F463553
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 559 | 250 | 1120 | 433 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10075800|Ga0157371_100758003 |
| Length | 469 |
| Sequence | LNIKKKFVSNNIVLSQQLIALMTDSQEVSFNNKYIIGISFISALGGYLFGFDFAVISGALPFLRSEFLLTPWWEGFLTGSLALGCIVXXXXAGKLSDRYGRKPGLLLSALIFAVSSFGMAFSGSLTMFIMMRFAAGIGVGMASMLSPMYIAEVSPAKVRGRNVAINQLTIVLGILITNLVNYGLADKGADAWRWMFGLGMVPSVLFLVGVLWLPESPRWLIKAGKPEEAKKILDKIGSAVFVENTISDINASLLGTTKLSYKAVFAKSVRPAVMVGIVLAAFQQLCGINVVFNYTSTIFESVGADLDRQLFETVSIGFVNLIFTLVAMWQVDKLGRRPLMLAGSLGLSIVYIILAILLQNQASPAFVSVFVLLAIAMYATSLAPVTWVLISEIFPNKIRGLASSVAVLSLWVSYFILVFTFPVLASKLGTYGPFYLYAGICILGFLFTKAKVRETKGKTLEEVEMVMAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 80 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 125 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 126 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 127 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 128 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 129 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 132 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 133 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 134 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 135 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 136 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 137 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 141 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 142 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 147 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 148 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 149 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 150 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 151 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 152 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 153 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 154 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 155 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 156 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 157 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 158 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 159 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 160 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 161 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 162 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 163 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 164 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 189 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 190 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 191 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 192 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 193 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 199 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 202 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 203 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 205 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 206 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 207 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 208 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 209 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 210 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 211 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 212 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 213 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 214 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 215 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 216 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 217 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 218 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 219 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 220 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 221 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 222 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 223 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 224 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 225 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 226 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 227 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 228 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 229 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 230 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 231 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 232 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 233 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 234 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 235 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 236 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 237 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 238 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 239 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 240 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 241 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 242 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 243 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 244 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 245 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 246 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 247 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 248 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 249 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 250 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.63 |
| Metatranscriptomes | 0 |
| Isolates | 5.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.05 |
| Nodule | 0 |
| Rhizoplane | 0.18 |
| Rhizosphere | 80.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157371_10075800 | 3300013102 | Unclassified | 2382 |
| 2 | SwRhRL2b_contig_466296 | 2162886007 | Bacteria | 30659 |
| 3 | JGI24737J22298_10002220 | 3300001990 | Bacteria | 6925 |
| 4 | JGI24735J21928_10000044 | 3300002067 | Bacteria | 57824 |
| 5 | JGI25162J39368_1000094 | 3300002737 | Bacteria | 98697 |
| 6 | JGI25162J39368_1002229 | 3300002737 | Bacteria | 7941 |
| 7 | JGI25165J46597_1001508 | 3300003214 | Bacteria | 11817 |
| 8 | rootH1_10000027 | 3300003316 | Bacteria | 6016 |
| 9 | rootH1_10000027 | 3300003323 | Bacteria | 5996 |
| 10 | rootH1_10005913 | 3300003316 | Bacteria | 3162 |
| 11 | rootH1_10028094 | 3300003316 | Bacteria | 13539 |
| 12 | rootH1_10076092 | 3300003316 | Bacteria | 8003 |
| 13 | rootH2_10001521 | 3300003320 | Bacteria | 67147 |
| 14 | rootH2_10035311 | 3300003320 | Bacteria | 15199 |
| 15 | rootH2_10096738 | 3300003320 | Bacteria | 3665 |
| 16 | rootH2_10200132 | 3300003320 | Bacteria | 3510 |
| 17 | rootH2_10257480 | 3300003320 | Bacteria | 2843 |
| 18 | rootL2_10006460 | 3300003322 | Bacteria | 5443 |
| 19 | rootL2_10108754 | 3300003322 | Bacteria | 2072 |
| 20 | rootL2_10173107 | 3300003322 | Bacteria | 2481 |
| 21 | rootL2_10193289 | 3300003322 | Bacteria | 5076 |
| 22 | rootH1_10004461 | 3300003323 | Bacteria | 20456 |
| 23 | rootH1_10005179 | 3300003316 | Bacteria | 7339 |
| 24 | rootH1_10005179 | 3300003323 | Bacteria | 16526 |
| 25 | rootH1_10100901 | 3300003323 | Bacteria | 3935 |
| 26 | rootH1_10112412 | 3300003323 | Bacteria | 8915 |
