300005289 Bacteria 2914
42 Ga0065712_10005812 3300005290 Unclassified 3164
43 Ga0065707_10024861 3300005295 Unclassified 2714
44 Ga0070658_10000434 3300005327 Bacteria 36390
45 Ga0070676_10000053 3300005328 Bacteria 37051
46 Ga0070670_100031914 3300005331 Bacteria 4535
47 Ga0070670_100120067 3300005331 Unclassified 2267
48 Ga0070680_100020002 3300005336 Bacteria 5307
49 Ga0070680_100036987 3300005336 Unclassified 3945
50 Ga0070682_100000811 3300005337 Bacteria 18338
51 Ga0068868_100005533 3300005338 Bacteria 8884
52 Ga0068868_100006338 3300005338 Bacteria 8364
53 Ga0070660_100001051 3300005339 Bacteria 18590
54 Ga0070660_100021579 3300005339 Unclassified 4751
55 Ga0070660_100033914 3300005339 Bacteria 3852
56 Ga0070660_100180575 3300005339 Bacteria 1708
57 Ga0070689_100098618 3300005340 Bacteria 2311
58 Ga0070691_10018412 3300005341 Unclassified 3220
59 Ga0070687_100044734 3300005343 Unclassified 2257
60 Ga0070673_100001414 3300005364 Bacteria 14048
61 Ga0070659_100002930 3300005366 Bacteria 12162
62 Ga0070659_100005603 3300005366 Bacteria 9028
63 Ga0070659_100017855 3300005366 Bacteria 5345
64 Ga0070659_100052142 3300005366 Bacteria 3217
65 Ga0070659_100119298 3300005366 Unclassified 2135
66 Ga0070659_100211126 3300005366 Bacteria 1600
67 Ga0070663_100011342 3300005455 Bacteria 5591
68 Ga0070698_100021191 3300005471 Bacteria 6811
69 Ga0070679_100015145 3300005530 Bacteria 7410
70 Ga0070679_100049058 3300005530 Unclassified 4205
71 Ga0068853_100000568 3300005539 Bacteria 25297
72 Ga0068853_100030399 3300005539 Unclassified 4562
73 Ga0068853_100035355 3300005539 Bacteria 4243
74 Ga0068853_100065925 3300005539 Bacteria 3143
75 Ga0068853_100105444 3300005539 Bacteria 2497
76 Ga0070672_100093686 3300005543 Unclassified 2427
77 Ga0070665_100000017 3300005548 Bacteria 448013
78 Ga0070665_100000041 3300005548 Bacteria 297849
79 Ga0068855_100000229 3300005563 Bacteria 71835
80 Ga0068855_100000730 3300005563 Bacteria 40377
81 Ga0068855_100001155 3300005563 Bacteria 32713
82 Ga0068855_100004742 3300005563 Bacteria 16601
83 Ga0068855_100025359 3300005563 Bacteria 7095
84 Ga0068855_100027449 3300005563 Bacteria 6810
85 Ga0068855_100041961 3300005563 Bacteria 5421
86 Ga0068855_100082527 3300005563 Bacteria 3725
87 Ga0068855_100114663 3300005563 Bacteria 3089
88 Ga0068855_100161791 3300005563 Bacteria 2540
89 Ga0068855_100224911 3300005563 Bacteria 2103
90 Ga0068855_100292695 3300005563 Bacteria 1805
91 Ga0068855_100317541 3300005563 Bacteria 1723
92 Ga0070664_100022082 3300005564 Bacteria 5248
93 Ga0070664_100036987 3300005564 Bacteria 4103
94 Ga0068857_100007826 3300005577 Bacteria 9215
95 Ga0068857_100041959 3300005577 Unclassified 4057
96 Ga0068854_100133307 3300005578 Bacteria 1899
97 Ga0068856_100000924 3300005614 Bacteria 31455
98 Ga0068856_100015341 3300005614 Bacteria 7404
99 Ga0068856_100061198 3300005614 Bacteria 3719
100 Ga0068856_100133462 3300005614 Bacteria 2488
101 Ga0068856_100217644 3300005614 Bacteria 1925
102 Ga0068856_100238683 3300005614 Bacteria 1833
103 Ga0068852_100000306 3300005616 Bacteria 33010
104 Ga0068852_100005366 3300005616 Bacteria 9163
105 Ga0068852_100009267 3300005616 Bacteria 7296
106 Ga0068852_100010690 3300005616 Bacteria 6872
107 Ga0068852_100116130 3300005616 Bacteria 2441
108 Ga0068852_100250932 3300005616 Bacteria 1695
109 Ga0068859_100014625 3300005617 Bacteria 7883
110 Ga0068859_100057873 3300005617 Bacteria 3904
111 Ga0068864_100000976 3300005618 Bacteria 23994
112 Ga0068870_10009858 3300005840 Bacteria 4362
113 Ga0068863_100215079 3300005841 Unclassified 1851
114 Ga0068863_100281138 3300005841 Unclassified 1612
115 Ga0068860_100000491 3300005843 Bacteria 48922
116 Ga0075366_10136009 3300006195 Bacteria 1484
117 Ga0097621_100000369 3300006237 Bacteria 31242
118 Ga0097621_100133834 3300006237 Bacteria 2112
119 Ga0068871_100000513 3300006358 Bacteria 26609
120 Ga0068865_100000133 3300006881 Bacteria 38624
121 Ga0068865_100000310 3300006881 Bacteria 26942
122 Ga0097620_100014625 3300006931 Bacteria 7883
123 Ga0097620_100057874 3300006931 Bacteria 3904
124 Ga0105240_10000126 3300009093 Bacteria 157403
125 Ga0105240_10000147 3300009093 Bacteria 142340
126 Ga0105240_10000168 3300009093 Bacteria 133212
127 Ga0105240_10001469 3300009093 Bacteria 40290
128 Ga0105240_10001927 3300009093 Bacteria 34500
129 Ga0105240_10004968 3300009093 Bacteria 19989
130 Ga0105240_10005895 3300009093 Bacteria 18149
131 Ga0105240_10021127 3300009093 Bacteria 8664
132 Ga0105240_10025982 3300009093 Bacteria 7691
133 Ga0105240_10039408 3300009093 Bacteria 6050
134 Ga0105240_10081685 3300009093 Unclassified 3971
135 Ga0111539_10178610 3300009094 Bacteria 2480
136 Ga0114129_10007293 3300009147 Bacteria 15742
137 Ga0105241_10000270 3300009174 Bacteria 38746
138 Ga0105241_10001046 3300009174 Bacteria 21092
139 Ga0105241_10001279 3300009174 Bacteria 19207
140 Ga0105241_10020689 3300009174 Bacteria 4862
141 Ga0105241_10046684 3300009174 Bacteria 3290
142 Ga0105241_10075341 3300009174 Bacteria 2629
143 Ga0105241_10076742 3300009174 Bacteria 2607
144 Ga0105242_10172967 3300009176 Bacteria 1899
145 Ga0105237_10000206 3300009545 Bacteria 84005
146 Ga0105237_10000263 3300009545 Bacteria 74133
147 Ga0105237_10000504 3300009545 Bacteria 55287
148 Ga0105237_10000962 3300009545 Bacteria 38751
149 Ga0105237_10000993 3300009545 Bacteria 38153
150 Ga0105237_10002695 3300009545 Bacteria 21736
