F463558

General Info

Members Datasets Scaffolds Average Seq Length
559 241 1118 435

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10081510|Ga0157372_100815103
Length 490
Sequence MWYILSNVKKNSKQSFSSKNDFANKVLKKNIFITKLKFFKCIADYIFHLNVFMAELDRKLGLWHASAINMTDMVGIGPFITLPMVIGMMNGPYFLYAWIAGAFLSIVDGMVWSELGAAFPRAGGSYNFLKEAYGKKAGGRMMSFLFVWQTMIQAPLVIASAAIGFAKYFSFIVPLTAYTEKLVSGGYRKIEAIGKISVFLWSGVIITMFWIIGGGILHGNFLMPLKNINNGLTVDYAFVTAIGFASVKSVYSYLGYYNICHLGGEIKNPSKNIPKSMFISIIVIAVLYLLMNISVVSVLPWQQAKDSEFVVSEFMQVLLGHTAATVITCLILWVAFASVFSATLGYSRIPYAAAEDGEFFKIFAKLHPTKHFPYVSLLFLGGVAFVFSMLFKLSETISAILAMRIMIQFIGQAVGLLILRSKKNEAAFPYKMPLFPLPVLAAIAMWLFILISTGTKLMLSGLFVIFLGVIVYFIKAKFQKEWPFVSVGKQ

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
206 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
220 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
221 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
222 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
232 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
233 2818991444 Filimonas endophytica 3197 Isolate Unclassified
234 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
235 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
236 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
237 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
238 2914759650 Rhizosphaericola mali Isolate Rhizosphere
239 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
240 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
241 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 0.18
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.83
Nodule 0
Rhizoplane 0.36
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 6.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10081510 3300013307 Bacteria 3662
2 JGI24751J29686_10012803 3300002459 Bacteria 1730
3 JGI25406J46586_10001059 3300003203 Bacteria 12890
4 rootH1_10018150 3300003316 Bacteria 2033
5 rootH1_10052371 3300003316 Bacteria 31617
6 rootH1_10117803 3300003316 Bacteria 3402
7 rootH2_10015699 3300003320 Bacteria 2370
8 rootH2_10114781 3300003320 Bacteria 2445
9 rootL2_10004033 3300003322 Bacteria 45524
10 rootL2_10065261 3300003322 Bacteria 18155
11 rootL2_10075642 3300003322 Bacteria 2868
12 rootL2_10132181 3300003322 Bacteria 15845
13 rootL2_10160375 3300003322 Bacteria 4188
14 rootL2_10194414 3300003322 Bacteria 2974
15 rootL2_10226720 3300003322 Bacteria 4711
16 rootH1_10015492 3300003323 Bacteria 90717
17 rootH1_10041902 3300003323 Bacteria 5968
18 rootH1_10098526 3300003323 Bacteria 5269
19 rootH1_10119581 3300003323 Bacteria 6300
20 rootH1_10251219 3300003323 Bacteria 4867
21 rootH1_10256724 3300003323 Bacteria 2944
22 Ga0055535_1000572 3300003761 Bacteria 31004
23 Ga0055531_10000041 3300003794 Bacteria 135600
24 Ga0065165_1001983 3300005262 Bacteria 19290
25 Ga0065712_10086646 3300005290 Bacteria 2623
26 Ga0065712_10107515 3300005290 Bacteria 1894
27 Ga0065712_10129417 3300005290 Bacteria 1567
28 Ga0070658_10009494 3300005327 Bacteria 7819
29 Ga0070658_10074535 3300005327 Bacteria 2783
30 Ga0070658_10086763 3300005327 Bacteria 2575
31 Ga0070658_10167895 3300005327 Bacteria 1843
32 Ga0070683_100000417 3300005329 Bacteria 29450
33 Ga0070683_100014920 3300005329 Bacteria 6809
34 Ga0070683_100024493 3300005329 Bacteria 5407
35 Ga0070683_100025718 3300005329 Bacteria 5291
36 Ga0070683_100045687 3300005329 Bacteria 4043
37 Ga0070683_100046675 3300005329 Bacteria 4003
38 Ga0070683_100102110 3300005329 Bacteria 2701
39 Ga0070670_100033275 3300005331 Bacteria 4440
40 Ga0070670_100060120 3300005331 Bacteria 3262
41 Ga0070670_100166206 3300005331 Bacteria 1913
42 Ga0070670_100200868 3300005331 Bacteria 1732
43 Ga0068869_100009198 3300005334 Bacteria 6402
44 Ga0068869_100110952 3300005334 Bacteria 2087
45 Ga0070666_10002958 3300005335 Bacteria 10296
46 Ga0070666_10003367 3300005335 Bacteria 9695
47 Ga0070680_100004033 3300005336 Bacteria 10986
48 Ga0070680_100032104 3300005336 Bacteria 4224
49 Ga0070680_100137441 3300005336 Unclassified 2048
50 Ga0070682_100000190 3300005337 Bacteria 46394
51 Ga0070682_100018940 3300005337 Bacteria 4032
52 Ga0068868_100000524 3300005338 Bacteria 25677