| 27 | rootH1_10157279 | 3300003323 | Bacteria | 3104 |
| 28 | rootH1_10161604 | 3300003323 | Bacteria | 5670 |
| 29 | JGI25160J50197_1000749 | 3300003354 | Bacteria | 17612 |
| 30 | Ga0055535_1001493 | 3300003761 | Bacteria | 11659 |
| 31 | Ga0055536_1000008 | 3300003781 | Bacteria | 335729 |
| 32 | Ga0055530_10001780 | 3300003791 | Bacteria | 14983 |
| 33 | Ga0055531_10000255 | 3300003794 | Bacteria | 56959 |
| 34 | Ga0065714_10001936 | 3300005288 | Bacteria | 75145 |
| 35 | Ga0065714_10002328 | 3300005288 | Bacteria | 46814 |
| 36 | Ga0065714_10002329 | 3300005288 | Bacteria | 24237 |
| 37 | Ga0065714_10003211 | 3300005288 | Bacteria | 8036 |
| 38 | Ga0065714_10064438 | 3300005288 | Bacteria | 113441 |
| 39 | Ga0065714_10079517 | 3300005288 | Bacteria | 2508 |
| 40 | Ga0065704_10000199 | 3300005289 | Bacteria | 297176 |
| 41 | Ga0065704_10088743 | 3300005289 | Bacteria | 2914 |
| 42 | Ga0065712_10005812 | 3300005290 | Unclassified | 3164 |
| 43 | Ga0065707_10024861 | 3300005295 | Unclassified | 2714 |
| 44 | Ga0070658_10000434 | 3300005327 | Bacteria | 36390 |
| 45 | Ga0070676_10000053 | 3300005328 | Bacteria | 37051 |
| 46 | Ga0070670_100031914 | 3300005331 | Bacteria | 4535 |
| 47 | Ga0070670_100120067 | 3300005331 | Unclassified | 2267 |
| 48 | Ga0070680_100020002 | 3300005336 | Bacteria | 5307 |
| 49 | Ga0070680_100036987 | 3300005336 | Unclassified | 3945 |
| 50 | Ga0070682_100000811 | 3300005337 | Bacteria | 18338 |
| 51 | Ga0068868_100005533 | 3300005338 | Bacteria | 8884 |
| 52 | Ga0068868_100006338 | 3300005338 | Bacteria | 8364 |
| 53 | Ga0070660_100001051 | 3300005339 | Bacteria | 18590 |
| 54 | Ga0070660_100021579 | 3300005339 | Unclassified | 4751 |
| 55 | Ga0070660_100033914 | 3300005339 | Bacteria | 3852 |
| 56 | Ga0070660_100180575 | 3300005339 | Bacteria | 1708 |
| 57 | Ga0070689_100098618 | 3300005340 | Bacteria | 2311 |
| 58 | Ga0070691_10018412 | 3300005341 | Unclassified | 3220 |
| 59 | Ga0070687_100044734 | 3300005343 | Unclassified | 2257 |
| 60 | Ga0070673_100001414 | 3300005364 | Bacteria | 14048 |
| 61 | Ga0070659_100002930 | 3300005366 | Bacteria | 12162 |
| 62 | Ga0070659_100005603 | 3300005366 | Bacteria | 9028 |
| 63 | Ga0070659_100017855 | 3300005366 | Bacteria | 5345 |
| 64 | Ga0070659_100052142 | 3300005366 | Bacteria | 3217 |
| 65 | Ga0070659_100119298 | 3300005366 | Unclassified | 2135 |
| 66 | Ga0070659_100211126 | 3300005366 | Bacteria | 1600 |
| 67 | Ga0070663_100011342 | 3300005455 | Bacteria | 5591 |
| 68 | Ga0070698_100021191 | 3300005471 | Bacteria | 6811 |
| 69 | Ga0070679_100015145 | 3300005530 | Bacteria | 7410 |
| 70 | Ga0070679_100049058 | 3300005530 | Unclassified | 4205 |
| 71 | Ga0068853_100000568 | 3300005539 | Bacteria | 25297 |
| 72 | Ga0068853_100030399 | 3300005539 | Unclassified | 4562 |
| 73 | Ga0068853_100035355 | 3300005539 | Bacteria | 4243 |
| 74 | Ga0068853_100065925 | 3300005539 | Bacteria | 3143 |
| 75 | Ga0068853_100105444 | 3300005539 | Bacteria | 2497 |
| 76 | Ga0070672_100093686 | 3300005543 | Unclassified | 2427 |
| 77 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 78 | Ga0070665_100000041 | 3300005548 | Bacteria | 297849 |
| 79 | Ga0068855_100000229 | 3300005563 | Bacteria | 71835 |
| 80 | Ga0068855_100000730 | 3300005563 | Bacteria | 40377 |
| 81 | Ga0068855_100001155 | 3300005563 | Bacteria | 32713 |
| 82 | Ga0068855_100004742 | 3300005563 | Bacteria | 16601 |
| 83 | Ga0068855_100025359 | 3300005563 | Bacteria | 7095 |
| 84 | Ga0068855_100027449 | 3300005563 | Bacteria | 6810 |
| 85 | Ga0068855_100041961 | 3300005563 | Bacteria | 5421 |
| 86 | Ga0068855_100082527 | 3300005563 | Bacteria | 3725 |
| 87 | Ga0068855_100114663 | 3300005563 | Bacteria | 3089 |
| 88 | Ga0068855_100161791 | 3300005563 | Bacteria | 2540 |
| 89 | Ga0068855_100224911 | 3300005563 | Bacteria | 2103 |
| 90 | Ga0068855_100292695 | 3300005563 | Bacteria | 1805 |
| 91 | Ga0068855_100317541 | 3300005563 | Bacteria | 1723 |
| 92 | Ga0070664_100022082 | 3300005564 | Bacteria | 5248 |
| 93 | Ga0070664_100036987 | 3300005564 | Bacteria | 4103 |
| 94 | Ga0068857_100007826 | 3300005577 | Bacteria | 9215 |
| 95 | Ga0068857_100041959 | 3300005577 | Unclassified | 4057 |
| 96 | Ga0068854_100133307 | 3300005578 | Bacteria | 1899 |
| 97 | Ga0068856_100000924 | 3300005614 | Bacteria | 31455 |
| 98 | Ga0068856_100015341 | 3300005614 | Bacteria | 7404 |
| 99 | Ga0068856_100061198 | 3300005614 | Bacteria | 3719 |
| 100 | Ga0068856_100133462 | 3300005614 | Bacteria | 2488 |
| 101 | Ga0068856_100217644 | 3300005614 | Bacteria | 1925 |
| 102 | Ga0068856_100238683 | 3300005614 | Bacteria | 1833 |
| 103 | Ga0068852_100000306 | 3300005616 | Bacteria | 33010 |
| 104 | Ga0068852_100005366 | 3300005616 | Bacteria | 9163 |
| 105 | Ga0068852_100009267 | 3300005616 | Bacteria | 7296 |
| 106 | Ga0068852_100010690 | 3300005616 | Bacteria | 6872 |
| 107 | Ga0068852_100116130 | 3300005616 | Bacteria | 2441 |
| 108 | Ga0068852_100250932 | 3300005616 | Bacteria | 1695 |
| 109 | Ga0068859_100014625 | 3300005617 | Bacteria | 7883 |
| 110 | Ga0068859_100057873 | 3300005617 | Bacteria | 3904 |
| 111 | Ga0068864_100000976 | 3300005618 | Bacteria | 23994 |
| 112 | Ga0068870_10009858 | 3300005840 | Bacteria | 4362 |
| 113 | Ga0068863_100215079 | 3300005841 | Unclassified | 1851 |
| 114 | Ga0068863_100281138 | 3300005841 | Unclassified | 1612 |
| 115 | Ga0068860_100000491 | 3300005843 | Bacteria | 48922 |
| 116 | Ga0075366_10136009 | 3300006195 | Bacteria | 1484 |
| 117 | Ga0097621_100000369 | 3300006237 | Bacteria | 31242 |
| 118 | Ga0097621_100133834 | 3300006237 | Bacteria | 2112 |
| 119 | Ga0068871_100000513 | 3300006358 | Bacteria | 26609 |
| 120 | Ga0068865_100000133 | 3300006881 | Bacteria | 38624 |
| 121 | Ga0068865_100000310 | 3300006881 | Bacteria | 26942 |
| 122 | Ga0097620_100014625 | 3300006931 | Bacteria | 7883 |
| 123 | Ga0097620_100057874 | 3300006931 | Bacteria | 3904 |
| 124 | Ga0105240_10000126 | 3300009093 | Bacteria | 157403 |
| 125 | Ga0105240_10000147 | 3300009093 | Bacteria | 142340 |
| 126 | Ga0105240_10000168 | 3300009093 | Bacteria | 133212 |
| 127 | Ga0105240_10001469 | 3300009093 | Bacteria | 40290 |
| 128 | Ga0105240_10001927 | 3300009093 | Bacteria | 34500 |
| 129 | Ga0105240_10004968 | 3300009093 | Bacteria | 19989 |
| 130 | Ga0105240_10005895 | 3300009093 | Bacteria | 18149 |
| 131 | Ga0105240_10021127 | 3300009093 | Bacteria | 8664 |
| 132 | Ga0105240_10025982 | 3300009093 | Bacteria | 7691 |
| 133 | Ga0105240_10039408 | 3300009093 | Bacteria | 6050 |
| 134 | Ga0105240_10081685 | 3300009093 | Unclassified | 3971 |
| 135 | Ga0111539_10178610 | 3300009094 | Bacteria | 2480 |
| 136 | Ga0114129_10007293 | 3300009147 | Bacteria | 15742 |
| 137 | Ga0105241_10000270 | 3300009174 | Bacteria | 38746 |
| 138 | Ga0105241_10001046 | 3300009174 | Bacteria | 21092 |
| 139 | Ga0105241_10001279 | 3300009174 | Bacteria | 19207 |
| 140 | Ga0105241_10020689 | 3300009174 | Bacteria | 4862 |
| 141 | Ga0105241_10046684 | 3300009174 | Bacteria | 3290 |
| 142 | Ga0105241_10075341 | 3300009174 | Bacteria | 2629 |
| 143 | Ga0105241_10076742 | 3300009174 | Bacteria | 2607 |
| 144 | Ga0105242_10172967 | 3300009176 | Bacteria | 1899 |
| 145 | Ga0105237_10000206 | 3300009545 | Bacteria | 84005 |
| 146 | Ga0105237_10000263 | 3300009545 | Bacteria | 74133 |
| 147 | Ga0105237_10000504 | 3300009545 | Bacteria | 55287 |
| 148 | Ga0105237_10000962 | 3300009545 | Bacteria | 38751 |