151 Ga0105237_10003064 3300009545 Bacteria 20158
152 Ga0105237_10003527 3300009545 Bacteria 18543
153 Ga0105237_10004889 3300009545 Bacteria 15348
154 Ga0105237_10005709 3300009545 Bacteria 13993
155 Ga0105237_10007620 3300009545 Bacteria 11833
156 Ga0105237_10012639 3300009545 Bacteria 8888
157 Ga0105237_10031241 3300009545 Bacteria 5401
158 Ga0105237_10033780 3300009545 Bacteria 5182
159 Ga0105237_10044219 3300009545 Bacteria 4484
160 Ga0105238_10001257 3300009551 Bacteria 25488
161 Ga0105238_10039594 3300009551 Bacteria 4779
162 Ga0105238_10050024 3300009551 Bacteria 4208
163 Ga0105238_10062583 3300009551 Bacteria 3721
164 Ga0105238_10066158 3300009551 Bacteria 3616
165 Ga0105239_10000016 3300010375 Bacteria 293142
166 Ga0105239_10000021 3300010375 Bacteria 259369
167 Ga0105239_10000101 3300010375 Bacteria 119610
168 Ga0105239_10000718 3300010375 Bacteria 47004
169 Ga0105239_10000896 3300010375 Bacteria 42315
170 Ga0105239_10001035 3300010375 Bacteria 38751
171 Ga0105239_10004693 3300010375 Bacteria 16230
172 Ga0105239_10009228 3300010375 Bacteria 11158
173 Ga0105239_10016300 3300010375 Bacteria 8216
174 Ga0105239_10028055 3300010375 Bacteria 6195
175 Ga0105239_10032473 3300010375 Bacteria 5736
176 Ga0105239_10046003 3300010375 Bacteria 4782
177 Ga0105239_10087590 3300010375 Bacteria 3432
178 Ga0157373_10000015 3300013100 Bacteria 183381
179 Ga0157373_10000018 3300013100 Bacteria 169293
180 Ga0157373_10023122 3300013100 Bacteria 4507
181 Ga0157373_10029427 3300013100 Unclassified 3956
182 Ga0157371_10000542 3300013102 Bacteria 44953
183 Ga0157371_10003393 3300013102 Bacteria 14471
184 Ga0157371_10005101 3300013102 Bacteria 11201
185 Ga0157371_10006506 3300013102 Bacteria 9622
186 Ga0157371_10006762 3300013102 Bacteria 9375
187 Ga0157371_10007304 3300013102 Bacteria 8973
188 Ga0157371_10011939 3300013102 Bacteria 6661
189 Ga0157371_10015963 3300013102 Bacteria 5617
190 Ga0157371_10105727 3300013102 Bacteria 1997
191 Ga0157371_10112929 3300013102 Bacteria 1929
192 Ga0157370_10000446 3300013104 Bacteria 51488
193 Ga0157370_10000474 3300013104 Bacteria 50140
194 Ga0157370_10003898 3300013104 Bacteria 17381
195 Ga0157370_10011410 3300013104 Bacteria 9296
196 Ga0157370_10032312 3300013104 Bacteria 5111
197 Ga0157370_10037479 3300013104 Bacteria 4700
198 Ga0157370_10081785 3300013104 Bacteria 3039
199 Ga0157370_10152118 3300013104 Unclassified 2153
200 Ga0157370_10200872 3300013104 Bacteria 1849
201 Ga0157370_10215892 3300013104 Bacteria 1777
202 Ga0157369_10000439 3300013105 Bacteria 55404
203 Ga0157369_10009068 3300013105 Bacteria 11387
204 Ga0157369_10014339 3300013105 Bacteria 8949
205 Ga0157369_10080377 3300013105 Bacteria 3491
206 Ga0157369_10098984 3300013105 Bacteria 3109
207 Ga0157369_10268440 3300013105 Bacteria 1778
208 Ga0157369_10296272 3300013105 Bacteria 1683
209 Ga0157374_10000599 3300013296 Bacteria 31938
210 Ga0157374_10014904 3300013296 Bacteria 6813
211 Ga0157378_10011362 3300013297 Bacteria 7794
212 Ga0157378_10029309 3300013297 Bacteria 4859
213 Ga0163162_10000026 3300013306 Bacteria 178701
214 Ga0163162_10000778 3300013306 Bacteria 29690
215 Ga0163162_10001178 3300013306 Bacteria 24409
216 Ga0163162_10002670 3300013306 Bacteria 16914
217 Ga0163162_10053450 3300013306 Bacteria 4060
218 Ga0157372_10000015 3300013307 Bacteria 225365
219 Ga0157372_10000346 3300013307 Bacteria 51170
220 Ga0157372_10000680 3300013307 Bacteria 37376
221 Ga0157372_10000735 3300013307 Bacteria 35709
222 Ga0157372_10002159 3300013307 Bacteria 21396
223 Ga0157372_10003320 3300013307 Bacteria 17386
224 Ga0157372_10008802 3300013307 Bacteria 10719
225 Ga0157372_10013232 3300013307 Bacteria 8806
226 Ga0157372_10022589 3300013307 Bacteria 6808
227 Ga0157372_10051670 3300013307 Bacteria 4574
228 Ga0157372_10062482 3300013307 Bacteria 4173
229 Ga0157372_10092533 3300013307 Bacteria 3440
230 Ga0157372_10119225 3300013307 Bacteria 3029
231 Ga0157372_10265952 3300013307 Bacteria 1991
232 Ga0157372_10296187 3300013307 Bacteria 1881
233 Ga0157375_10347838 3300013308 Bacteria 1648
234 Ga0157380_10011724 3300014326 Bacteria 6338
235 Ga0182008_10000001 3300014497 Bacteria 540790
236 Ga0157376_10123309 3300014969 Bacteria 2300
237 Ga0182006_1002670 3300015261 Bacteria 9599
238 Ga0182006_1027607 3300015261 Bacteria 2315
239 Ga0182005_1000202 3300015265 Bacteria 40206
240 Ga0163161_10000365 3300017792 Bacteria 37837
241 Ga0163161_10103835 3300017792 Bacteria 2118
242 Ga0207427_100219 3300025231 Bacteria 49678
243 Ga0209437_100077 3300025233 Bacteria 286656
244 Ga0209437_100363 3300025233 Bacteria 49686
245 Ga0209258_100282 3300025242 Bacteria 85032
246 Ga0209026_1000357 3300025250 Bacteria 43020
247 Ga0209026_1002923 3300025250 Bacteria 5987
248 Ga0209026_1008946 3300025250 Bacteria 2026
249 Ga0209148_1000247 3300025254 Bacteria 86505
250 Ga0209233_1000017 3300025261 Bacteria 898076
251 Ga0209455_1009419 3300025272 Bacteria 2568
252 Ga0209676_1000042 3300025292 Bacteria 424130
253 Ga0209050_1000035 3300025298 Bacteria 424005
254 Ga0207426_1000170 3300025302 Bacteria 164216
255 Ga0209257_1000071 3300025304 Bacteria 335832
256 Ga0207656_10049877 3300025321 Bacteria 1806
257 Ga0207642_10082507 3300025899 Unclassified 1565
258 Ga0207647_10000574 3300025904 Bacteria 28662
259 Ga0207647_10002245 3300025904 Bacteria 14722
260 Ga0207645_10000440 3300025907 Bacteria 34498
261 Ga0207643_10021862 3300025908 Bacteria 3519