53 Ga0068868_100042742 3300005338 Bacteria 3539
54 Ga0068868_100095244 3300005338 Bacteria 2403
55 Ga0068868_100165131 3300005338 Bacteria 1831
56 Ga0070660_100006675 3300005339 Bacteria 8011
57 Ga0070660_100190825 3300005339 Bacteria 1660
58 Ga0070689_100002023 3300005340 Bacteria 13154
59 Ga0070661_100020138 3300005344 Bacteria 4756
60 Ga0070668_100013224 3300005347 Bacteria 6156
61 Ga0070669_100023893 3300005353 Bacteria 4379
62 Ga0070669_100096607 3300005353 Bacteria 2223
63 Ga0070675_100006657 3300005354 Bacteria 8885
64 Ga0070675_100087564 3300005354 Unclassified 2604
65 Ga0070671_100105816 3300005355 Unclassified 2361
66 Ga0070673_100093991 3300005364 Bacteria 2457
67 Ga0070673_100178932 3300005364 Bacteria 1814
68 Ga0070688_100015633 3300005365 Bacteria 4323
69 Ga0070659_100022425 3300005366 Bacteria 4820
70 Ga0070659_100033893 3300005366 Bacteria 3970
71 Ga0070659_100116503 3300005366 Unclassified 2160
72 Ga0070659_100179132 3300005366 Bacteria 1739
73 Ga0070667_100023184 3300005367 Bacteria 5150
74 Ga0070667_100072478 3300005367 Bacteria 2935
75 Ga0070714_100000093 3300005435 Bacteria 75455
76 Ga0070700_100125917 3300005441 Bacteria 1723
77 Ga0070678_100022194 3300005456 Bacteria 4200
78 Ga0070662_100002459 3300005457 Bacteria 11410
79 Ga0070662_100003891 3300005457 Bacteria 9359
80 Ga0070681_10033322 3300005458 Bacteria 5171
81 Ga0070681_10257137 3300005458 Bacteria 1658
82 Ga0068867_100003552 3300005459 Bacteria 10963
83 Ga0070685_10011485 3300005466 Bacteria 4635
84 Ga0070685_10016179 3300005466 Bacteria 3970
85 Ga0070698_100011518 3300005471 Bacteria 9387
86 Ga0070698_100029257 3300005471 Bacteria 5717
87 Ga0070698_100084618 3300005471 Bacteria 3159
88 Ga0070699_100033198 3300005518 Bacteria 4458
89 Ga0070679_100001265 3300005530 Bacteria 22305
90 Ga0070679_100023347 3300005530 Bacteria 6052
91 Ga0070679_100031623 3300005530 Bacteria 5230
92 Ga0070679_100121412 3300005530 Bacteria 2598
93 Ga0070679_100163105 3300005530 Bacteria 2202
94 Ga0070684_100000433 3300005535 Bacteria 28743
95 Ga0070684_100004933 3300005535 Bacteria 10180
96 Ga0070684_100010691 3300005535 Bacteria 7280
97 Ga0070697_100018471 3300005536 Bacteria 5498
98 Ga0068853_100001703 3300005539 Bacteria 16107
99 Ga0068853_100024478 3300005539 Bacteria 5062
100 Ga0068853_100040540 3300005539 Bacteria 3973
101 Ga0068853_100180730 3300005539 Bacteria 1913
102 Ga0070686_100143059 3300005544 Bacteria 1667
103 Ga0070665_100011246 3300005548 Bacteria 9051
104 Ga0068855_100004062 3300005563 Bacteria 17861
105 Ga0068855_100016626 3300005563 Bacteria 8845
106 Ga0068855_100052249 3300005563 Bacteria 4812
107 Ga0068855_100346773 3300005563 Bacteria 1636
108 Ga0070664_100006889 3300005564 Bacteria 9161
109 Ga0070664_100025629 3300005564 Bacteria 4890
110 Ga0070664_100073927 3300005564 Bacteria 2925
111 Ga0068857_100011323 3300005577 Bacteria 7760
112 Ga0068854_100084271 3300005578 Bacteria 2352
113 Ga0068854_100086644 3300005578 Bacteria 2322
114 Ga0068856_100017565 3300005614 Bacteria 6932
115 Ga0068856_100077102 3300005614 Bacteria 3302
116 Ga0068856_100083052 3300005614 Bacteria 3180
117 Ga0068852_100001894 3300005616 Bacteria 14234
118 Ga0068852_100004963 3300005616 Bacteria 9456
119 Ga0068852_100005740 3300005616 Bacteria 8904
120 Ga0068852_100033029 3300005616 Bacteria 4292
121 Ga0068852_100300290 3300005616 Bacteria 1554
122 Ga0068859_100000023 3300005617 Bacteria 221914
123 Ga0068859_100015184 3300005617 Bacteria 7730
124 Ga0068859_100019080 3300005617 Bacteria 6886
125 Ga0068864_100004780 3300005618 Bacteria 11099
126 Ga0068864_100007894 3300005618 Bacteria 8770
127 Ga0068864_100009090 3300005618 Bacteria 8190
128 Ga0068864_100014772 3300005618 Bacteria 6487
129 Ga0068864_100048489 3300005618 Bacteria 3652
130 Ga0068861_100020844 3300005719 Bacteria 4702
131 Ga0068861_100108203 3300005719 Bacteria 2224
132 Ga0068861_100160611 3300005719 Bacteria 1853
133 Ga0068863_100013333 3300005841 Bacteria 7926
134 Ga0068863_100120840 3300005841 Unclassified 2497
135 Ga0068863_100161442 3300005841 Bacteria 2147
136 Ga0068858_100013810 3300005842 Bacteria 7624
137 Ga0068858_100103472 3300005842 Unclassified 2656