| 149 | Ga0105237_10000993 | 3300009545 | Bacteria | 38153 |
| 150 | Ga0105237_10002695 | 3300009545 | Bacteria | 21736 |
| 151 | Ga0105237_10003064 | 3300009545 | Bacteria | 20158 |
| 152 | Ga0105237_10003527 | 3300009545 | Bacteria | 18543 |
| 153 | Ga0105237_10004889 | 3300009545 | Bacteria | 15348 |
| 154 | Ga0105237_10005709 | 3300009545 | Bacteria | 13993 |
| 155 | Ga0105237_10007620 | 3300009545 | Bacteria | 11833 |
| 156 | Ga0105237_10012639 | 3300009545 | Bacteria | 8888 |
| 157 | Ga0105237_10031241 | 3300009545 | Bacteria | 5401 |
| 158 | Ga0105237_10033780 | 3300009545 | Bacteria | 5182 |
| 159 | Ga0105237_10044219 | 3300009545 | Bacteria | 4484 |
| 160 | Ga0105238_10001257 | 3300009551 | Bacteria | 25488 |
| 161 | Ga0105238_10039594 | 3300009551 | Bacteria | 4779 |
| 162 | Ga0105238_10050024 | 3300009551 | Bacteria | 4208 |
| 163 | Ga0105238_10062583 | 3300009551 | Bacteria | 3721 |
| 164 | Ga0105238_10066158 | 3300009551 | Bacteria | 3616 |
| 165 | Ga0105239_10000016 | 3300010375 | Bacteria | 293142 |
| 166 | Ga0105239_10000021 | 3300010375 | Bacteria | 259369 |
| 167 | Ga0105239_10000101 | 3300010375 | Bacteria | 119610 |
| 168 | Ga0105239_10000718 | 3300010375 | Bacteria | 47004 |
| 169 | Ga0105239_10000896 | 3300010375 | Bacteria | 42315 |
| 170 | Ga0105239_10001035 | 3300010375 | Bacteria | 38751 |
| 171 | Ga0105239_10004693 | 3300010375 | Bacteria | 16230 |
| 172 | Ga0105239_10009228 | 3300010375 | Bacteria | 11158 |
| 173 | Ga0105239_10016300 | 3300010375 | Bacteria | 8216 |
| 174 | Ga0105239_10028055 | 3300010375 | Bacteria | 6195 |
| 175 | Ga0105239_10032473 | 3300010375 | Bacteria | 5736 |
| 176 | Ga0105239_10046003 | 3300010375 | Bacteria | 4782 |
| 177 | Ga0105239_10087590 | 3300010375 | Bacteria | 3432 |
| 178 | Ga0157373_10000015 | 3300013100 | Bacteria | 183381 |
| 179 | Ga0157373_10000018 | 3300013100 | Bacteria | 169293 |
| 180 | Ga0157373_10023122 | 3300013100 | Bacteria | 4507 |
| 181 | Ga0157373_10029427 | 3300013100 | Unclassified | 3956 |
| 182 | Ga0157371_10000542 | 3300013102 | Bacteria | 44953 |
| 183 | Ga0157371_10003393 | 3300013102 | Bacteria | 14471 |
| 184 | Ga0157371_10005101 | 3300013102 | Bacteria | 11201 |
| 185 | Ga0157371_10006506 | 3300013102 | Bacteria | 9622 |
| 186 | Ga0157371_10006762 | 3300013102 | Bacteria | 9375 |
| 187 | Ga0157371_10007304 | 3300013102 | Bacteria | 8973 |
| 188 | Ga0157371_10011939 | 3300013102 | Bacteria | 6661 |
| 189 | Ga0157371_10015963 | 3300013102 | Bacteria | 5617 |
| 190 | Ga0157371_10105727 | 3300013102 | Bacteria | 1997 |
| 191 | Ga0157371_10112929 | 3300013102 | Bacteria | 1929 |
| 192 | Ga0157370_10000446 | 3300013104 | Bacteria | 51488 |
| 193 | Ga0157370_10000474 | 3300013104 | Bacteria | 50140 |
| 194 | Ga0157370_10003898 | 3300013104 | Bacteria | 17381 |
| 195 | Ga0157370_10011410 | 3300013104 | Bacteria | 9296 |
| 196 | Ga0157370_10032312 | 3300013104 | Bacteria | 5111 |
| 197 | Ga0157370_10037479 | 3300013104 | Bacteria | 4700 |
| 198 | Ga0157370_10081785 | 3300013104 | Bacteria | 3039 |
| 199 | Ga0157370_10152118 | 3300013104 | Unclassified | 2153 |
| 200 | Ga0157370_10200872 | 3300013104 | Bacteria | 1849 |
| 201 | Ga0157370_10215892 | 3300013104 | Bacteria | 1777 |
| 202 | Ga0157369_10000439 | 3300013105 | Bacteria | 55404 |
| 203 | Ga0157369_10009068 | 3300013105 | Bacteria | 11387 |
| 204 | Ga0157369_10014339 | 3300013105 | Bacteria | 8949 |
| 205 | Ga0157369_10080377 | 3300013105 | Bacteria | 3491 |
| 206 | Ga0157369_10098984 | 3300013105 | Bacteria | 3109 |
| 207 | Ga0157369_10268440 | 3300013105 | Bacteria | 1778 |
| 208 | Ga0157369_10296272 | 3300013105 | Bacteria | 1683 |
| 209 | Ga0157374_10000599 | 3300013296 | Bacteria | 31938 |
| 210 | Ga0157374_10014904 | 3300013296 | Bacteria | 6813 |
| 211 | Ga0157378_10011362 | 3300013297 | Bacteria | 7794 |
| 212 | Ga0157378_10029309 | 3300013297 | Bacteria | 4859 |
| 213 | Ga0163162_10000026 | 3300013306 | Bacteria | 178701 |
| 214 | Ga0163162_10000778 | 3300013306 | Bacteria | 29690 |
| 215 | Ga0163162_10001178 | 3300013306 | Bacteria | 24409 |
| 216 | Ga0163162_10002670 | 3300013306 | Bacteria | 16914 |
| 217 | Ga0163162_10053450 | 3300013306 | Bacteria | 4060 |
| 218 | Ga0157372_10000015 | 3300013307 | Bacteria | 225365 |
| 219 | Ga0157372_10000346 | 3300013307 | Bacteria | 51170 |
| 220 | Ga0157372_10000680 | 3300013307 | Bacteria | 37376 |
| 221 | Ga0157372_10000735 | 3300013307 | Bacteria | 35709 |
| 222 | Ga0157372_10002159 | 3300013307 | Bacteria | 21396 |
| 223 | Ga0157372_10003320 | 3300013307 | Bacteria | 17386 |
| 224 | Ga0157372_10008802 | 3300013307 | Bacteria | 10719 |
| 225 | Ga0157372_10013232 | 3300013307 | Bacteria | 8806 |
| 226 | Ga0157372_10022589 | 3300013307 | Bacteria | 6808 |
| 227 | Ga0157372_10051670 | 3300013307 | Bacteria | 4574 |
| 228 | Ga0157372_10062482 | 3300013307 | Bacteria | 4173 |
| 229 | Ga0157372_10092533 | 3300013307 | Bacteria | 3440 |
| 230 | Ga0157372_10119225 | 3300013307 | Bacteria | 3029 |
| 231 | Ga0157372_10265952 | 3300013307 | Bacteria | 1991 |
| 232 | Ga0157372_10296187 | 3300013307 | Bacteria | 1881 |
| 233 | Ga0157375_10347838 | 3300013308 | Bacteria | 1648 |
| 234 | Ga0157380_10011724 | 3300014326 | Bacteria | 6338 |
| 235 | Ga0182008_10000001 | 3300014497 | Bacteria | 540790 |
| 236 | Ga0157376_10123309 | 3300014969 | Bacteria | 2300 |
| 237 | Ga0182006_1002670 | 3300015261 | Bacteria | 9599 |
| 238 | Ga0182006_1027607 | 3300015261 | Bacteria | 2315 |
| 239 | Ga0182005_1000202 | 3300015265 | Bacteria | 40206 |
| 240 | Ga0163161_10000365 | 3300017792 | Bacteria | 37837 |
| 241 | Ga0163161_10103835 | 3300017792 | Bacteria | 2118 |
| 242 | Ga0207427_100219 | 3300025231 | Bacteria | 49678 |
| 243 | Ga0209437_100077 | 3300025233 | Bacteria | 286656 |
| 244 | Ga0209437_100363 | 3300025233 | Bacteria | 49686 |
| 245 | Ga0209258_100282 | 3300025242 | Bacteria | 85032 |
| 246 | Ga0209026_1000357 | 3300025250 | Bacteria | 43020 |
| 247 | Ga0209026_1002923 | 3300025250 | Bacteria | 5987 |
| 248 | Ga0209026_1008946 | 3300025250 | Bacteria | 2026 |
| 249 | Ga0209148_1000247 | 3300025254 | Bacteria | 86505 |
| 250 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 251 | Ga0209455_1009419 | 3300025272 | Bacteria | 2568 |
| 252 | Ga0209676_1000042 | 3300025292 | Bacteria | 424130 |
| 253 | Ga0209050_1000035 | 3300025298 | Bacteria | 424005 |
| 254 | Ga0207426_1000170 | 3300025302 | Bacteria | 164216 |
| 255 | Ga0209257_1000071 | 3300025304 | Bacteria | 335832 |
| 256 | Ga0207656_10049877 | 3300025321 | Bacteria | 1806 |
| 257 | Ga0207642_10082507 | 3300025899 | Unclassified | 1565 |
| 258 | Ga0207647_10000574 | 3300025904 | Bacteria | 28662 |
| 259 | Ga0207647_10002245 | 3300025904 | Bacteria | 14722 |
| 260 | Ga0207645_10000440 | 3300025907 | Bacteria | 34498 |
| 261 | Ga0207643_10021862 | 3300025908 | Bacteria | 3519 |
| 262 | Ga0207643_10027656 | 3300025908 | Bacteria | 3145 |
| 263 | Ga0207705_10000482 | 3300025909 | Bacteria | 34233 |
| 264 | Ga0207705_10076584 | 3300025909 | Unclassified | 2432 |
| 265 | Ga0207654_10000184 | 3300025911 | Bacteria | 38751 |
| 266 | Ga0207654_10043669 | 3300025911 | Unclassified | 2542 |
| 267 | Ga0207707_10003153 | 3300025912 | Bacteria | 14634 |
| 268 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 269 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 270 | Ga0207695_10000031 | 3300025913 | Bacteria | 526801 |
| 271 | Ga0207695_10001274 | 3300025913 | Bacteria | 42874 |