262 Ga0207643_10027656 3300025908 Bacteria 3145
263 Ga0207705_10000482 3300025909 Bacteria 34233
264 Ga0207705_10076584 3300025909 Unclassified 2432
265 Ga0207654_10000184 3300025911 Bacteria 38751
266 Ga0207654_10043669 3300025911 Unclassified 2542
267 Ga0207707_10003153 3300025912 Bacteria 14634
268 Ga0207695_10000013 3300025913 Bacteria 821265
269 Ga0207695_10000023 3300025913 Bacteria 657903
270 Ga0207695_10000031 3300025913 Bacteria 526801
271 Ga0207695_10001274 3300025913 Bacteria 42874
272 Ga0207695_10001380 3300025913 Bacteria 41073
273 Ga0207695_10027307 3300025913 Bacteria 6358
274 Ga0207695_10057140 3300025913 Bacteria 4056
275 Ga0207695_10093616 3300025913 Bacteria 3014
276 Ga0207695_10100449 3300025913 Bacteria 2889
277 Ga0207671_10000297 3300025914 Bacteria 73234
278 Ga0207671_10000316 3300025914 Bacteria 71241
279 Ga0207671_10000957 3300025914 Bacteria 35834
280 Ga0207671_10002372 3300025914 Bacteria 20248
281 Ga0207671_10002996 3300025914 Bacteria 17314
282 Ga0207671_10004115 3300025914 Bacteria 14064
283 Ga0207671_10004574 3300025914 Bacteria 13145
284 Ga0207671_10008091 3300025914 Bacteria 8978
285 Ga0207671_10014013 3300025914 Bacteria 6360
286 Ga0207671_10016757 3300025914 Bacteria 5683
287 Ga0207671_10018858 3300025914 Bacteria 5287
288 Ga0207671_10021557 3300025914 Bacteria 4885
289 Ga0207671_10059448 3300025914 Bacteria 2834
290 Ga0207671_10099726 3300025914 Unclassified 2198
291 Ga0207660_10006527 3300025917 Bacteria 7567
292 Ga0207660_10038208 3300025917 Unclassified 3350
293 Ga0207662_10046259 3300025918 Bacteria 2574
294 Ga0207657_10004064 3300025919 Bacteria 15524
295 Ga0207657_10023840 3300025919 Bacteria 5687
296 Ga0207657_10034672 3300025919 Unclassified 4535
297 Ga0207652_10004993 3300025921 Bacteria 10746
298 Ga0207652_10005780 3300025921 Bacteria 10036
299 Ga0207652_10009935 3300025921 Bacteria 7660
300 Ga0207694_10002091 3300025924 Bacteria 16492
301 Ga0207694_10032463 3300025924 Bacteria 3996
302 Ga0207694_10087572 3300025924 Bacteria 2453
303 Ga0207690_10000759 3300025932 Bacteria 20828
304 Ga0207690_10024572 3300025932 Bacteria 3775
305 Ga0207690_10044117 3300025932 Bacteria 2938
306 Ga0207690_10178620 3300025932 Unclassified 1596
307 Ga0207670_10151819 3300025936 Bacteria 1720
308 Ga0207669_10088833 3300025937 Bacteria 2005
309 Ga0207704_10000010 3300025938 Bacteria 188125
310 Ga0207704_10000120 3300025938 Bacteria 42425
311 Ga0207691_10064987 3300025940 Unclassified 3304
312 Ga0207689_10045659 3300025942 Unclassified 3622
313 Ga0207679_10042790 3300025945 Bacteria 3257
314 Ga0207679_10102257 3300025945 Unclassified 2243
315 Ga0207667_10000197 3300025949 Bacteria 87987
316 Ga0207667_10001217 3300025949 Bacteria 32222
317 Ga0207667_10010389 3300025949 Bacteria 10882
318 Ga0207667_10021359 3300025949 Bacteria 7173
319 Ga0207667_10039748 3300025949 Bacteria 5011
320 Ga0207667_10091830 3300025949 Bacteria 3136
321 Ga0207667_10107289 3300025949 Bacteria 2881
322 Ga0207667_10216366 3300025949 Bacteria 1963
323 Ga0207667_10274631 3300025949 Bacteria 1723
324 Ga0207651_10003447 3300025960 Bacteria 7772
325 Ga0207712_10102919 3300025961 Bacteria 2127
326 Ga0207677_10015405 3300026023 Bacteria 4497
327 Ga0207677_10049302 3300026023 Bacteria 2840
328 Ga0207703_10043478 3300026035 Bacteria 3606
329 Ga0207639_10014162 3300026041 Bacteria 5600
330 Ga0207678_10160399 3300026067 Bacteria 1921
331 Ga0207702_10034225 3300026078 Bacteria 4247
332 Ga0207702_10059707 3300026078 Bacteria 3249
333 Ga0207702_10091360 3300026078 Bacteria 2665
334 Ga0207702_10166085 3300026078 Bacteria 2019
335 Ga0207702_10179635 3300026078 Bacteria 1948
336 Ga0207648_10002447 3300026089 Bacteria 19963
337 Ga0207648_10035278 3300026089 Bacteria 4407
338 Ga0207676_10016416 3300026095 Bacteria 5362
339 Ga0207674_10008302 3300026116 Bacteria 12020
340 Ga0207674_10014223 3300026116 Bacteria 8793
341 Ga0207674_10208217 3300026116 Unclassified 1905
342 Ga0207675_100243099 3300026118 Unclassified 1740
343 Ga0207698_10003067 3300026142 Bacteria 10013
344 Ga0207698_10026144 3300026142 Bacteria 4126
345 Ga0207698_10086354 3300026142 Bacteria 2551
346 Ga0207698_10107001 3300026142 Bacteria 2334
347 Ga0268266_10000014 3300028379 Bacteria 644033
348 Ga0268266_10000037 3300028379 Bacteria 342368
349 Ga0268264_10000674 3300028381 Bacteria 39908
350 Ga0307517_10002284 3300028786 Bacteria 30925
351 Ga0307515_10000001 3300028794 Bacteria 4259510
352 Ga0307515_10000280 3300028794 Bacteria 125330
353 Ga0307515_10003886 3300028794 Bacteria 31200
354 Ga0307515_10063752 3300028794 Bacteria 5167
355 Ga0307511_10000264 3300030521 Bacteria 54303
356 Ga0316176_1048616 3300030732 Bacteria 40116
357 Ga0316183_1018086 3300030742 Bacteria 5775
358 Ga0316181_1069399 3300030744 Bacteria 5011
359 Ga0265327_10000411 3300031251 Bacteria 78751
360 Ga0307513_10071485 3300031456 Bacteria 3621
361 Ga0307513_10110373 3300031456 Bacteria 2746
362 Ga0307509_10018041 3300031507 Bacteria 8103
363 Ga0307509_10045122 3300031507 Bacteria 4757
364 Ga0307408_100001128 3300031548 Bacteria 20333
365 Ga0307408_100001139 3300031548 Bacteria 20205
366 Ga0307408_100002494 3300031548 Bacteria 12880
367 Ga0307508_10000644 3300031616 Bacteria 42035
368 Ga0316576_10061672 3300031727 Bacteria 2749
369 Ga0307516_10000656 3300031730 Bacteria 46771
370 Ga0307516_10144430 3300031730 Bacteria 2146
371 Ga0307405_10000046 3300031731 Bacteria 71442
372 Ga0307405_10015870 3300031731 Bacteria 4092