138 Ga0068860_100056458 3300005843 Bacteria 3732
139 Ga0068860_100244507 3300005843 Bacteria 1746
140 Ga0068862_100061127 3300005844 Bacteria 3238
141 Ga0068862_100063460 3300005844 Bacteria 3178
142 Ga0068862_100109651 3300005844 Bacteria 2422
143 Ga0081540_1016967 3300005983 Unclassified 4528
144 Ga0081539_10002864 3300005985 Bacteria 22927
145 Ga0081539_10027982 3300005985 Unclassified 3555
146 Ga0070715_10014634 3300006163 Unclassified 2909
147 Ga0075367_10012918 3300006178 Bacteria 4474
148 Ga0075366_10014817 3300006195 Bacteria 4458
149 Ga0097621_100001040 3300006237 Bacteria 19470
150 Ga0097621_100006660 3300006237 Bacteria 8211
151 Ga0097621_100035192 3300006237 Bacteria 4000
152 Ga0068871_100007865 3300006358 Bacteria 7640
153 Ga0068871_100008736 3300006358 Bacteria 7292
154 Ga0068871_100018190 3300006358 Bacteria 5337
155 Ga0068871_100027376 3300006358 Bacteria 4458
156 Ga0068871_100037063 3300006358 Bacteria 3886
157 Ga0068871_100084776 3300006358 Bacteria 2630
158 Ga0075428_100015198 3300006844 Bacteria 8539
159 Ga0075428_100318420 3300006844 Bacteria 1672
160 Ga0075430_100036205 3300006846 Bacteria 4185
161 Ga0075429_100005844 3300006880 Bacteria 10616
162 Ga0075429_100058294 3300006880 Bacteria 3363
163 Ga0068865_100067325 3300006881 Bacteria 2529
164 Ga0068865_100075117 3300006881 Bacteria 2409
165 Ga0068865_100085420 3300006881 Bacteria 2276
166 Ga0097620_100000023 3300006931 Bacteria 221914
167 Ga0097620_100015184 3300006931 Bacteria 7730
168 Ga0097620_100019082 3300006931 Bacteria 6886
169 Ga0099794_10006332 3300007265 Bacteria 4785
170 Ga0105240_10000283 3300009093 Bacteria 99553
171 Ga0105240_10000390 3300009093 Bacteria 82256
172 Ga0105240_10018885 3300009093 Bacteria 9230
173 Ga0105240_10099952 3300009093 Bacteria 3530
174 Ga0105240_10141183 3300009093 Bacteria 2880
175 Ga0111539_10120581 3300009094 Bacteria 3073
176 Ga0105247_10001787 3300009101 Bacteria 15121
177 Ga0105243_10063645 3300009148 Bacteria 2956
178 Ga0105241_10000409 3300009174 Bacteria 32453
179 Ga0105241_10001396 3300009174 Bacteria 18470
180 Ga0105241_10083840 3300009174 Bacteria 2501
181 Ga0105241_10130201 3300009174 Bacteria 2036
182 Ga0105242_10019529 3300009176 Bacteria 5311
183 Ga0105242_10054087 3300009176 Bacteria 3280
184 Ga0105242_10231266 3300009176 Bacteria 1657
185 Ga0105237_10003688 3300009545 Bacteria 18053
186 Ga0105237_10030065 3300009545 Bacteria 5518
187 Ga0105237_10095659 3300009545 Bacteria 2960
188 Ga0105237_10307377 3300009545 Bacteria 1588
189 Ga0105238_10008637 3300009551 Bacteria 10194
190 Ga0105249_10001211 3300009553 Bacteria 22772
191 Ga0105249_10007479 3300009553 Bacteria 9529
192 Ga0105249_10008699 3300009553 Bacteria 8849
193 Ga0105249_10009806 3300009553 Bacteria 8393
194 Ga0105249_10012755 3300009553 Bacteria 7408
195 Ga0105249_10013556 3300009553 Bacteria 7200
196 Ga0105249_10030935 3300009553 Bacteria 4839
197 Ga0105249_10053900 3300009553 Bacteria 3676
198 Ga0105239_10000184 3300010375 Bacteria 91348
199 Ga0105239_10060135 3300010375 Bacteria 4169
200 Ga0105239_10070500 3300010375 Bacteria 3840
201 Ga0105239_10092949 3300010375 Bacteria 3330
202 Ga0105239_10182435 3300010375 Bacteria 2348
203 Ga0157373_10000350 3300013100 Bacteria 37264
204 Ga0157373_10002372 3300013100 Bacteria 14308
205 Ga0157371_10001497 3300013102 Bacteria 24172
206 Ga0157371_10002643 3300013102 Bacteria 16991
207 Ga0157371_10003906 3300013102 Bacteria 13268
208 Ga0157371_10004594 3300013102 Bacteria 11988
209 Ga0157371_10007068 3300013102 Bacteria 9132
210 Ga0157371_10008419 3300013102 Bacteria 8215
211 Ga0157371_10012637 3300013102 Bacteria 6443
212 Ga0157371_10018133 3300013102 Bacteria 5211
213 Ga0157371_10057765 3300013102 Bacteria 2752
214 Ga0157371_10067778 3300013102 Unclassified 2526
215 Ga0157370_10000839 3300013104 Bacteria 39014
216 Ga0157370_10004162 3300013104 Bacteria 16742
217 Ga0157370_10012033 3300013104 Bacteria 9009
218 Ga0157370_10023019 3300013104 Bacteria 6192
219 Ga0157370_10062692 3300013104 Bacteria 3525
220 Ga0157370_10087093 3300013104 Bacteria 2934
221 Ga0157370_10119709 3300013104 Bacteria 2458
222 Ga0157370_10136300 3300013104 Bacteria 2288