| 272 | Ga0207695_10001380 | 3300025913 | Bacteria | 41073 |
| 273 | Ga0207695_10027307 | 3300025913 | Bacteria | 6358 |
| 274 | Ga0207695_10057140 | 3300025913 | Bacteria | 4056 |
| 275 | Ga0207695_10093616 | 3300025913 | Bacteria | 3014 |
| 276 | Ga0207695_10100449 | 3300025913 | Bacteria | 2889 |
| 277 | Ga0207671_10000297 | 3300025914 | Bacteria | 73234 |
| 278 | Ga0207671_10000316 | 3300025914 | Bacteria | 71241 |
| 279 | Ga0207671_10000957 | 3300025914 | Bacteria | 35834 |
| 280 | Ga0207671_10002372 | 3300025914 | Bacteria | 20248 |
| 281 | Ga0207671_10002996 | 3300025914 | Bacteria | 17314 |
| 282 | Ga0207671_10004115 | 3300025914 | Bacteria | 14064 |
| 283 | Ga0207671_10004574 | 3300025914 | Bacteria | 13145 |
| 284 | Ga0207671_10008091 | 3300025914 | Bacteria | 8978 |
| 285 | Ga0207671_10014013 | 3300025914 | Bacteria | 6360 |
| 286 | Ga0207671_10016757 | 3300025914 | Bacteria | 5683 |
| 287 | Ga0207671_10018858 | 3300025914 | Bacteria | 5287 |
| 288 | Ga0207671_10021557 | 3300025914 | Bacteria | 4885 |
| 289 | Ga0207671_10059448 | 3300025914 | Bacteria | 2834 |
| 290 | Ga0207671_10099726 | 3300025914 | Unclassified | 2198 |
| 291 | Ga0207660_10006527 | 3300025917 | Bacteria | 7567 |
| 292 | Ga0207660_10038208 | 3300025917 | Unclassified | 3350 |
| 293 | Ga0207662_10046259 | 3300025918 | Bacteria | 2574 |
| 294 | Ga0207657_10004064 | 3300025919 | Bacteria | 15524 |
| 295 | Ga0207657_10023840 | 3300025919 | Bacteria | 5687 |
| 296 | Ga0207657_10034672 | 3300025919 | Unclassified | 4535 |
| 297 | Ga0207652_10004993 | 3300025921 | Bacteria | 10746 |
| 298 | Ga0207652_10005780 | 3300025921 | Bacteria | 10036 |
| 299 | Ga0207652_10009935 | 3300025921 | Bacteria | 7660 |
| 300 | Ga0207694_10002091 | 3300025924 | Bacteria | 16492 |
| 301 | Ga0207694_10032463 | 3300025924 | Bacteria | 3996 |
| 302 | Ga0207694_10087572 | 3300025924 | Bacteria | 2453 |
| 303 | Ga0207690_10000759 | 3300025932 | Bacteria | 20828 |
| 304 | Ga0207690_10024572 | 3300025932 | Bacteria | 3775 |
| 305 | Ga0207690_10044117 | 3300025932 | Bacteria | 2938 |
| 306 | Ga0207690_10178620 | 3300025932 | Unclassified | 1596 |
| 307 | Ga0207670_10151819 | 3300025936 | Bacteria | 1720 |
| 308 | Ga0207669_10088833 | 3300025937 | Bacteria | 2005 |
| 309 | Ga0207704_10000010 | 3300025938 | Bacteria | 188125 |
| 310 | Ga0207704_10000120 | 3300025938 | Bacteria | 42425 |
| 311 | Ga0207691_10064987 | 3300025940 | Unclassified | 3304 |
| 312 | Ga0207689_10045659 | 3300025942 | Unclassified | 3622 |
| 313 | Ga0207679_10042790 | 3300025945 | Bacteria | 3257 |
| 314 | Ga0207679_10102257 | 3300025945 | Unclassified | 2243 |
| 315 | Ga0207667_10000197 | 3300025949 | Bacteria | 87987 |
| 316 | Ga0207667_10001217 | 3300025949 | Bacteria | 32222 |
| 317 | Ga0207667_10010389 | 3300025949 | Bacteria | 10882 |
| 318 | Ga0207667_10021359 | 3300025949 | Bacteria | 7173 |
| 319 | Ga0207667_10039748 | 3300025949 | Bacteria | 5011 |
| 320 | Ga0207667_10091830 | 3300025949 | Bacteria | 3136 |
| 321 | Ga0207667_10107289 | 3300025949 | Bacteria | 2881 |
| 322 | Ga0207667_10216366 | 3300025949 | Bacteria | 1963 |
| 323 | Ga0207667_10274631 | 3300025949 | Bacteria | 1723 |
| 324 | Ga0207651_10003447 | 3300025960 | Bacteria | 7772 |
| 325 | Ga0207712_10102919 | 3300025961 | Bacteria | 2127 |
| 326 | Ga0207677_10015405 | 3300026023 | Bacteria | 4497 |
| 327 | Ga0207677_10049302 | 3300026023 | Bacteria | 2840 |
| 328 | Ga0207703_10043478 | 3300026035 | Bacteria | 3606 |
| 329 | Ga0207639_10014162 | 3300026041 | Bacteria | 5600 |
| 330 | Ga0207678_10160399 | 3300026067 | Bacteria | 1921 |
| 331 | Ga0207702_10034225 | 3300026078 | Bacteria | 4247 |
| 332 | Ga0207702_10059707 | 3300026078 | Bacteria | 3249 |
| 333 | Ga0207702_10091360 | 3300026078 | Bacteria | 2665 |
| 334 | Ga0207702_10166085 | 3300026078 | Bacteria | 2019 |
| 335 | Ga0207702_10179635 | 3300026078 | Bacteria | 1948 |
| 336 | Ga0207648_10002447 | 3300026089 | Bacteria | 19963 |
| 337 | Ga0207648_10035278 | 3300026089 | Bacteria | 4407 |
| 338 | Ga0207676_10016416 | 3300026095 | Bacteria | 5362 |
| 339 | Ga0207674_10008302 | 3300026116 | Bacteria | 12020 |
| 340 | Ga0207674_10014223 | 3300026116 | Bacteria | 8793 |
| 341 | Ga0207674_10208217 | 3300026116 | Unclassified | 1905 |
| 342 | Ga0207675_100243099 | 3300026118 | Unclassified | 1740 |
| 343 | Ga0207698_10003067 | 3300026142 | Bacteria | 10013 |
| 344 | Ga0207698_10026144 | 3300026142 | Bacteria | 4126 |
| 345 | Ga0207698_10086354 | 3300026142 | Bacteria | 2551 |
| 346 | Ga0207698_10107001 | 3300026142 | Bacteria | 2334 |
| 347 | Ga0268266_10000014 | 3300028379 | Bacteria | 644033 |
| 348 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 349 | Ga0268264_10000674 | 3300028381 | Bacteria | 39908 |
| 350 | Ga0307517_10002284 | 3300028786 | Bacteria | 30925 |
| 351 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 352 | Ga0307515_10000280 | 3300028794 | Bacteria | 125330 |
| 353 | Ga0307515_10003886 | 3300028794 | Bacteria | 31200 |
| 354 | Ga0307515_10063752 | 3300028794 | Bacteria | 5167 |
| 355 | Ga0307511_10000264 | 3300030521 | Bacteria | 54303 |
| 356 | Ga0316176_1048616 | 3300030732 | Bacteria | 40116 |
| 357 | Ga0316183_1018086 | 3300030742 | Bacteria | 5775 |
| 358 | Ga0316181_1069399 | 3300030744 | Bacteria | 5011 |
| 359 | Ga0265327_10000411 | 3300031251 | Bacteria | 78751 |
| 360 | Ga0307513_10071485 | 3300031456 | Bacteria | 3621 |
| 361 | Ga0307513_10110373 | 3300031456 | Bacteria | 2746 |
| 362 | Ga0307509_10018041 | 3300031507 | Bacteria | 8103 |
| 363 | Ga0307509_10045122 | 3300031507 | Bacteria | 4757 |
| 364 | Ga0307408_100001128 | 3300031548 | Bacteria | 20333 |
| 365 | Ga0307408_100001139 | 3300031548 | Bacteria | 20205 |
| 366 | Ga0307408_100002494 | 3300031548 | Bacteria | 12880 |
| 367 | Ga0307508_10000644 | 3300031616 | Bacteria | 42035 |
| 368 | Ga0316576_10061672 | 3300031727 | Bacteria | 2749 |
| 369 | Ga0307516_10000656 | 3300031730 | Bacteria | 46771 |
| 370 | Ga0307516_10144430 | 3300031730 | Bacteria | 2146 |
| 371 | Ga0307405_10000046 | 3300031731 | Bacteria | 71442 |
| 372 | Ga0307405_10015870 | 3300031731 | Bacteria | 4092 |
| 373 | Ga0307412_10000017 | 3300031911 | Bacteria | 294698 |
| 374 | Ga0307412_10002541 | 3300031911 | Bacteria | 10141 |
| 375 | Ga0307414_10001044 | 3300032004 | Bacteria | 14161 |
| 376 | Ga0307414_10005303 | 3300032004 | Bacteria | 7086 |
| 377 | Ga0307414_10155409 | 3300032004 | Bacteria | 1810 |
| 378 | Ga0307507_10001142 | 3300033179 | Bacteria | 58894 |
| 379 | Ga0307510_10009647 | 3300033180 | Bacteria | 11505 |
| 380 | Ga0307510_10033263 | 3300033180 | Bacteria | 5794 |
| 381 | Ga0316584_0124463 | 3300036712 | Bacteria | 1926 |
| 382 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 383 | Ga0395899_0000181 | 3300037312 | Bacteria | 92672 |
| 384 | Ga0395899_0000717 | 3300037312 | Bacteria | 33215 |
| 385 | Ga0395899_0000806 | 3300037312 | Bacteria | 30625 |
| 386 | Ga0395899_0004001 | 3300037312 | Bacteria | 11614 |
| 387 | Ga0395899_0005474 | 3300037312 | Bacteria | 9847 |
| 388 | Ga0395899_0100112 | 3300037312 | Bacteria | 2093 |
| 389 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 390 | Ga0395900_0002459 | 3300037418 | Bacteria | 20402 |
| 391 | Ga0395900_0005331 | 3300037418 | Bacteria | 13474 |
| 392 | Ga0395900_0009414 | 3300037418 | Bacteria | 10015 |
| 393 | Ga0395900_0012319 | 3300037418 | Bacteria | 8748 |