373 Ga0307412_10000017 3300031911 Bacteria 294698
374 Ga0307412_10002541 3300031911 Bacteria 10141
375 Ga0307414_10001044 3300032004 Bacteria 14161
376 Ga0307414_10005303 3300032004 Bacteria 7086
377 Ga0307414_10155409 3300032004 Bacteria 1810
378 Ga0307507_10001142 3300033179 Bacteria 58894
379 Ga0307510_10009647 3300033180 Bacteria 11505
380 Ga0307510_10033263 3300033180 Bacteria 5794
381 Ga0316584_0124463 3300036712 Bacteria 1926
382 Ga0395899_0000001 3300037312 Bacteria 1750322
383 Ga0395899_0000181 3300037312 Bacteria 92672
384 Ga0395899_0000717 3300037312 Bacteria 33215
385 Ga0395899_0000806 3300037312 Bacteria 30625
386 Ga0395899_0004001 3300037312 Bacteria 11614
387 Ga0395899_0005474 3300037312 Bacteria 9847
388 Ga0395899_0100112 3300037312 Bacteria 2093
389 Ga0395900_0000014 3300037418 Bacteria 386513
390 Ga0395900_0002459 3300037418 Bacteria 20402
391 Ga0395900_0005331 3300037418 Bacteria 13474
392 Ga0395900_0009414 3300037418 Bacteria 10015
393 Ga0395900_0012319 3300037418 Bacteria 8748
394 Ga0395900_0099969 3300037418 Bacteria 2979
395 Ga0395900_0125910 3300037418 Bacteria 2628
396 Ga0395900_0211550 3300037418 Bacteria 1958
397 Ga0395900_0281162 3300037418 Unclassified 1656
398 Ga0395898_0002747 3300037466 Bacteria 20291
399 Ga0395898_0009073 3300037466 Bacteria 10472
400 Ga0395898_0015129 3300037466 Bacteria 7918
401 Ga0395898_0105748 3300037466 Bacteria 2699
402 Ga0395898_0238949 3300037466 Bacteria 1733
403 Ga0395905_0000037 3300037471 Bacteria 261808
404 Ga0395905_0000819 3300037471 Bacteria 40842
405 Ga0395905_0001794 3300037471 Bacteria 24895
406 Ga0395901_0000219 3300038443 Bacteria 71884
407 Ga0395901_0002632 3300038443 Bacteria 18151
408 Ga0395901_0008449 3300038443 Bacteria 10405
409 Ga0395901_0025905 3300038443 Bacteria 6023
410 Ga0395901_0051155 3300038443 Bacteria 4294
411 Ga0400483_016155 3300039062 Bacteria 13502
412 Ga0400483_231526 3300039062 Bacteria 9538
413 Ga0439445_0011601 3300042004 Bacteria 2105
414 Ga0439457_027749 3300042014 Bacteria 1253
415 Ga0439462_0009518 3300042015 Bacteria 2457
416 Ga0439462_0042735 3300042015 Bacteria 1211
417 Ga0439434_0009670 3300042435 Bacteria 2835
418 Ga0451577_0025309 3300042876 Bacteria 5387
419 Ga0451577_0095655 3300042876 Bacteria 2652
420 Ga0466969_0000052 3300044656 Bacteria 60425
421 Ga0466972_0000008 3300044658 Bacteria 264518
422 Ga0466972_0000020 3300044658 Bacteria 197336
423 Ga0466972_0001211 3300044658 Bacteria 12411
424 Ga0466972_0007337 3300044658 Bacteria 5537
425 Ga0466966_0005448 3300044684 Bacteria 8368
426 Ga0466966_0056036 3300044684 Bacteria 2494
427 Ga0466966_0074066 3300044684 Bacteria 2129
428 Ga0466961_0021074 3300044693 Bacteria 4195
429 Ga0453684_0007582 3300044712 Bacteria 19895
430 Ga0453684_0030621 3300044712 Bacteria 7596
431 Ga0453684_0041284 3300044712 Bacteria 6245
432 Ga0453684_0066924 3300044712 Bacteria 4572
433 Ga0453684_0143333 3300044712 Bacteria 2849
434 Ga0453684_0249062 3300044712 Bacteria 2041
435 Ga0466971_0004044 3300044719 Bacteria 6309
436 Ga0466957_0000239 3300044842 Bacteria 26161
437 Ga0466957_0015641 3300044842 Bacteria 4433
438 Ga0466957_0030262 3300044842 Bacteria 3232
439 Ga0466959_0000084 3300045049 Bacteria 59368
440 Ga0466959_0002016 3300045049 Bacteria 12821
441 Ga0451576_0037096 3300045051 Bacteria 5164
442 Ga0466958_0051875 3300045836 Bacteria 2485
443 Ga0495627_022022 3300046453 Unclassified 2101
444 Ga0495638_0046190 3300046460 Unclassified 2737
445 Ga0495650_0000231 3300046471 Bacteria 113969
446 Ga0495650_0029554 3300046471 Bacteria 2497
447 Ga0495585_0000037 3300046492 Bacteria 133335
448 Ga0495585_0015075 3300046492 Bacteria 4493
449 Ga0495596_0029183 3300046500 Bacteria 2213
450 Ga0495606_0000060 3300046507 Bacteria 185907
451 Ga0495606_0005180 3300046507 Bacteria 12610
452 Ga0495606_0005353 3300046507 Bacteria 12323
453 Ga0495606_0099225 3300046507 Bacteria 1776
454 Ga0495610_0000093 3300046512 Bacteria 105873
455 Ga0495616_0008927 3300046513 Bacteria 5891
456 Ga0495631_0038658 3300046518 Unclassified 2120
457 Ga0495637_0022196 3300046520 Bacteria 2899
458 Ga0495648_0004193 3300046524 Bacteria 12383
459 Ga0495648_0019829 3300046524 Bacteria 4710
460 Ga0495652_0219171 3300046529 Unclassified 1431
461 Ga0495598_0011499 3300046537 Bacteria 2149
462 Ga0495609_0014279 3300046538 Bacteria 3738
463 Ga0495622_0035607 3300046557 Bacteria 2321
464 Ga0495633_0000023 3300046558 Bacteria 226510
465 Ga0495633_0000641 3300046558 Bacteria 32663
466 Ga0495668_0000012 3300046616 Bacteria 458817
467 Ga0495668_0020335 3300046616 Bacteria 3819
468 Ga0495611_0000100 3300046648 Bacteria 59688
469 Ga0495625_0000191 3300046660 Bacteria 97363
470 Ga0495625_0001093 3300046660 Bacteria 35233
471 Ga0495625_0001735 3300046660 Bacteria 25214
472 Ga0495625_0090399 3300046660 Bacteria 2118
473 Ga0495625_0098709 3300046660 Bacteria 2008
474 Ga0495661_0002843 3300046665 Bacteria 13106
475 Ga0495661_0010372 3300046665 Bacteria 6359
476 Ga0495649_0000010 3300046694 Bacteria 430552
477 Ga0495649_0000061 3300046694 Bacteria 97338
478 Ga0495683_0030179 3300047323 Bacteria 2767
479 Ga0495687_000144 3300047443 Bacteria 108217
480 Ga0495687_002703 3300047443 Bacteria 13756
481 Ga0495686_0000004 3300047472 Bacteria 869019
482 Ga0495686_0000071 3300047472 Bacteria 216594
483 Ga0495686_0026706 3300047472 Unclassified 3777
484 Ga0495686_0031208 3300047472 Bacteria 3457