223 Ga0157369_10007843 3300013105 Bacteria 12282
224 Ga0157369_10033474 3300013105 Bacteria 5647
225 Ga0157369_10071888 3300013105 Bacteria 3713
226 Ga0157374_10008934 3300013296 Bacteria 8585
227 Ga0157374_10008935 3300013296 Bacteria 8585
228 Ga0157374_10016485 3300013296 Bacteria 6497
229 Ga0157374_10134602 3300013296 Bacteria 2395
230 Ga0157374_10152079 3300013296 Bacteria 2250
231 Ga0157374_10349969 3300013296 Bacteria 1468
232 Ga0157378_10001602 3300013297 Bacteria 20452
233 Ga0157378_10008492 3300013297 Bacteria 8946
234 Ga0157378_10037390 3300013297 Bacteria 4299
235 Ga0157378_10073004 3300013297 Bacteria 3084
236 Ga0157378_10193193 3300013297 Bacteria 1921
237 Ga0157378_10212930 3300013297 Bacteria 1833
238 Ga0163162_10000705 3300013306 Bacteria 30921
239 Ga0163162_10001117 3300013306 Bacteria 24935
240 Ga0163162_10009987 3300013306 Bacteria 9231
241 Ga0163162_10011005 3300013306 Bacteria 8810
242 Ga0163162_10024996 3300013306 Bacteria 5900
243 Ga0163162_10162881 3300013306 Bacteria 2353
244 Ga0163162_10185254 3300013306 Bacteria 2209
245 Ga0157372_10002887 3300013307 Bacteria 18572
246 Ga0157372_10008365 3300013307 Bacteria 10999
247 Ga0157372_10024406 3300013307 Bacteria 6567
248 Ga0157372_10034569 3300013307 Bacteria 5557
249 Ga0157372_10039913 3300013307 Bacteria 5183
250 Ga0157372_10041668 3300013307 Bacteria 5076
251 Ga0157372_10054732 3300013307 Bacteria 4453
252 Ga0157372_10191202 3300013307 Unclassified 2371
253 Ga0157372_10346872 3300013307 Bacteria 1730
254 Ga0157375_10007105 3300013308 Bacteria 9779
255 Ga0157375_10010656 3300013308 Bacteria 8095
256 Ga0157375_10086371 3300013308 Unclassified 3188
257 Ga0157375_10157660 3300013308 Bacteria 2410
258 Ga0157375_10176067 3300013308 Bacteria 2289
259 Ga0157375_10262465 3300013308 Unclassified 1889
260 Ga0163163_10000198 3300014325 Bacteria 62120
261 Ga0163163_10000557 3300014325 Bacteria 32741
262 Ga0163163_10026596 3300014325 Bacteria 5534
263 Ga0163163_10091728 3300014325 Bacteria 3053
264 Ga0163163_10106051 3300014325 Bacteria 2836
265 Ga0163163_10164040 3300014325 Bacteria 2268
266 Ga0157377_10053067 3300014745 Bacteria 2291
267 Ga0157377_10063330 3300014745 Bacteria 2118
268 Ga0157379_10051444 3300014968 Bacteria 3680
269 Ga0157379_10076667 3300014968 Bacteria 2994
270 Ga0157379_10080203 3300014968 Bacteria 2923
271 Ga0157379_10112234 3300014968 Bacteria 2449
272 Ga0157379_10174549 3300014968 Bacteria 1940
273 Ga0157379_10206863 3300014968 Bacteria 1776
274 Ga0157376_10066557 3300014969 Unclassified 3046
275 Ga0157376_10077425 3300014969 Bacteria 2845
276 Ga0157376_10082958 3300014969 Bacteria 2756
277 Ga0157376_10132271 3300014969 Bacteria 2228
278 Ga0182005_1000109 3300015265 Bacteria 59696
279 Ga0163161_10000189 3300017792 Bacteria 56683
280 Ga0163161_10013189 3300017792 Bacteria 5744
281 Ga0163161_10026859 3300017792 Bacteria 4081
282 Ga0213876_10014288 3300021384 Bacteria 4209
283 Ga0213876_10015759 3300021384 Bacteria 4001
284 Ga0209436_100626 3300025208 Bacteria 15103
285 Ga0209258_100378 3300025242 Bacteria 57308
286 Ga0209148_1000391 3300025254 Bacteria 51783
287 Ga0207426_1007502 3300025302 Bacteria 4553
288 Ga0209257_1000001 3300025304 Bacteria 2274655
289 Ga0207682_10029421 3300025893 Bacteria 2196
290 Ga0207710_10009235 3300025900 Bacteria 4146
291 Ga0207680_10000834 3300025903 Bacteria 14542
292 Ga0207680_10042985 3300025903 Bacteria 2647
293 Ga0207647_10001371 3300025904 Bacteria 18715
294 Ga0207647_10009967 3300025904 Bacteria 6730
295 Ga0207647_10016593 3300025904 Bacteria 5022
296 Ga0207685_10012112 3300025905 Bacteria 2620
297 Ga0207645_10010374 3300025907 Bacteria 6396
298 Ga0207645_10011044 3300025907 Bacteria 6181
299 Ga0207643_10038872 3300025908 Bacteria 2675
300 Ga0207705_10005162 3300025909 Bacteria 9789
301 Ga0207705_10017399 3300025909 Bacteria 5148
302 Ga0207705_10063880 3300025909 Bacteria 2660
303 Ga0207705_10082967 3300025909 Unclassified 2338
304 Ga0207705_10091242 3300025909 Unclassified 2231
305 Ga0207654_10000685 3300025911 Bacteria 18960
306 Ga0207654_10007011 3300025911 Bacteria 5676
307 Ga0207707_10015678 3300025912 Bacteria 6603