| 394 | Ga0395900_0099969 | 3300037418 | Bacteria | 2979 |
| 395 | Ga0395900_0125910 | 3300037418 | Bacteria | 2628 |
| 396 | Ga0395900_0211550 | 3300037418 | Bacteria | 1958 |
| 397 | Ga0395900_0281162 | 3300037418 | Unclassified | 1656 |
| 398 | Ga0395898_0002747 | 3300037466 | Bacteria | 20291 |
| 399 | Ga0395898_0009073 | 3300037466 | Bacteria | 10472 |
| 400 | Ga0395898_0015129 | 3300037466 | Bacteria | 7918 |
| 401 | Ga0395898_0105748 | 3300037466 | Bacteria | 2699 |
| 402 | Ga0395898_0238949 | 3300037466 | Bacteria | 1733 |
| 403 | Ga0395905_0000037 | 3300037471 | Bacteria | 261808 |
| 404 | Ga0395905_0000819 | 3300037471 | Bacteria | 40842 |
| 405 | Ga0395905_0001794 | 3300037471 | Bacteria | 24895 |
| 406 | Ga0395901_0000219 | 3300038443 | Bacteria | 71884 |
| 407 | Ga0395901_0002632 | 3300038443 | Bacteria | 18151 |
| 408 | Ga0395901_0008449 | 3300038443 | Bacteria | 10405 |
| 409 | Ga0395901_0025905 | 3300038443 | Bacteria | 6023 |
| 410 | Ga0395901_0051155 | 3300038443 | Bacteria | 4294 |
| 411 | Ga0400483_016155 | 3300039062 | Bacteria | 13502 |
| 412 | Ga0400483_231526 | 3300039062 | Bacteria | 9538 |
| 413 | Ga0439445_0011601 | 3300042004 | Bacteria | 2105 |
| 414 | Ga0439457_027749 | 3300042014 | Bacteria | 1253 |
| 415 | Ga0439462_0009518 | 3300042015 | Bacteria | 2457 |
| 416 | Ga0439462_0042735 | 3300042015 | Bacteria | 1211 |
| 417 | Ga0439434_0009670 | 3300042435 | Bacteria | 2835 |
| 418 | Ga0451577_0025309 | 3300042876 | Bacteria | 5387 |
| 419 | Ga0451577_0095655 | 3300042876 | Bacteria | 2652 |
| 420 | Ga0466969_0000052 | 3300044656 | Bacteria | 60425 |
| 421 | Ga0466972_0000008 | 3300044658 | Bacteria | 264518 |
| 422 | Ga0466972_0000020 | 3300044658 | Bacteria | 197336 |
| 423 | Ga0466972_0001211 | 3300044658 | Bacteria | 12411 |
| 424 | Ga0466972_0007337 | 3300044658 | Bacteria | 5537 |
| 425 | Ga0466966_0005448 | 3300044684 | Bacteria | 8368 |
| 426 | Ga0466966_0056036 | 3300044684 | Bacteria | 2494 |
| 427 | Ga0466966_0074066 | 3300044684 | Bacteria | 2129 |
| 428 | Ga0466961_0021074 | 3300044693 | Bacteria | 4195 |
| 429 | Ga0453684_0007582 | 3300044712 | Bacteria | 19895 |
| 430 | Ga0453684_0030621 | 3300044712 | Bacteria | 7596 |
| 431 | Ga0453684_0041284 | 3300044712 | Bacteria | 6245 |
| 432 | Ga0453684_0066924 | 3300044712 | Bacteria | 4572 |
| 433 | Ga0453684_0143333 | 3300044712 | Bacteria | 2849 |
| 434 | Ga0453684_0249062 | 3300044712 | Bacteria | 2041 |
| 435 | Ga0466971_0004044 | 3300044719 | Bacteria | 6309 |
| 436 | Ga0466957_0000239 | 3300044842 | Bacteria | 26161 |
| 437 | Ga0466957_0015641 | 3300044842 | Bacteria | 4433 |
| 438 | Ga0466957_0030262 | 3300044842 | Bacteria | 3232 |
| 439 | Ga0466959_0000084 | 3300045049 | Bacteria | 59368 |
| 440 | Ga0466959_0002016 | 3300045049 | Bacteria | 12821 |
| 441 | Ga0451576_0037096 | 3300045051 | Bacteria | 5164 |
| 442 | Ga0466958_0051875 | 3300045836 | Bacteria | 2485 |
| 443 | Ga0495627_022022 | 3300046453 | Unclassified | 2101 |
| 444 | Ga0495638_0046190 | 3300046460 | Unclassified | 2737 |
| 445 | Ga0495650_0000231 | 3300046471 | Bacteria | 113969 |
| 446 | Ga0495650_0029554 | 3300046471 | Bacteria | 2497 |
| 447 | Ga0495585_0000037 | 3300046492 | Bacteria | 133335 |
| 448 | Ga0495585_0015075 | 3300046492 | Bacteria | 4493 |
| 449 | Ga0495596_0029183 | 3300046500 | Bacteria | 2213 |
| 450 | Ga0495606_0000060 | 3300046507 | Bacteria | 185907 |
| 451 | Ga0495606_0005180 | 3300046507 | Bacteria | 12610 |
| 452 | Ga0495606_0005353 | 3300046507 | Bacteria | 12323 |
| 453 | Ga0495606_0099225 | 3300046507 | Bacteria | 1776 |
| 454 | Ga0495610_0000093 | 3300046512 | Bacteria | 105873 |
| 455 | Ga0495616_0008927 | 3300046513 | Bacteria | 5891 |
| 456 | Ga0495631_0038658 | 3300046518 | Unclassified | 2120 |
| 457 | Ga0495637_0022196 | 3300046520 | Bacteria | 2899 |
| 458 | Ga0495648_0004193 | 3300046524 | Bacteria | 12383 |
| 459 | Ga0495648_0019829 | 3300046524 | Bacteria | 4710 |
| 460 | Ga0495652_0219171 | 3300046529 | Unclassified | 1431 |
| 461 | Ga0495598_0011499 | 3300046537 | Bacteria | 2149 |
| 462 | Ga0495609_0014279 | 3300046538 | Bacteria | 3738 |
| 463 | Ga0495622_0035607 | 3300046557 | Bacteria | 2321 |
| 464 | Ga0495633_0000023 | 3300046558 | Bacteria | 226510 |
| 465 | Ga0495633_0000641 | 3300046558 | Bacteria | 32663 |
| 466 | Ga0495668_0000012 | 3300046616 | Bacteria | 458817 |
| 467 | Ga0495668_0020335 | 3300046616 | Bacteria | 3819 |
| 468 | Ga0495611_0000100 | 3300046648 | Bacteria | 59688 |
| 469 | Ga0495625_0000191 | 3300046660 | Bacteria | 97363 |
| 470 | Ga0495625_0001093 | 3300046660 | Bacteria | 35233 |
| 471 | Ga0495625_0001735 | 3300046660 | Bacteria | 25214 |
| 472 | Ga0495625_0090399 | 3300046660 | Bacteria | 2118 |
| 473 | Ga0495625_0098709 | 3300046660 | Bacteria | 2008 |
| 474 | Ga0495661_0002843 | 3300046665 | Bacteria | 13106 |
| 475 | Ga0495661_0010372 | 3300046665 | Bacteria | 6359 |
| 476 | Ga0495649_0000010 | 3300046694 | Bacteria | 430552 |
| 477 | Ga0495649_0000061 | 3300046694 | Bacteria | 97338 |
| 478 | Ga0495683_0030179 | 3300047323 | Bacteria | 2767 |
| 479 | Ga0495687_000144 | 3300047443 | Bacteria | 108217 |
| 480 | Ga0495687_002703 | 3300047443 | Bacteria | 13756 |
| 481 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 482 | Ga0495686_0000071 | 3300047472 | Bacteria | 216594 |
| 483 | Ga0495686_0026706 | 3300047472 | Unclassified | 3777 |
| 484 | Ga0495686_0031208 | 3300047472 | Bacteria | 3457 |
| 485 | Ga0495686_0038489 | 3300047472 | Unclassified | 3058 |
| 486 | Ga0495686_0045132 | 3300047472 | Bacteria | 2789 |
| 487 | Ga0496121_0000026 | 3300048924 | Bacteria | 450157 |
| 488 | Ga0496122_0001373 | 3300048925 | Bacteria | 39623 |
| 489 | Ga0496123_0010050 | 3300048926 | Bacteria | 8424 |
| 490 | Ga0496125_0050779 | 3300048928 | Bacteria | 3430 |
| 491 | Ga0496126_0116479 | 3300048929 | Bacteria | 2322 |
| 492 | Ga0495678_004082 | 3300049459 | Bacteria | 8658 |
| 493 | Ga0501033_0033698 | 3300049570 | Bacteria | 3845 |
| 494 | Ga0501033_0061896 | 3300049570 | Bacteria | 2757 |
| 495 | Ga0501033_0162912 | 3300049570 | Bacteria | 1605 |
| 496 | Ga0501034_0047009 | 3300049571 | Unclassified | 4359 |
| 497 | Ga0501034_0102587 | 3300049571 | Bacteria | 2854 |
| 498 | Ga0501034_0115052 | 3300049571 | Unclassified | 2678 |
| 499 | Ga0501039_0211589 | 3300049575 | Bacteria | 1525 |
| 500 | Ga0501047_0061473 | 3300049581 | Bacteria | 3624 |
| 501 | Ga0501219_000091 | 3300049703 | Bacteria | 15479 |
| 502 | Ga0501225_0000313 | 3300049705 | Bacteria | 15194 |
| 503 | Ga0501044_0116710 | 3300049823 | Bacteria | 2674 |
| 504 | Ga0501284_00037 | 3300050005 | Bacteria | 55085 |
| 505 | nmdc:mga0k408_1220_c1 | 3300050493 | Bacteria | 14082 |
| 506 | nmdc:mga05p37_5208_c1 | 3300050507 | Bacteria | 15258 |
| 507 | Ga0500578_0000024 | 3300053086 | Bacteria | 151503 |
| 508 | Ga0500578_0033161 | 3300053086 | Bacteria | 3320 |
| 509 | Ga0500644_0000567 | 3300053088 | Bacteria | 14501 |
| 510 | Ga0500646_0016329 | 3300053090 | Bacteria | 1938 |
| 511 | Ga0500583_0000058 | 3300053092 | Bacteria | 68363 |
| 512 | Ga0500583_0002307 | 3300053092 | Bacteria | 5704 |
| 513 | Ga0500651_0000451 | 3300053093 | Bacteria | 21958 |
| 514 | Ga0500569_001611 | 3300053109 | Bacteria | 4283 |
| 515 | Ga0500607_017620 | 3300053121 | Bacteria | 4072 |
| 516 | Ga0500618_000013 | 3300053125 | Bacteria | 183026 |
| 517 | Ga0500642_0019392 | 3300053130 | Bacteria | 2652 |
| 518 | Ga0500652_052105 | 3300053131 | Bacteria | 1673 |