485 Ga0495686_0038489 3300047472 Unclassified 3058
486 Ga0495686_0045132 3300047472 Bacteria 2789
487 Ga0496121_0000026 3300048924 Bacteria 450157
488 Ga0496122_0001373 3300048925 Bacteria 39623
489 Ga0496123_0010050 3300048926 Bacteria 8424
490 Ga0496125_0050779 3300048928 Bacteria 3430
491 Ga0496126_0116479 3300048929 Bacteria 2322
492 Ga0495678_004082 3300049459 Bacteria 8658
493 Ga0501033_0033698 3300049570 Bacteria 3845
494 Ga0501033_0061896 3300049570 Bacteria 2757
495 Ga0501033_0162912 3300049570 Bacteria 1605
496 Ga0501034_0047009 3300049571 Unclassified 4359
497 Ga0501034_0102587 3300049571 Bacteria 2854
498 Ga0501034_0115052 3300049571 Unclassified 2678
499 Ga0501039_0211589 3300049575 Bacteria 1525
500 Ga0501047_0061473 3300049581 Bacteria 3624
501 Ga0501219_000091 3300049703 Bacteria 15479
502 Ga0501225_0000313 3300049705 Bacteria 15194
503 Ga0501044_0116710 3300049823 Bacteria 2674
504 Ga0501284_00037 3300050005 Bacteria 55085
505 nmdc:mga0k408_1220_c1 3300050493 Bacteria 14082
506 nmdc:mga05p37_5208_c1 3300050507 Bacteria 15258
507 Ga0500578_0000024 3300053086 Bacteria 151503
508 Ga0500578_0033161 3300053086 Bacteria 3320
509 Ga0500644_0000567 3300053088 Bacteria 14501
510 Ga0500646_0016329 3300053090 Bacteria 1938
511 Ga0500583_0000058 3300053092 Bacteria 68363
512 Ga0500583_0002307 3300053092 Bacteria 5704
513 Ga0500651_0000451 3300053093 Bacteria 21958
514 Ga0500569_001611 3300053109 Bacteria 4283
515 Ga0500607_017620 3300053121 Bacteria 4072
516 Ga0500618_000013 3300053125 Bacteria 183026
517 Ga0500642_0019392 3300053130 Bacteria 2652
518 Ga0500652_052105 3300053131 Bacteria 1673
519 Ga0500658_0002777 3300053134 Bacteria 6727
520 Ga0500559_0016035 3300053136 Bacteria 3165
521 Ga0500559_0017951 3300053136 Bacteria 2991
522 Ga0500577_0000506 3300053142 Bacteria 10029
523 Ga0500616_0059090 3300053153 Bacteria 1992
524 Ga0500622_0000199 3300053156 Bacteria 63518
525 Ga0500622_0000676 3300053156 Bacteria 30139
526 Ga0500622_0001133 3300053156 Bacteria 22246
527 Ga0500622_0001437 3300053156 Bacteria 19111
528 Ga0500622_0019691 3300053156 Bacteria 3582
529 Ga0500633_0009438 3300053160 Unclassified 2566
530 Ga0500611_000063 3300053727 Bacteria 44144
531 Ga0466962_0016666 3300061719 Bacteria 3544
532 2586208828 2585427687 Bacteria 5544917
533 2599481466 2599185184 Bacteria 6430550
534 2738729947 2738541278 Bacteria 9755573
535 2738756180 2738541283 Bacteria 7222293
536 2738763926 2738541284 Bacteria 5199923
537 2739616691 2739367656 Bacteria 5152243
538 2776613601 2775506987 Bacteria 5373360
539 2819549343 2818991437 Bacteria 5805520
540 2819577475 2818991442 Bacteria 8318214
541 2819590128 2818991444 Bacteria 6968812
542 2821138853 2821136567 Bacteria 8080116
543 2842726221 2842722452 Bacteria 6263924
544 2842904141 2842903701 Bacteria 6986368
545 2842910466 2842909656 Bacteria 6185908
546 2852623975 2852623160 Bacteria 4376875
547 2852629740 2852627209 Bacteria 5896285
548 2883072013 2883068021 Bacteria 6192739
549 2884937122 2884933994 Bacteria 4535041
550 2896111097 2896109856 Bacteria 7140722
551 2896113891 2896109856 Bacteria 7140722
552 2896346585 2896344016 Bacteria 3811746
553 2904472568 2904467357 Bacteria 8057758
554 2919442582 2919437846 Bacteria 6199444
555 2928082830 2928078545 Bacteria 6534839
556 2928149848 2928147474 Bacteria 6512076
557 2929243164 2929239360 Bacteria 7745570
558 2932086501 2932082852 Bacteria 6563563
559 2954017702 2954016120 Bacteria 6446024
560 2958512846 2958512119 Bacteria 4528530
561 2977234263 2977232053 Bacteria 5485925
562 Ga0157371_10075800
563 SwRhRL2b_contig_466296
564 JGI24737J22298_10002220
565 JGI24735J21928_10000044
566 JGI25162J39368_1000094
567 JGI25162J39368_1002229
568 JGI25165J46597_1001508
569 rootH1_10000027
570 rootH1_10005913
571 rootH1_10028094
572 rootH1_10076092
573 rootH2_10001521
574 rootH2_10035311
575 rootH2_10096738
576 rootH2_10200132
577 rootH2_10257480
578 rootL2_10006460
579 rootL2_10108754
580 rootL2_10173107
581 rootL2_10193289
582 rootH1_10004461
583 rootH1_10005179
584 rootH1_10100901
585 rootH1_10112412
586 rootH1_10157279
587 rootH1_10161604
588 JGI25160J50197_1000749
589 Ga0055535_1001493
590 Ga0055536_1000008
591 Ga0055530_10001780
592 Ga0055531_10000255
593 Ga0065714_10001936
594 Ga0065714_10002328
595 Ga0065714_10002329
596 Ga0065714_10003211
597 Ga0065714_10064438
598 Ga0065714_10079517
599 Ga0065704_10000199
600 Ga0065704_10088743
601 Ga0065712_10005812
602 Ga0065707_10024861
603 Ga0070658_10000434
604 Ga0070676_10000053
605 Ga0070670_100031914
606 Ga0070670_100120067
607 Ga0070680_100020002
608 Ga0070680_100036987
609 Ga0070682_100000811
610 Ga0068868_100005533
611 Ga0068868_100006338
612 Ga0070660_100001051
613 Ga0070660_100021579
614 Ga0070660_100033914
615 Ga0070660_100180575
616 Ga0070689_100098618
617 Ga0070691_10018412
618 Ga0070687_100044734
619 Ga0070673_100001414
620 Ga0070659_100002930
621 Ga0070659_100005603
622 Ga0070659_100017855
623 Ga0070659_100052142
624 Ga0070659_100119298
625 Ga0070659_100211126
626 Ga0070663_100011342
627 Ga0070698_100021191
628 Ga0070679_100015145
629 Ga0070679_100049058
630 Ga0068853_100000568
631 Ga0068853_100030399
632 Ga0068853_100035355
633 Ga0068853_100065925
634 Ga0068853_100105444
635 Ga0070672_100093686
636 Ga0070665_100000017
637 Ga0070665_100000041
638 Ga0068855_100000229
639 Ga0068855_100000730
640 Ga0068855_100001155
641 Ga0068855_100004742
642 Ga0068855_100025359