308 Ga0207707_10015774 3300025912 Bacteria 6586
309 Ga0207707_10118863 3300025912 Bacteria 2310
310 Ga0207695_10000020 3300025913 Bacteria 723025
311 Ga0207695_10003728 3300025913 Bacteria 21215
312 Ga0207695_10023032 3300025913 Bacteria 7051
313 Ga0207695_10068921 3300025913 Bacteria 3622
314 Ga0207695_10076614 3300025913 Bacteria 3399
315 Ga0207671_10000025 3300025914 Bacteria 271617
316 Ga0207671_10001126 3300025914 Bacteria 32182
317 Ga0207671_10007029 3300025914 Bacteria 9862
318 Ga0207671_10039959 3300025914 Bacteria 3473
319 Ga0207671_10093699 3300025914 Bacteria 2265
320 Ga0207660_10004753 3300025917 Bacteria 8844
321 Ga0207660_10095889 3300025917 Bacteria 2207
322 Ga0207662_10091740 3300025918 Bacteria 1869
323 Ga0207657_10004855 3300025919 Bacteria 14159
324 Ga0207657_10011713 3300025919 Bacteria 8689
325 Ga0207657_10089855 3300025919 Bacteria 2564
326 Ga0207657_10120429 3300025919 Bacteria 2159
327 Ga0207649_10002116 3300025920 Bacteria 11250
328 Ga0207649_10073520 3300025920 Unclassified 2190
329 Ga0207652_10000011 3300025921 Bacteria 246742
330 Ga0207652_10001308 3300025921 Bacteria 22126
331 Ga0207652_10003341 3300025921 Bacteria 13262
332 Ga0207681_10094932 3300025923 Bacteria 2138
333 Ga0207650_10003727 3300025925 Bacteria 10424
334 Ga0207659_10011219 3300025926 Bacteria 5656
335 Ga0207664_10000048 3300025929 Bacteria 138515
336 Ga0207706_10001784 3300025933 Bacteria 21146
337 Ga0207706_10002489 3300025933 Bacteria 17951
338 Ga0207706_10007739 3300025933 Bacteria 9918
339 Ga0207706_10077167 3300025933 Bacteria 2930
340 Ga0207686_10000715 3300025934 Bacteria 20597
341 Ga0207686_10033261 3300025934 Bacteria 3076
342 Ga0207670_10006016 3300025936 Bacteria 6705
343 Ga0207691_10085710 3300025940 Bacteria 2827
344 Ga0207689_10001497 3300025942 Bacteria 22310
345 Ga0207689_10002441 3300025942 Bacteria 17314
346 Ga0207689_10053082 3300025942 Bacteria 3339
347 Ga0207689_10053580 3300025942 Unclassified 3324
348 Ga0207689_10058662 3300025942 Bacteria 3165
349 Ga0207661_10003258 3300025944 Bacteria 11254
350 Ga0207661_10010722 3300025944 Bacteria 6605
351 Ga0207661_10018303 3300025944 Bacteria 5204
352 Ga0207661_10023950 3300025944 Bacteria 4619
353 Ga0207679_10000915 3300025945 Bacteria 18846
354 Ga0207679_10007237 3300025945 Bacteria 7035
355 Ga0207679_10097647 3300025945 Bacteria 2289
356 Ga0207679_10164514 3300025945 Bacteria 1820
357 Ga0207667_10000222 3300025949 Bacteria 79873
358 Ga0207667_10053470 3300025949 Bacteria 4249
359 Ga0207667_10093867 3300025949 Bacteria 3098
360 Ga0207667_10133916 3300025949 Bacteria 2552
361 Ga0207667_10218890 3300025949 Bacteria 1951
362 Ga0207651_10065340 3300025960 Bacteria 2551
363 Ga0207651_10067053 3300025960 Bacteria 2524
364 Ga0207651_10107050 3300025960 Bacteria 2089
365 Ga0207651_10178936 3300025960 Unclassified 1680
366 Ga0207712_10001188 3300025961 Bacteria 17998
367 Ga0207712_10003348 3300025961 Bacteria 10149
368 Ga0207712_10012872 3300025961 Bacteria 5352
369 Ga0207712_10033185 3300025961 Bacteria 3488
370 Ga0207712_10063540 3300025961 Bacteria 2628
371 Ga0207712_10077614 3300025961 Bacteria 2408
372 Ga0207640_10070234 3300025981 Bacteria 2354
373 Ga0207640_10112472 3300025981 Bacteria 1933
374 Ga0207658_10035215 3300025986 Bacteria 3584
375 Ga0207658_10099259 3300025986 Bacteria 2277
376 Ga0207677_10040572 3300026023 Bacteria 3070
377 Ga0207677_10120049 3300026023 Bacteria 1975
378 Ga0207677_10227030 3300026023 Bacteria 1501
379 Ga0207703_10017694 3300026035 Bacteria 5564
380 Ga0207639_10015099 3300026041 Bacteria 5441
381 Ga0207639_10017528 3300026041 Bacteria 5078
382 Ga0207639_10089995 3300026041 Bacteria 2454
383 Ga0207639_10197452 3300026041 Bacteria 1723
384 Ga0207639_10239888 3300026041 Bacteria 1575
385 Ga0207678_10005810 3300026067 Bacteria 10998
386 Ga0207678_10161103 3300026067 Bacteria 1916
387 Ga0207702_10065338 3300026078 Bacteria 3116
388 Ga0207702_10073034 3300026078 Bacteria 2957
389 Ga0207641_10000213 3300026088 Bacteria 75051
390 Ga0207641_10002072 3300026088 Bacteria 19005
391 Ga0207641_10046045 3300026088 Bacteria 3676
392 Ga0207641_10095701 3300026088 Bacteria 2607
393 Ga0207648_10002070 3300026089 Bacteria 21873