| 519 | Ga0500658_0002777 | 3300053134 | Bacteria | 6727 |
| 520 | Ga0500559_0016035 | 3300053136 | Bacteria | 3165 |
| 521 | Ga0500559_0017951 | 3300053136 | Bacteria | 2991 |
| 522 | Ga0500577_0000506 | 3300053142 | Bacteria | 10029 |
| 523 | Ga0500616_0059090 | 3300053153 | Bacteria | 1992 |
| 524 | Ga0500622_0000199 | 3300053156 | Bacteria | 63518 |
| 525 | Ga0500622_0000676 | 3300053156 | Bacteria | 30139 |
| 526 | Ga0500622_0001133 | 3300053156 | Bacteria | 22246 |
| 527 | Ga0500622_0001437 | 3300053156 | Bacteria | 19111 |
| 528 | Ga0500622_0019691 | 3300053156 | Bacteria | 3582 |
| 529 | Ga0500633_0009438 | 3300053160 | Unclassified | 2566 |
| 530 | Ga0500611_000063 | 3300053727 | Bacteria | 44144 |
| 531 | Ga0466962_0016666 | 3300061719 | Bacteria | 3544 |
| 532 | 2586208828 | 2585427687 | Bacteria | 5544917 |
| 533 | 2599481466 | 2599185184 | Bacteria | 6430550 |
| 534 | 2738729947 | 2738541278 | Bacteria | 9755573 |
| 535 | 2738756180 | 2738541283 | Bacteria | 7222293 |
| 536 | 2738763926 | 2738541284 | Bacteria | 5199923 |
| 537 | 2739616691 | 2739367656 | Bacteria | 5152243 |
| 538 | 2776613601 | 2775506987 | Bacteria | 5373360 |
| 539 | 2819549343 | 2818991437 | Bacteria | 5805520 |
| 540 | 2819577475 | 2818991442 | Bacteria | 8318214 |
| 541 | 2819590128 | 2818991444 | Bacteria | 6968812 |
| 542 | 2821138853 | 2821136567 | Bacteria | 8080116 |
| 543 | 2842726221 | 2842722452 | Bacteria | 6263924 |
| 544 | 2842904141 | 2842903701 | Bacteria | 6986368 |
| 545 | 2842910466 | 2842909656 | Bacteria | 6185908 |
| 546 | 2852623975 | 2852623160 | Bacteria | 4376875 |
| 547 | 2852629740 | 2852627209 | Bacteria | 5896285 |
| 548 | 2883072013 | 2883068021 | Bacteria | 6192739 |
| 549 | 2884937122 | 2884933994 | Bacteria | 4535041 |
| 550 | 2896111097 | 2896109856 | Bacteria | 7140722 |
| 551 | 2896113891 | 2896109856 | Bacteria | 7140722 |
| 552 | 2896346585 | 2896344016 | Bacteria | 3811746 |
| 553 | 2904472568 | 2904467357 | Bacteria | 8057758 |
| 554 | 2919442582 | 2919437846 | Bacteria | 6199444 |
| 555 | 2928082830 | 2928078545 | Bacteria | 6534839 |
| 556 | 2928149848 | 2928147474 | Bacteria | 6512076 |
| 557 | 2929243164 | 2929239360 | Bacteria | 7745570 |
| 558 | 2932086501 | 2932082852 | Bacteria | 6563563 |
| 559 | 2954017702 | 2954016120 | Bacteria | 6446024 |
| 560 | 2958512846 | 2958512119 | Bacteria | 4528530 |
| 561 | 2977234263 | 2977232053 | Bacteria | 5485925 |
| 562 | Ga0157371_10075800 | |||
| 563 | SwRhRL2b_contig_466296 | |||
| 564 | JGI24737J22298_10002220 | |||
| 565 | JGI24735J21928_10000044 | |||
| 566 | JGI25162J39368_1000094 | |||
| 567 | JGI25162J39368_1002229 | |||
| 568 | JGI25165J46597_1001508 | |||
| 569 | rootH1_10000027 | |||
| 570 | rootH1_10005913 | |||
| 571 | rootH1_10028094 | |||
| 572 | rootH1_10076092 | |||
| 573 | rootH2_10001521 | |||
| 574 | rootH2_10035311 | |||
| 575 | rootH2_10096738 | |||
| 576 | rootH2_10200132 | |||
| 577 | rootH2_10257480 | |||
| 578 | rootL2_10006460 | |||
| 579 | rootL2_10108754 | |||
| 580 | rootL2_10173107 | |||
| 581 | rootL2_10193289 | |||
| 582 | rootH1_10004461 | |||
| 583 | rootH1_10005179 | |||
| 584 | rootH1_10100901 | |||
| 585 | rootH1_10112412 | |||
| 586 | rootH1_10157279 | |||
| 587 | rootH1_10161604 | |||
| 588 | JGI25160J50197_1000749 | |||
| 589 | Ga0055535_1001493 | |||
| 590 | Ga0055536_1000008 | |||
| 591 | Ga0055530_10001780 | |||
| 592 | Ga0055531_10000255 | |||
| 593 | Ga0065714_10001936 | |||
| 594 | Ga0065714_10002328 | |||
| 595 | Ga0065714_10002329 | |||
| 596 | Ga0065714_10003211 | |||
| 597 | Ga0065714_10064438 | |||
| 598 | Ga0065714_10079517 | |||
| 599 | Ga0065704_10000199 | |||
| 600 | Ga0065704_10088743 | |||
| 601 | Ga0065712_10005812 | |||
| 602 | Ga0065707_10024861 | |||
| 603 | Ga0070658_10000434 | |||
| 604 | Ga0070676_10000053 | |||
| 605 | Ga0070670_100031914 | |||
| 606 | Ga0070670_100120067 | |||
| 607 | Ga0070680_100020002 | |||
| 608 | Ga0070680_100036987 | |||
| 609 | Ga0070682_100000811 | |||
| 610 | Ga0068868_100005533 | |||
| 611 | Ga0068868_100006338 | |||
| 612 | Ga0070660_100001051 | |||
| 613 | Ga0070660_100021579 | |||
| 614 | Ga0070660_100033914 | |||
| 615 | Ga0070660_100180575 | |||
| 616 | Ga0070689_100098618 | |||
| 617 | Ga0070691_10018412 | |||
| 618 | Ga0070687_100044734 | |||
| 619 | Ga0070673_100001414 | |||
| 620 | Ga0070659_100002930 | |||
| 621 | Ga0070659_100005603 | |||
| 622 | Ga0070659_100017855 | |||
| 623 | Ga0070659_100052142 | |||
| 624 | Ga0070659_100119298 | |||
| 625 | Ga0070659_100211126 | |||
| 626 | Ga0070663_100011342 | |||
| 627 | Ga0070698_100021191 | |||
| 628 | Ga0070679_100015145 | |||
| 629 | Ga0070679_100049058 | |||
| 630 | Ga0068853_100000568 | |||
| 631 | Ga0068853_100030399 | |||
| 632 | Ga0068853_100035355 | |||
| 633 | Ga0068853_100065925 | |||
| 634 | Ga0068853_100105444 | |||
| 635 | Ga0070672_100093686 | |||
| 636 | Ga0070665_100000017 | |||
| 637 | Ga0070665_100000041 | |||
| 638 | Ga0068855_100000229 | |||
| 639 | Ga0068855_100000730 | |||
| 640 | Ga0068855_100001155 | |||
| 641 | Ga0068855_100004742 | |||
| 642 | Ga0068855_100025359 | |||
| 643 | Ga0068855_100027449 | |||
| 644 | Ga0068855_100041961 | |||
| 645 | Ga0068855_100082527 | |||
| 646 | Ga0068855_100114663 | |||
| 647 | Ga0068855_100161791 | |||
| 648 | Ga0068855_100224911 | |||
| 649 | Ga0068855_100292695 | |||
| 650 | Ga0068855_100317541 | |||
| 651 | Ga0070664_100022082 | |||
| 652 | Ga0070664_100036987 | |||
| 653 | Ga0068857_100007826 | |||
| 654 | Ga0068857_100041959 | |||
| 655 | Ga0068854_100133307 | |||
| 656 | Ga0068856_100000924 | |||
| 657 | Ga0068856_100015341 | |||
| 658 | Ga0068856_100061198 | |||
| 659 | Ga0068856_100133462 | |||
| 660 | Ga0068856_100217644 | |||
| 661 | Ga0068856_100238683 | |||
| 662 | Ga0068852_100000306 | |||
| 663 | Ga0068852_100005366 | |||
| 664 | Ga0068852_100009267 | |||
| 665 | Ga0068852_100010690 | |||
| 666 | Ga0068852_100116130 | |||
| 667 | Ga0068852_100250932 | |||
| 668 | Ga0068859_100014625 | |||
| 669 | Ga0068859_100057873 | |||
| 670 | Ga0068864_100000976 | |||
| 671 | Ga0068870_10009858 | |||
| 672 | Ga0068863_100215079 | |||
| 673 | Ga0068863_100281138 | |||
| 674 | Ga0068860_100000491 | |||
| 675 | Ga0075366_10136009 | |||
| 676 | Ga0097621_100000369 | |||
| 677 | Ga0097621_100133834 | |||
| 678 | Ga0068871_100000513 | |||
| 679 | Ga0068865_100000133 | |||
| 680 | Ga0068865_100000310 | |||
| 681 | Ga0097620_100014625 | |||
| 682 | Ga0097620_100057874 | |||
| 683 | Ga0105240_10000126 | |||
| 684 | Ga0105240_10000147 | |||
| 685 | Ga0105240_10000168 | |||
| 686 | Ga0105240_10001469 | |||
| 687 | Ga0105240_10001927 | |||
| 688 | Ga0105240_10004968 | |||
| 689 | Ga0105240_10005895 | |||
| 690 | Ga0105240_10021127 | |||
| 691 | Ga0105240_10025982 | |||
| 692 | Ga0105240_10039408 | |||
| 693 | Ga0105240_10081685 | |||
| 694 | Ga0111539_10178610 | |||
| 695 | Ga0114129_10007293 | |||
| 696 | Ga0105241_10000270 | |||
| 697 | Ga0105241_10001046 | |||
| 698 | Ga0105241_10001279 | |||
| 699 | Ga0105241_10020689 | |||
| 700 | Ga0105241_10046684 | |||
| 701 | Ga0105241_10075341 | |||
| 702 | Ga0105241_10076742 | |||
| 703 | Ga0105242_10172967 | |||
| 704 | Ga0105237_10000206 | |||
| 705 | Ga0105237_10000263 | |||
| 706 | Ga0105237_10000504 | |||
| 707 | Ga0105237_10000962 | |||
| 708 | Ga0105237_10000993 | |||
| 709 | Ga0105237_10002695 | |||
| 710 | Ga0105237_10003064 | |||