643 Ga0068855_100027449
644 Ga0068855_100041961
645 Ga0068855_100082527
646 Ga0068855_100114663
647 Ga0068855_100161791
648 Ga0068855_100224911
649 Ga0068855_100292695
650 Ga0068855_100317541
651 Ga0070664_100022082
652 Ga0070664_100036987
653 Ga0068857_100007826
654 Ga0068857_100041959
655 Ga0068854_100133307
656 Ga0068856_100000924
657 Ga0068856_100015341
658 Ga0068856_100061198
659 Ga0068856_100133462
660 Ga0068856_100217644
661 Ga0068856_100238683
662 Ga0068852_100000306
663 Ga0068852_100005366
664 Ga0068852_100009267
665 Ga0068852_100010690
666 Ga0068852_100116130
667 Ga0068852_100250932
668 Ga0068859_100014625
669 Ga0068859_100057873
670 Ga0068864_100000976
671 Ga0068870_10009858
672 Ga0068863_100215079
673 Ga0068863_100281138
674 Ga0068860_100000491
675 Ga0075366_10136009
676 Ga0097621_100000369
677 Ga0097621_100133834
678 Ga0068871_100000513
679 Ga0068865_100000133
680 Ga0068865_100000310
681 Ga0097620_100014625
682 Ga0097620_100057874
683 Ga0105240_10000126
684 Ga0105240_10000147
685 Ga0105240_10000168
686 Ga0105240_10001469
687 Ga0105240_10001927
688 Ga0105240_10004968
689 Ga0105240_10005895
690 Ga0105240_10021127
691 Ga0105240_10025982
692 Ga0105240_10039408
693 Ga0105240_10081685
694 Ga0111539_10178610
695 Ga0114129_10007293
696 Ga0105241_10000270
697 Ga0105241_10001046
698 Ga0105241_10001279
699 Ga0105241_10020689
700 Ga0105241_10046684
701 Ga0105241_10075341
702 Ga0105241_10076742
703 Ga0105242_10172967
704 Ga0105237_10000206
705 Ga0105237_10000263
706 Ga0105237_10000504
707 Ga0105237_10000962
708 Ga0105237_10000993
709 Ga0105237_10002695
710 Ga0105237_10003064
711 Ga0105237_10003527
712 Ga0105237_10004889
713 Ga0105237_10005709
714 Ga0105237_10007620
715 Ga0105237_10012639
716 Ga0105237_10031241
717 Ga0105237_10033780
718 Ga0105237_10044219
719 Ga0105238_10001257
720 Ga0105238_10039594
721 Ga0105238_10050024
722 Ga0105238_10062583
723 Ga0105238_10066158
724 Ga0105239_10000016
725 Ga0105239_10000021
726 Ga0105239_10000101
727 Ga0105239_10000718
728 Ga0105239_10000896
729 Ga0105239_10001035
730 Ga0105239_10004693
731 Ga0105239_10009228
732 Ga0105239_10016300
733 Ga0105239_10028055
734 Ga0105239_10032473
735 Ga0105239_10046003
736 Ga0105239_10087590
737 Ga0157373_10000015
738 Ga0157373_10000018
739 Ga0157373_10023122
740 Ga0157373_10029427
741 Ga0157371_10000542
742 Ga0157371_10003393
743 Ga0157371_10005101
744 Ga0157371_10006506
745 Ga0157371_10006762
746 Ga0157371_10007304
747 Ga0157371_10011939
748 Ga0157371_10015963
749 Ga0157371_10105727
750 Ga0157371_10112929
751 Ga0157370_10000446
752 Ga0157370_10000474
753 Ga0157370_10003898
754 Ga0157370_10011410
755 Ga0157370_10032312
756 Ga0157370_10037479
757 Ga0157370_10081785
758 Ga0157370_10152118
759 Ga0157370_10200872
760 Ga0157370_10215892
761 Ga0157369_10000439
762 Ga0157369_10009068
763 Ga0157369_10014339
764 Ga0157369_10080377
765 Ga0157369_10098984
766 Ga0157369_10268440
767 Ga0157369_10296272
768 Ga0157374_10000599
769 Ga0157374_10014904
770 Ga0157378_10011362
771 Ga0157378_10029309
772 Ga0163162_10000026
773 Ga0163162_10000778
774 Ga0163162_10001178
775 Ga0163162_10002670
776 Ga0163162_10053450
777 Ga0157372_10000015
778 Ga0157372_10000346
779 Ga0157372_10000680
780 Ga0157372_10000735
781 Ga0157372_10002159
782 Ga0157372_10003320
783 Ga0157372_10008802
784 Ga0157372_10013232
785 Ga0157372_10022589
786 Ga0157372_10051670
787 Ga0157372_10062482
788 Ga0157372_10092533
789 Ga0157372_10119225
790 Ga0157372_10265952
791 Ga0157372_10296187
792 Ga0157375_10347838
793 Ga0157380_10011724
794 Ga0182008_10000001
795 Ga0157376_10123309
796 Ga0182006_1002670
797 Ga0182006_1027607
798 Ga0182005_1000202
799 Ga0163161_10000365
800 Ga0163161_10103835
801 Ga0207427_100219
802 Ga0209437_100077
803 Ga0209437_100363
804 Ga0209258_100282
805 Ga0209026_1000357
806 Ga0209026_1002923
807 Ga0209026_1008946
808 Ga0209148_1000247
809 Ga0209233_1000017
810 Ga0209455_1009419
811 Ga0209676_1000042
812 Ga0209050_1000035
813 Ga0207426_1000170
814 Ga0209257_1000071
815 Ga0207656_10049877
816 Ga0207642_10082507
817 Ga0207647_10000574
818 Ga0207647_10002245
819 Ga0207645_10000440
820 Ga0207643_10021862
821 Ga0207643_10027656
822 Ga0207705_10000482
823 Ga0207705_10076584
824 Ga0207654_10000184
825 Ga0207654_10043669
826 Ga0207707_10003153
827 Ga0207695_10000013
828 Ga0207695_10000023
829 Ga0207695_10000031
830 Ga0207695_10001274
831 Ga0207695_10001380
832 Ga0207695_10027307
833 Ga0207695_10057140
834 Ga0207695_10093616
835 Ga0207695_10100449
836 Ga0207671_10000297
837 Ga0207671_10000316
838 Ga0207671_10000957
839 Ga0207671_10002372
840 Ga0207671_10002996
841 Ga0207671_10004115
842 Ga0207671_10004574
843 Ga0207671_10008091
844 Ga0207671_10014013
845 Ga0207671_10016757
846 Ga0207671_10018858
847 Ga0207671_10021557
848 Ga0207671_10059448
849 Ga0207671_10099726
850 Ga0207660_10006527
851 Ga0207660_10038208
852 Ga0207662_10046259
853 Ga0207657_10004064
854 Ga0207657_10023840
855 Ga0207657_10034672
856 Ga0207652_10004993
857 Ga0207652_10005780
858 Ga0207652_10009935
859 Ga0207694_10002091
860 Ga0207694_10032463
861 Ga0207694_10087572
862 Ga0207690_10000759
863 Ga0207690_10024572
864 Ga0207690_10044117
865 Ga0207690_10178620
866 Ga0207670_10151819
867 Ga0207669_10088833
868 Ga0207704_10000010
869 Ga0207704_10000120
870 Ga0207691_10064987
871 Ga0207689_10045659
872 Ga0207679_10042790
873 Ga0207679_10102257
874 Ga0207667_10000197
875 Ga0207667_10001217
876 Ga0207667_10010389