394 Ga0207648_10015356 3300026089 Bacteria 7045
395 Ga0207676_10006342 3300026095 Bacteria 8354
396 Ga0207676_10007606 3300026095 Bacteria 7693
397 Ga0207676_10031454 3300026095 Bacteria 3992
398 Ga0207676_10058002 3300026095 Bacteria 3052
399 Ga0207676_10079700 3300026095 Bacteria 2656
400 Ga0207676_10092097 3300026095 Bacteria 2492
401 Ga0207676_10126522 3300026095 Bacteria 2165
402 Ga0207674_10003090 3300026116 Bacteria 20578
403 Ga0207674_10043911 3300026116 Bacteria 4607
404 Ga0207674_10284343 3300026116 Bacteria 1602
405 Ga0207675_100015939 3300026118 Bacteria 7011
406 Ga0207675_100034661 3300026118 Bacteria 4708
407 Ga0207675_100069249 3300026118 Bacteria 3298
408 Ga0207683_10028015 3300026121 Bacteria 4870
409 Ga0207683_10120621 3300026121 Bacteria 2354
410 Ga0207698_10013920 3300026142 Bacteria 5327
411 Ga0207698_10034075 3300026142 Bacteria 3708
412 Ga0207698_10035341 3300026142 Unclassified 3655
413 Ga0207698_10117317 3300026142 Bacteria 2245
414 Ga0207698_10245657 3300026142 Bacteria 1634
415 Ga0209974_10017345 3300027876 Bacteria 2388
416 Ga0268266_10019494 3300028379 Bacteria 5779
417 Ga0268266_10050321 3300028379 Bacteria 3575
418 Ga0268266_10168931 3300028379 Bacteria 1984
419 Ga0268265_10156368 3300028380 Bacteria 1930
420 Ga0268265_10203632 3300028380 Bacteria 1719
421 Ga0268264_10004982 3300028381 Bacteria 11244
422 Ga0268264_10026700 3300028381 Bacteria 4718
423 Ga0268264_10047532 3300028381 Bacteria 3568
424 Ga0268264_10074819 3300028381 Bacteria 2878
425 Ga0307515_10000002 3300028794 Bacteria 1231751
426 Ga0307515_10000003 3300028794 Bacteria 891317
427 Ga0307515_10000057 3300028794 Bacteria 261695
428 Ga0265770_1004706 3300030878 Unclassified 1866
429 Ga0265339_10033963 3300031249 Bacteria 2869
430 Ga0265327_10000022 3300031251 Bacteria 402724
431 Ga0265327_10000508 3300031251 Bacteria 67561
432 Ga0265327_10000531 3300031251 Bacteria 65562
433 Ga0265327_10002921 3300031251 Bacteria 17111
434 Ga0265327_10008280 3300031251 Bacteria 7786
435 Ga0265316_10102991 3300031344 Unclassified 2168
436 Ga0307513_10165914 3300031456 Bacteria 2093
437 Ga0307509_10019004 3300031507 Bacteria 7863
438 Ga0307509_10085076 3300031507 Bacteria 3256
439 Ga0307408_100001708 3300031548 Bacteria 16126
440 Ga0307408_100128506 3300031548 Unclassified 1974
441 Ga0265313_10028008 3300031595 Bacteria 2937
442 Ga0307516_10002728 3300031730 Bacteria 23265
443 Ga0307406_10038797 3300031901 Bacteria 2951
444 Ga0373925_0128101 3300037068 Unclassified 1977
445 Ga0395899_0010903 3300037312 Bacteria 6965
446 Ga0395899_0022227 3300037312 Bacteria 4810
447 Ga0395899_0034322 3300037312 Bacteria 3809
448 Ga0395900_0001729 3300037418 Bacteria 25209
449 Ga0395900_0017872 3300037418 Bacteria 7238
450 Ga0395900_0034145 3300037418 Bacteria 5236
451 Ga0395900_0071909 3300037418 Bacteria 3556
452 Ga0395898_0001712 3300037466 Bacteria 29076
453 Ga0395898_0031083 3300037466 Bacteria 5340
454 Ga0395898_0128909 3300037466 Bacteria 2423
455 Ga0395905_0007067 3300037471 Bacteria 11222
456 Ga0395905_0021319 3300037471 Bacteria 6130
457 Ga0395905_0053813 3300037471 Bacteria 3767
458 Ga0395901_0008316 3300038443 Bacteria 10488
459 Ga0395901_0009041 3300038443 Bacteria 10087
460 Ga0395901_0033777 3300038443 Bacteria 5282
461 Ga0395901_0043947 3300038443 Bacteria 4634
462 Ga0395901_0058758 3300038443 Bacteria 4000
463 Ga0436365_0577581 3300039437 Bacteria 30054
464 Ga0436365_0905724 3300039437 Bacteria 1408
465 Ga0436365_1553484 3300039437 Bacteria 10706
466 Ga0451577_0000202 3300042876 Bacteria 124050
467 Ga0451577_0291577 3300042876 Unclassified 1479
468 Ga0466972_0000003 3300044658 Bacteria 391452
469 Ga0466972_0016561 3300044658 Bacteria 3686
470 Ga0466982_0091555 3300044672 Bacteria 1884
471 Ga0453684_0000004 3300044712 Bacteria 1469893
472 Ga0453684_0146283 3300044712 Bacteria 2814
473 Ga0466968_0008949 3300044735 Bacteria 3845
474 Ga0466970_0005150 3300044765 Bacteria 6464
475 Ga0466970_0065640 3300044765 Bacteria 1948
476 Ga0466959_0058878 3300045049 Bacteria 2798
477 Ga0466967_0079540 3300045976 Bacteria 2956
478 Ga0466967_0361760 3300045976 Bacteria 1406