| 711 | Ga0105237_10003527 | |||
| 712 | Ga0105237_10004889 | |||
| 713 | Ga0105237_10005709 | |||
| 714 | Ga0105237_10007620 | |||
| 715 | Ga0105237_10012639 | |||
| 716 | Ga0105237_10031241 | |||
| 717 | Ga0105237_10033780 | |||
| 718 | Ga0105237_10044219 | |||
| 719 | Ga0105238_10001257 | |||
| 720 | Ga0105238_10039594 | |||
| 721 | Ga0105238_10050024 | |||
| 722 | Ga0105238_10062583 | |||
| 723 | Ga0105238_10066158 | |||
| 724 | Ga0105239_10000016 | |||
| 725 | Ga0105239_10000021 | |||
| 726 | Ga0105239_10000101 | |||
| 727 | Ga0105239_10000718 | |||
| 728 | Ga0105239_10000896 | |||
| 729 | Ga0105239_10001035 | |||
| 730 | Ga0105239_10004693 | |||
| 731 | Ga0105239_10009228 | |||
| 732 | Ga0105239_10016300 | |||
| 733 | Ga0105239_10028055 | |||
| 734 | Ga0105239_10032473 | |||
| 735 | Ga0105239_10046003 | |||
| 736 | Ga0105239_10087590 | |||
| 737 | Ga0157373_10000015 | |||
| 738 | Ga0157373_10000018 | |||
| 739 | Ga0157373_10023122 | |||
| 740 | Ga0157373_10029427 | |||
| 741 | Ga0157371_10000542 | |||
| 742 | Ga0157371_10003393 | |||
| 743 | Ga0157371_10005101 | |||
| 744 | Ga0157371_10006506 | |||
| 745 | Ga0157371_10006762 | |||
| 746 | Ga0157371_10007304 | |||
| 747 | Ga0157371_10011939 | |||
| 748 | Ga0157371_10015963 | |||
| 749 | Ga0157371_10105727 | |||
| 750 | Ga0157371_10112929 | |||
| 751 | Ga0157370_10000446 | |||
| 752 | Ga0157370_10000474 | |||
| 753 | Ga0157370_10003898 | |||
| 754 | Ga0157370_10011410 | |||
| 755 | Ga0157370_10032312 | |||
| 756 | Ga0157370_10037479 | |||
| 757 | Ga0157370_10081785 | |||
| 758 | Ga0157370_10152118 | |||
| 759 | Ga0157370_10200872 | |||
| 760 | Ga0157370_10215892 | |||
| 761 | Ga0157369_10000439 | |||
| 762 | Ga0157369_10009068 | |||
| 763 | Ga0157369_10014339 | |||
| 764 | Ga0157369_10080377 | |||
| 765 | Ga0157369_10098984 | |||
| 766 | Ga0157369_10268440 | |||
| 767 | Ga0157369_10296272 | |||
| 768 | Ga0157374_10000599 | |||
| 769 | Ga0157374_10014904 | |||
| 770 | Ga0157378_10011362 | |||
| 771 | Ga0157378_10029309 | |||
| 772 | Ga0163162_10000026 | |||
| 773 | Ga0163162_10000778 | |||
| 774 | Ga0163162_10001178 | |||
| 775 | Ga0163162_10002670 | |||
| 776 | Ga0163162_10053450 | |||
| 777 | Ga0157372_10000015 | |||
| 778 | Ga0157372_10000346 | |||
| 779 | Ga0157372_10000680 | |||
| 780 | Ga0157372_10000735 | |||
| 781 | Ga0157372_10002159 | |||
| 782 | Ga0157372_10003320 | |||
| 783 | Ga0157372_10008802 | |||
| 784 | Ga0157372_10013232 | |||
| 785 | Ga0157372_10022589 | |||
| 786 | Ga0157372_10051670 | |||
| 787 | Ga0157372_10062482 | |||
| 788 | Ga0157372_10092533 | |||
| 789 | Ga0157372_10119225 | |||
| 790 | Ga0157372_10265952 | |||
| 791 | Ga0157372_10296187 | |||
| 792 | Ga0157375_10347838 | |||
| 793 | Ga0157380_10011724 | |||
| 794 | Ga0182008_10000001 | |||
| 795 | Ga0157376_10123309 | |||
| 796 | Ga0182006_1002670 | |||
| 797 | Ga0182006_1027607 | |||
| 798 | Ga0182005_1000202 | |||
| 799 | Ga0163161_10000365 | |||
| 800 | Ga0163161_10103835 | |||
| 801 | Ga0207427_100219 | |||
| 802 | Ga0209437_100077 | |||
| 803 | Ga0209437_100363 | |||
| 804 | Ga0209258_100282 | |||
| 805 | Ga0209026_1000357 | |||
| 806 | Ga0209026_1002923 | |||
| 807 | Ga0209026_1008946 | |||
| 808 | Ga0209148_1000247 | |||
| 809 | Ga0209233_1000017 | |||
| 810 | Ga0209455_1009419 | |||
| 811 | Ga0209676_1000042 | |||
| 812 | Ga0209050_1000035 | |||
| 813 | Ga0207426_1000170 | |||
| 814 | Ga0209257_1000071 | |||
| 815 | Ga0207656_10049877 | |||
| 816 | Ga0207642_10082507 | |||
| 817 | Ga0207647_10000574 | |||
| 818 | Ga0207647_10002245 | |||
| 819 | Ga0207645_10000440 | |||
| 820 | Ga0207643_10021862 | |||
| 821 | Ga0207643_10027656 | |||
| 822 | Ga0207705_10000482 | |||
| 823 | Ga0207705_10076584 | |||
| 824 | Ga0207654_10000184 | |||
| 825 | Ga0207654_10043669 | |||
| 826 | Ga0207707_10003153 | |||
| 827 | Ga0207695_10000013 | |||
| 828 | Ga0207695_10000023 | |||
| 829 | Ga0207695_10000031 | |||
| 830 | Ga0207695_10001274 | |||
| 831 | Ga0207695_10001380 | |||
| 832 | Ga0207695_10027307 | |||
| 833 | Ga0207695_10057140 | |||
| 834 | Ga0207695_10093616 | |||
| 835 | Ga0207695_10100449 | |||
| 836 | Ga0207671_10000297 | |||
| 837 | Ga0207671_10000316 | |||
| 838 | Ga0207671_10000957 | |||
| 839 | Ga0207671_10002372 | |||
| 840 | Ga0207671_10002996 | |||
| 841 | Ga0207671_10004115 | |||
| 842 | Ga0207671_10004574 | |||
| 843 | Ga0207671_10008091 | |||
| 844 | Ga0207671_10014013 | |||
| 845 | Ga0207671_10016757 | |||
| 846 | Ga0207671_10018858 | |||
| 847 | Ga0207671_10021557 | |||
| 848 | Ga0207671_10059448 | |||
| 849 | Ga0207671_10099726 | |||
| 850 | Ga0207660_10006527 | |||
| 851 | Ga0207660_10038208 | |||
| 852 | Ga0207662_10046259 | |||
| 853 | Ga0207657_10004064 | |||
| 854 | Ga0207657_10023840 | |||
| 855 | Ga0207657_10034672 | |||
| 856 | Ga0207652_10004993 | |||
| 857 | Ga0207652_10005780 | |||
| 858 | Ga0207652_10009935 | |||
| 859 | Ga0207694_10002091 | |||
| 860 | Ga0207694_10032463 | |||
| 861 | Ga0207694_10087572 | |||
| 862 | Ga0207690_10000759 | |||
| 863 | Ga0207690_10024572 | |||
| 864 | Ga0207690_10044117 | |||
| 865 | Ga0207690_10178620 | |||
| 866 | Ga0207670_10151819 | |||
| 867 | Ga0207669_10088833 | |||
| 868 | Ga0207704_10000010 | |||
| 869 | Ga0207704_10000120 | |||
| 870 | Ga0207691_10064987 | |||
| 871 | Ga0207689_10045659 | |||
| 872 | Ga0207679_10042790 | |||
| 873 | Ga0207679_10102257 | |||
| 874 | Ga0207667_10000197 | |||
| 875 | Ga0207667_10001217 | |||
| 876 | Ga0207667_10010389 | |||
| 877 | Ga0207667_10021359 | |||
| 878 | Ga0207667_10039748 | |||
| 879 | Ga0207667_10091830 | |||
| 880 | Ga0207667_10107289 | |||
| 881 | Ga0207667_10216366 | |||
| 882 | Ga0207667_10274631 | |||
| 883 | Ga0207651_10003447 | |||
| 884 | Ga0207712_10102919 | |||
| 885 | Ga0207677_10015405 | |||
| 886 | Ga0207677_10049302 | |||
| 887 | Ga0207703_10043478 | |||
| 888 | Ga0207639_10014162 | |||
| 889 | Ga0207678_10160399 | |||
| 890 | Ga0207702_10034225 | |||
| 891 | Ga0207702_10059707 | |||
| 892 | Ga0207702_10091360 | |||
| 893 | Ga0207702_10166085 | |||
| 894 | Ga0207702_10179635 | |||
| 895 | Ga0207648_10002447 | |||
| 896 | Ga0207648_10035278 | |||
| 897 | Ga0207676_10016416 | |||
| 898 | Ga0207674_10008302 | |||
| 899 | Ga0207674_10014223 | |||
| 900 | Ga0207674_10208217 | |||
| 901 | Ga0207675_100243099 | |||
| 902 | Ga0207698_10003067 | |||
| 903 | Ga0207698_10026144 | |||
| 904 | Ga0207698_10086354 | |||
| 905 | Ga0207698_10107001 | |||
| 906 | Ga0268266_10000014 | |||
| 907 | Ga0268266_10000037 | |||
| 908 | Ga0268264_10000674 | |||
| 909 | Ga0307517_10002284 | |||
| 910 | Ga0307515_10000001 | |||
| 911 | Ga0307515_10000280 | |||
| 912 | Ga0307515_10003886 | |||
| 913 | Ga0307515_10063752 | |||
| 914 | Ga0307511_10000264 | |||
| 915 | Ga0316176_1048616 | |||
| 916 | Ga0316183_1018086 | |||
| 917 | Ga0316181_1069399 | |||
| 918 | Ga0265327_10000411 | |||
| 919 | Ga0307513_10071485 | |||
| 920 | Ga0307513_10110373 | |||
| 921 | Ga0307509_10018041 | |||
| 922 | Ga0307509_10045122 | |||
| 923 | Ga0307408_100001128 | |||
| 924 | Ga0307408_100001139 | |||
| 925 | Ga0307408_100002494 | |||
| 926 | Ga0307508_10000644 | |||
| 927 | Ga0316576_10061672 | |||
| 928 | Ga0307516_10000656 | |||
| 929 | Ga0307516_10144430 | |||
| 930 | Ga0307405_10000046 | |||
| 931 | Ga0307405_10015870 | |||
| 932 | Ga0307412_10000017 | |||
| 933 | Ga0307412_10002541 | |||
| 934 | Ga0307414_10001044 | |||
| 935 | Ga0307414_10005303 | |||
| 936 | Ga0307414_10155409 | |||