877 Ga0207667_10021359
878 Ga0207667_10039748
879 Ga0207667_10091830
880 Ga0207667_10107289
881 Ga0207667_10216366
882 Ga0207667_10274631
883 Ga0207651_10003447
884 Ga0207712_10102919
885 Ga0207677_10015405
886 Ga0207677_10049302
887 Ga0207703_10043478
888 Ga0207639_10014162
889 Ga0207678_10160399
890 Ga0207702_10034225
891 Ga0207702_10059707
892 Ga0207702_10091360
893 Ga0207702_10166085
894 Ga0207702_10179635
895 Ga0207648_10002447
896 Ga0207648_10035278
897 Ga0207676_10016416
898 Ga0207674_10008302
899 Ga0207674_10014223
900 Ga0207674_10208217
901 Ga0207675_100243099
902 Ga0207698_10003067
903 Ga0207698_10026144
904 Ga0207698_10086354
905 Ga0207698_10107001
906 Ga0268266_10000014
907 Ga0268266_10000037
908 Ga0268264_10000674
909 Ga0307517_10002284
910 Ga0307515_10000001
911 Ga0307515_10000280
912 Ga0307515_10003886
913 Ga0307515_10063752
914 Ga0307511_10000264
915 Ga0316176_1048616
916 Ga0316183_1018086
917 Ga0316181_1069399
918 Ga0265327_10000411
919 Ga0307513_10071485
920 Ga0307513_10110373
921 Ga0307509_10018041
922 Ga0307509_10045122
923 Ga0307408_100001128
924 Ga0307408_100001139
925 Ga0307408_100002494
926 Ga0307508_10000644
927 Ga0316576_10061672
928 Ga0307516_10000656
929 Ga0307516_10144430
930 Ga0307405_10000046
931 Ga0307405_10015870
932 Ga0307412_10000017
933 Ga0307412_10002541
934 Ga0307414_10001044
935 Ga0307414_10005303
936 Ga0307414_10155409
937 Ga0307507_10001142
938 Ga0307510_10009647
939 Ga0307510_10033263
940 Ga0316584_0124463
941 Ga0395899_0000001
942 Ga0395899_0000181
943 Ga0395899_0000717
944 Ga0395899_0000806
945 Ga0395899_0004001
946 Ga0395899_0005474
947 Ga0395899_0100112
948 Ga0395900_0000014
949 Ga0395900_0002459
950 Ga0395900_0005331
951 Ga0395900_0009414
952 Ga0395900_0012319
953 Ga0395900_0099969
954 Ga0395900_0125910
955 Ga0395900_0211550
956 Ga0395900_0281162
957 Ga0395898_0002747
958 Ga0395898_0009073
959 Ga0395898_0015129
960 Ga0395898_0105748
961 Ga0395898_0238949
962 Ga0395905_0000037
963 Ga0395905_0000819
964 Ga0395905_0001794
965 Ga0395901_0000219
966 Ga0395901_0002632
967 Ga0395901_0008449
968 Ga0395901_0025905
969 Ga0395901_0051155
970 Ga0400483_016155
971 Ga0400483_231526
972 Ga0439445_0011601
973 Ga0439457_027749
974 Ga0439462_0009518
975 Ga0439462_0042735
976 Ga0439434_0009670
977 Ga0451577_0025309
978 Ga0451577_0095655
979 Ga0466969_0000052
980 Ga0466972_0000008
981 Ga0466972_0000020
982 Ga0466972_0001211
983 Ga0466972_0007337
984 Ga0466966_0005448
985 Ga0466966_0056036
986 Ga0466966_0074066
987 Ga0466961_0021074
988 Ga0453684_0007582
989 Ga0453684_0030621
990 Ga0453684_0041284
991 Ga0453684_0066924
992 Ga0453684_0143333
993 Ga0453684_0249062
994 Ga0466971_0004044
995 Ga0466957_0000239
996 Ga0466957_0015641
997 Ga0466957_0030262
998 Ga0466959_0000084
999 Ga0466959_0002016
1000 Ga0451576_0037096
1001 Ga0466958_0051875
1002 Ga0495627_022022
1003 Ga0495638_0046190
1004 Ga0495650_0000231
1005 Ga0495650_0029554
1006 Ga0495585_0000037
1007 Ga0495585_0015075
1008 Ga0495596_0029183
1009 Ga0495606_0000060
1010 Ga0495606_0005180
1011 Ga0495606_0005353
1012 Ga0495606_0099225
1013 Ga0495610_0000093
1014 Ga0495616_0008927
1015 Ga0495631_0038658
1016 Ga0495637_0022196
1017 Ga0495648_0004193
1018 Ga0495648_0019829
1019 Ga0495652_0219171
1020 Ga0495598_0011499
1021 Ga0495609_0014279
1022 Ga0495622_0035607
1023 Ga0495633_0000023
1024 Ga0495633_0000641
1025 Ga0495668_0000012
1026 Ga0495668_0020335
1027 Ga0495611_0000100
1028 Ga0495625_0000191
1029 Ga0495625_0001093
1030 Ga0495625_0001735
1031 Ga0495625_0090399
1032 Ga0495625_0098709
1033 Ga0495661_0002843
1034 Ga0495661_0010372
1035 Ga0495649_0000010
1036 Ga0495649_0000061
1037 Ga0495683_0030179
1038 Ga0495687_000144
1039 Ga0495687_002703
1040 Ga0495686_0000004
1041 Ga0495686_0000071
1042 Ga0495686_0026706
1043 Ga0495686_0031208
1044 Ga0495686_0038489
1045 Ga0495686_0045132
1046 Ga0496121_0000026
1047 Ga0496122_0001373
1048 Ga0496123_0010050
1049 Ga0496125_0050779
1050 Ga0496126_0116479
1051 Ga0495678_004082
1052 Ga0501033_0033698
1053 Ga0501033_0061896
1054 Ga0501033_0162912
1055 Ga0501034_0047009
1056 Ga0501034_0102587
1057 Ga0501034_0115052
1058 Ga0501039_0211589
1059 Ga0501047_0061473
1060 Ga0501219_000091
1061 Ga0501225_0000313
1062 Ga0501044_0116710
1063 Ga0501284_00037
1064 nmdc:mga0k408_1220_c1
1065 nmdc:mga05p37_5208_c1
1066 Ga0500578_0000024
1067 Ga0500578_0033161
1068 Ga0500644_0000567
1069 Ga0500646_0016329
1070 Ga0500583_0000058
1071 Ga0500583_0002307
1072 Ga0500651_0000451
1073 Ga0500569_001611
1074 Ga0500607_017620
1075 Ga0500618_000013
1076 Ga0500642_0019392
1077 Ga0500652_052105
1078 Ga0500658_0002777
1079 Ga0500559_0016035
1080 Ga0500559_0017951
1081 Ga0500577_0000506
1082 Ga0500616_0059090
1083 Ga0500622_0000199
1084 Ga0500622_0000676
1085 Ga0500622_0001133
1086 Ga0500622_0001437
1087 Ga0500622_0019691
1088 Ga0500633_0009438
1089 Ga0500611_000063
1090 Ga0466962_0016666
1091 2586208828
1092 2599481466
1093 2738729947
1094 2738756180
1095 2738763926
1096 2739616691
1097 2776613601
1098 2819549343
1099 2819577475
1100 2819590128
1101 2821138853
1102 2842726221
1103 2842904141
1104 2842910466
1105 2852623975
1106 2852629740
1107 2883072013
1108 2884937122
1109 2896111097
1110 2896113891
1111 2896346585
1112 2904472568
1113 2919442582
1114 2928082830
1115 2928149848
1116 2929243164
1117 2932086501
1118 2954017702
1119 2958512846
1120 2977234263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