479 Ga0495618_0100987 3300046514 Unclassified 1847
480 Ga0495598_0030983 3300046537 Bacteria 1502
481 Ga0495645_0086927 3300046543 Unclassified 2237
482 Ga0495668_0000367 3300046616 Bacteria 59531
483 Ga0495668_0002380 3300046616 Bacteria 15605
484 Ga0495634_0027616 3300046642 Bacteria 3948
485 Ga0495670_0086465 3300046691 Bacteria 1601
486 Ga0495604_0087105 3300047317 Unclassified 2327
487 Ga0495636_0000037 3300047318 Bacteria 56866
488 Ga0495672_0067722 3300047320 Bacteria 2033
489 Ga0495686_0006810 3300047472 Bacteria 8674
490 Ga0495686_0014544 3300047472 Bacteria 5412
491 Ga0496101_0150373 3300048904 Bacteria 1781
492 Ga0496110_0136356 3300048913 Bacteria 2218
493 Ga0496121_0000054 3300048924 Bacteria 307236
494 Ga0496124_0074226 3300048927 Bacteria 2812
495 Ga0496126_0005325 3300048929 Bacteria 14746
496 Ga0501031_0004536 3300049568 Bacteria 9001
497 Ga0501031_0082837 3300049568 Unclassified 2091
498 Ga0501032_0019989 3300049569 Bacteria 4673
499 Ga0501034_0000002 3300049571 Bacteria 565510
500 Ga0501036_0000630 3300049572 Bacteria 25708
501 Ga0501036_0001356 3300049572 Bacteria 18774
502 Ga0501037_0041256 3300049573 Bacteria 3394
503 Ga0501038_0029224 3300049574 Bacteria 4887
504 Ga0501039_0045873 3300049575 Unclassified 3377
505 Ga0501043_0005661 3300049579 Bacteria 10068
506 Ga0501043_0083719 3300049579 Bacteria 2507
507 Ga0501047_0004450 3300049581 Bacteria 13194
508 Ga0501047_0064657 3300049581 Bacteria 3528
509 Ga0501070_0008454 3300049586 Bacteria 8694
510 Ga0501070_0113866 3300049586 Unclassified 2235
511 Ga0501072_0245875 3300049588 Unclassified 1425
512 Ga0501073_0004829 3300049589 Bacteria 10114
513 Ga0501074_0010705 3300049590 Bacteria 6660
514 Ga0501247_000069 3300049677 Bacteria 5677
515 Ga0501251_002312 3300049681 Bacteria 1839
516 Ga0501080_0015066 3300049742 Bacteria 7125
517 Ga0501081_0015376 3300049743 Bacteria 5049
518 Ga0501083_0047809 3300049744 Unclassified 2889
519 Ga0501269_002671 3300049766 Bacteria 2178
520 Ga0501035_0023263 3300049822 Bacteria 5683
521 Ga0501035_0029077 3300049822 Bacteria 5040
522 Ga0501035_0083413 3300049822 Bacteria 2820
523 Ga0501044_0015980 3300049823 Bacteria 8076
524 Ga0501044_0018446 3300049823 Bacteria 7476
525 Ga0501044_0039768 3300049823 Bacteria 4904
526 nmdc:mga0k408_27056_c1 3300050493 Unclassified 3255
527 nmdc:mga0k408_44427_c1 3300050493 Bacteria 2562
528 nmdc:mga09592_16021_c1 3300050508 Bacteria 6126
529 nmdc:mga09592_4462_c1 3300050508 Bacteria 11320
530 nmdc:mga0qj67_39163_c1 3300050509 Bacteria 3721
531 nmdc:mga08y16_171971_c1 3300050511 Bacteria 2250
532 Ga0495619_0027624 3300053085 Unclassified 3657
533 Ga0500644_0000048 3300053088 Bacteria 73311
534 Ga0500581_076207 3300053089 Bacteria 1682
535 Ga0500562_000029 3300053108 Bacteria 94705
536 Ga0500569_002995 3300053109 Unclassified 3394
537 Ga0500642_0009154 3300053130 Unclassified 3422
538 Ga0500658_0010954 3300053134 Bacteria 3343
539 Ga0500568_0003381 3300053139 Bacteria 8919
540 Ga0500604_0002867 3300053151 Unclassified 4675
541 Ga0500616_0004167 3300053153 Bacteria 10435
542 Ga0500622_0000015 3300053156 Bacteria 346227
543 Ga0500622_0000022 3300053156 Bacteria 267246
544 Ga0500622_0000193 3300053156 Bacteria 64805
545 Ga0500622_0001004 3300053156 Bacteria 23799
546 Ga0500611_000069 3300053727 Bacteria 41999
547 Ga0500645_036197 3300053730 Bacteria 1469
548 Ga0501084_0114609 3300054114 Unclassified 2266
549 2740031859 2739367866 Bacteria 4215900
550 2819574187 2818991442 Bacteria 8318214
551 2819588655 2818991444 Bacteria 6968812
552 2821137499 2821136567 Bacteria 8080116
553 2852625544 2852623160 Bacteria 4376875
554 2884934549 2884933994 Bacteria 4535041
555 2904467760 2904467357 Bacteria 8057758
556 2914762787 2914759650 Bacteria 4701441
557 2929157664 2929154850 Bacteria 6753285
558 2929242218 2929239360 Bacteria 7745570
559 2977233084 2977232053 Bacteria 5485925
560 Ga0157372_10081510
561 JGI24751J29686_10012803
562 JGI25406J46586_10001059
563 rootH1_10018150
564 rootH1_10052371
565 rootH1_10117803
566 rootH2_10015699
567 rootH2_10114781
568 rootL2_10004033
569 rootL2_10065261
570 rootL2_10075642
571 rootL2_10132181
572 rootL2_10160375
573 rootL2_10194414