| 937 | Ga0307507_10001142 | |||
| 938 | Ga0307510_10009647 | |||
| 939 | Ga0307510_10033263 | |||
| 940 | Ga0316584_0124463 | |||
| 941 | Ga0395899_0000001 | |||
| 942 | Ga0395899_0000181 | |||
| 943 | Ga0395899_0000717 | |||
| 944 | Ga0395899_0000806 | |||
| 945 | Ga0395899_0004001 | |||
| 946 | Ga0395899_0005474 | |||
| 947 | Ga0395899_0100112 | |||
| 948 | Ga0395900_0000014 | |||
| 949 | Ga0395900_0002459 | |||
| 950 | Ga0395900_0005331 | |||
| 951 | Ga0395900_0009414 | |||
| 952 | Ga0395900_0012319 | |||
| 953 | Ga0395900_0099969 | |||
| 954 | Ga0395900_0125910 | |||
| 955 | Ga0395900_0211550 | |||
| 956 | Ga0395900_0281162 | |||
| 957 | Ga0395898_0002747 | |||
| 958 | Ga0395898_0009073 | |||
| 959 | Ga0395898_0015129 | |||
| 960 | Ga0395898_0105748 | |||
| 961 | Ga0395898_0238949 | |||
| 962 | Ga0395905_0000037 | |||
| 963 | Ga0395905_0000819 | |||
| 964 | Ga0395905_0001794 | |||
| 965 | Ga0395901_0000219 | |||
| 966 | Ga0395901_0002632 | |||
| 967 | Ga0395901_0008449 | |||
| 968 | Ga0395901_0025905 | |||
| 969 | Ga0395901_0051155 | |||
| 970 | Ga0400483_016155 | |||
| 971 | Ga0400483_231526 | |||
| 972 | Ga0439445_0011601 | |||
| 973 | Ga0439457_027749 | |||
| 974 | Ga0439462_0009518 | |||
| 975 | Ga0439462_0042735 | |||
| 976 | Ga0439434_0009670 | |||
| 977 | Ga0451577_0025309 | |||
| 978 | Ga0451577_0095655 | |||
| 979 | Ga0466969_0000052 | |||
| 980 | Ga0466972_0000008 | |||
| 981 | Ga0466972_0000020 | |||
| 982 | Ga0466972_0001211 | |||
| 983 | Ga0466972_0007337 | |||
| 984 | Ga0466966_0005448 | |||
| 985 | Ga0466966_0056036 | |||
| 986 | Ga0466966_0074066 | |||
| 987 | Ga0466961_0021074 | |||
| 988 | Ga0453684_0007582 | |||
| 989 | Ga0453684_0030621 | |||
| 990 | Ga0453684_0041284 | |||
| 991 | Ga0453684_0066924 | |||
| 992 | Ga0453684_0143333 | |||
| 993 | Ga0453684_0249062 | |||
| 994 | Ga0466971_0004044 | |||
| 995 | Ga0466957_0000239 | |||
| 996 | Ga0466957_0015641 | |||
| 997 | Ga0466957_0030262 | |||
| 998 | Ga0466959_0000084 | |||
| 999 | Ga0466959_0002016 | |||
| 1000 | Ga0451576_0037096 | |||
| 1001 | Ga0466958_0051875 | |||
| 1002 | Ga0495627_022022 | |||
| 1003 | Ga0495638_0046190 | |||
| 1004 | Ga0495650_0000231 | |||
| 1005 | Ga0495650_0029554 | |||
| 1006 | Ga0495585_0000037 | |||
| 1007 | Ga0495585_0015075 | |||
| 1008 | Ga0495596_0029183 | |||
| 1009 | Ga0495606_0000060 | |||
| 1010 | Ga0495606_0005180 | |||
| 1011 | Ga0495606_0005353 | |||
| 1012 | Ga0495606_0099225 | |||
| 1013 | Ga0495610_0000093 | |||
| 1014 | Ga0495616_0008927 | |||
| 1015 | Ga0495631_0038658 | |||
| 1016 | Ga0495637_0022196 | |||
| 1017 | Ga0495648_0004193 | |||
| 1018 | Ga0495648_0019829 | |||
| 1019 | Ga0495652_0219171 | |||
| 1020 | Ga0495598_0011499 | |||
| 1021 | Ga0495609_0014279 | |||
| 1022 | Ga0495622_0035607 | |||
| 1023 | Ga0495633_0000023 | |||
| 1024 | Ga0495633_0000641 | |||
| 1025 | Ga0495668_0000012 | |||
| 1026 | Ga0495668_0020335 | |||
| 1027 | Ga0495611_0000100 | |||
| 1028 | Ga0495625_0000191 | |||
| 1029 | Ga0495625_0001093 | |||
| 1030 | Ga0495625_0001735 | |||
| 1031 | Ga0495625_0090399 | |||
| 1032 | Ga0495625_0098709 | |||
| 1033 | Ga0495661_0002843 | |||
| 1034 | Ga0495661_0010372 | |||
| 1035 | Ga0495649_0000010 | |||
| 1036 | Ga0495649_0000061 | |||
| 1037 | Ga0495683_0030179 | |||
| 1038 | Ga0495687_000144 | |||
| 1039 | Ga0495687_002703 | |||
| 1040 | Ga0495686_0000004 | |||
| 1041 | Ga0495686_0000071 | |||
| 1042 | Ga0495686_0026706 | |||
| 1043 | Ga0495686_0031208 | |||
| 1044 | Ga0495686_0038489 | |||
| 1045 | Ga0495686_0045132 | |||
| 1046 | Ga0496121_0000026 | |||
| 1047 | Ga0496122_0001373 | |||
| 1048 | Ga0496123_0010050 | |||
| 1049 | Ga0496125_0050779 | |||
| 1050 | Ga0496126_0116479 | |||
| 1051 | Ga0495678_004082 | |||
| 1052 | Ga0501033_0033698 | |||
| 1053 | Ga0501033_0061896 | |||
| 1054 | Ga0501033_0162912 | |||
| 1055 | Ga0501034_0047009 | |||
| 1056 | Ga0501034_0102587 | |||
| 1057 | Ga0501034_0115052 | |||
| 1058 | Ga0501039_0211589 | |||
| 1059 | Ga0501047_0061473 | |||
| 1060 | Ga0501219_000091 | |||
| 1061 | Ga0501225_0000313 | |||
| 1062 | Ga0501044_0116710 | |||
| 1063 | Ga0501284_00037 | |||
| 1064 | nmdc:mga0k408_1220_c1 | |||
| 1065 | nmdc:mga05p37_5208_c1 | |||
| 1066 | Ga0500578_0000024 | |||
| 1067 | Ga0500578_0033161 | |||
| 1068 | Ga0500644_0000567 | |||
| 1069 | Ga0500646_0016329 | |||
| 1070 | Ga0500583_0000058 | |||
| 1071 | Ga0500583_0002307 | |||
| 1072 | Ga0500651_0000451 | |||
| 1073 | Ga0500569_001611 | |||
| 1074 | Ga0500607_017620 | |||
| 1075 | Ga0500618_000013 | |||
| 1076 | Ga0500642_0019392 | |||
| 1077 | Ga0500652_052105 | |||
| 1078 | Ga0500658_0002777 | |||
| 1079 | Ga0500559_0016035 | |||
| 1080 | Ga0500559_0017951 | |||
| 1081 | Ga0500577_0000506 | |||
| 1082 | Ga0500616_0059090 | |||
| 1083 | Ga0500622_0000199 | |||
| 1084 | Ga0500622_0000676 | |||
| 1085 | Ga0500622_0001133 | |||
| 1086 | Ga0500622_0001437 | |||
| 1087 | Ga0500622_0019691 | |||
| 1088 | Ga0500633_0009438 | |||
| 1089 | Ga0500611_000063 | |||
| 1090 | Ga0466962_0016666 | |||
| 1091 | 2586208828 | |||
| 1092 | 2599481466 | |||
| 1093 | 2738729947 | |||
| 1094 | 2738756180 | |||
| 1095 | 2738763926 | |||
| 1096 | 2739616691 | |||
| 1097 | 2776613601 | |||
| 1098 | 2819549343 | |||
| 1099 | 2819577475 | |||
| 1100 | 2819590128 | |||
| 1101 | 2821138853 | |||
| 1102 | 2842726221 | |||
| 1103 | 2842904141 | |||
| 1104 | 2842910466 | |||
| 1105 | 2852623975 | |||
| 1106 | 2852629740 | |||
| 1107 | 2883072013 | |||
| 1108 | 2884937122 | |||
| 1109 | 2896111097 | |||
| 1110 | 2896113891 | |||
| 1111 | 2896346585 | |||
| 1112 | 2904472568 | |||
| 1113 | 2919442582 | |||
| 1114 | 2928082830 | |||
| 1115 | 2928149848 | |||
| 1116 | 2929243164 | |||
| 1117 | 2932086501 | |||
| 1118 | 2954017702 | |||
| 1119 | 2958512846 | |||
| 1120 | 2977234263 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lds-assembly1.cif.gz_A | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.9102 | 19 | 433 |
| 4yb9-assembly1.cif.gz_D | crystal structure of the bovine fructose transporter glut5 in an open inward-facing conformation | 0.9028 | 17 | 432 |
| 4lds-assembly1.cif.gz_B | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.9006 | 16 | 433 |
| 4lds-assembly1.cif.gz_A | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.8959 | 19 | 433 |
| 4lds-assembly1.cif.gz_B | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.8925 | 16 | 433 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0WGH5_53_382_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9583 | 10 | 316 | 1.20.1250.20 |
| af_A0A0P0WGJ2_58_436_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9575 | 11 | 366 | 1.20.1250.20 |
| af_K7TQZ4_34_446_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9573 | 11 | 394 | 1.20.1250.20 |
| 4ja3A03 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9546 | 251 | 432 | 1.20.1250.20 |
| af_O95528_5_195_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9524 | 13 | 192 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5RE67-F1-model_v4 | MFS transporter | 0.9793 | 1 | 265 |
GO:0016020
GO:0022857 |
| AF-A0A519V664-F1-model_v4 | MFS transporter | 0.9748 | 1 | 193 |
GO:0016020
GO:0022857 |
| AF-A0A519V664-F1-model_v4 | MFS transporter | 0.9699 | 1 | 193 |
GO:0016020
GO:0022857 |
| AF-A0A4Q5RE67-F1-model_v4 | MFS transporter | 0.9685 | 1 | 265 |
GO:0016020
GO:0022857 |
| AF-A0A7V3JMR2-F1-model_v4 | MFS transporter | 0.9671 | 12 | 446 |
GO:0016020
GO:0022857 |