38

467

0.96

PF07690

MFS_1

Major Facilitator Superfamily

42

318

0.8

PF07690

MFS_1

Major Facilitator Superfamily

277

466

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.9102 19 433
4yb9-assembly1.cif.gz_D crystal structure of the bovine fructose transporter glut5 in an open inward-facing conformation 0.9028 17 432
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.9006 16 433
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.8959 19 433
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.8925 16 433
ID Description Score Start End Superfamily
af_A0A0P0WGH5_53_382_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9583 10 316 1.20.1250.20
af_A0A0P0WGJ2_58_436_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9575 11 366 1.20.1250.20
af_K7TQZ4_34_446_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9573 11 394 1.20.1250.20
4ja3A03 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9546 251 432 1.20.1250.20
af_O95528_5_195_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9524 13 192 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4Q5RE67-F1-model_v4 MFS transporter 0.9793 1 265 GO:0016020
GO:0022857
AF-A0A519V664-F1-model_v4 MFS transporter 0.9748 1 193 GO:0016020
GO:0022857
AF-A0A519V664-F1-model_v4 MFS transporter 0.9699 1 193 GO:0016020
GO:0022857
AF-A0A4Q5RE67-F1-model_v4 MFS transporter 0.9685 1 265 GO:0016020
GO:0022857
AF-A0A7V3JMR2-F1-model_v4 MFS transporter 0.9671 12 446 GO:0016020
GO:0022857

Map