574 rootL2_10226720
575 rootH1_10015492
576 rootH1_10041902
577 rootH1_10098526
578 rootH1_10119581
579 rootH1_10251219
580 rootH1_10256724
581 Ga0055535_1000572
582 Ga0055531_10000041
583 Ga0065165_1001983
584 Ga0065712_10086646
585 Ga0065712_10107515
586 Ga0065712_10129417
587 Ga0070658_10009494
588 Ga0070658_10074535
589 Ga0070658_10086763
590 Ga0070658_10167895
591 Ga0070683_100000417
592 Ga0070683_100014920
593 Ga0070683_100024493
594 Ga0070683_100025718
595 Ga0070683_100045687
596 Ga0070683_100046675
597 Ga0070683_100102110
598 Ga0070670_100033275
599 Ga0070670_100060120
600 Ga0070670_100166206
601 Ga0070670_100200868
602 Ga0068869_100009198
603 Ga0068869_100110952
604 Ga0070666_10002958
605 Ga0070666_10003367
606 Ga0070680_100004033
607 Ga0070680_100032104
608 Ga0070680_100137441
609 Ga0070682_100000190
610 Ga0070682_100018940
611 Ga0068868_100000524
612 Ga0068868_100042742
613 Ga0068868_100095244
614 Ga0068868_100165131
615 Ga0070660_100006675
616 Ga0070660_100190825
617 Ga0070689_100002023
618 Ga0070661_100020138
619 Ga0070668_100013224
620 Ga0070669_100023893
621 Ga0070669_100096607
622 Ga0070675_100006657
623 Ga0070675_100087564
624 Ga0070671_100105816
625 Ga0070673_100093991
626 Ga0070673_100178932
627 Ga0070688_100015633
628 Ga0070659_100022425
629 Ga0070659_100033893
630 Ga0070659_100116503
631 Ga0070659_100179132
632 Ga0070667_100023184
633 Ga0070667_100072478
634 Ga0070714_100000093
635 Ga0070700_100125917
636 Ga0070678_100022194
637 Ga0070662_100002459
638 Ga0070662_100003891
639 Ga0070681_10033322
640 Ga0070681_10257137
641 Ga0068867_100003552
642 Ga0070685_10011485
643 Ga0070685_10016179
644 Ga0070698_100011518
645 Ga0070698_100029257
646 Ga0070698_100084618
647 Ga0070699_100033198
648 Ga0070679_100001265
649 Ga0070679_100023347
650 Ga0070679_100031623
651 Ga0070679_100121412
652 Ga0070679_100163105
653 Ga0070684_100000433
654 Ga0070684_100004933
655 Ga0070684_100010691
656 Ga0070697_100018471
657 Ga0068853_100001703
658 Ga0068853_100024478
659 Ga0068853_100040540
660 Ga0068853_100180730
661 Ga0070686_100143059
662 Ga0070665_100011246
663 Ga0068855_100004062
664 Ga0068855_100016626
665 Ga0068855_100052249
666 Ga0068855_100346773
667 Ga0070664_100006889
668 Ga0070664_100025629
669 Ga0070664_100073927
670 Ga0068857_100011323
671 Ga0068854_100084271
672 Ga0068854_100086644
673 Ga0068856_100017565
674 Ga0068856_100077102
675 Ga0068856_100083052
676 Ga0068852_100001894
677 Ga0068852_100004963
678 Ga0068852_100005740
679 Ga0068852_100033029
680 Ga0068852_100300290
681 Ga0068859_100000023
682 Ga0068859_100015184
683 Ga0068859_100019080
684 Ga0068864_100004780
685 Ga0068864_100007894
686 Ga0068864_100009090
687 Ga0068864_100014772
688 Ga0068864_100048489
689 Ga0068861_100020844
690 Ga0068861_100108203
691 Ga0068861_100160611
692 Ga0068863_100013333
693 Ga0068863_100120840
694 Ga0068863_100161442
695 Ga0068858_100013810
696 Ga0068858_100103472
697 Ga0068860_100056458
698 Ga0068860_100244507
699 Ga0068862_100061127
700 Ga0068862_100063460
701 Ga0068862_100109651
702 Ga0081540_1016967
703 Ga0081539_10002864
704 Ga0081539_10027982
705 Ga0070715_10014634
706 Ga0075367_10012918
707 Ga0075366_10014817
708 Ga0097621_100001040
709 Ga0097621_100006660
710 Ga0097621_100035192
711 Ga0068871_100007865
712 Ga0068871_100008736
713 Ga0068871_100018190
714 Ga0068871_100027376
715 Ga0068871_100037063
716 Ga0068871_100084776
717 Ga0075428_100015198
718 Ga0075428_100318420
719 Ga0075430_100036205
720 Ga0075429_100005844
721 Ga0075429_100058294
722 Ga0068865_100067325
723 Ga0068865_100075117
724 Ga0068865_100085420
725 Ga0097620_100000023
726 Ga0097620_100015184
727 Ga0097620_100019082
728 Ga0099794_10006332
729 Ga0105240_10000283
730 Ga0105240_10000390
731 Ga0105240_10018885
732 Ga0105240_10099952
733 Ga0105240_10141183
734 Ga0111539_10120581
735 Ga0105247_10001787
736 Ga0105243_10063645
737 Ga0105241_10000409
738 Ga0105241_10001396
739 Ga0105241_10083840
740 Ga0105241_10130201
741 Ga0105242_10019529
742 Ga0105242_10054087
743 Ga0105242_10231266
744 Ga0105237_10003688
745 Ga0105237_10030065
746 Ga0105237_10095659
747 Ga0105237_10307377
748 Ga0105238_10008637
749 Ga0105249_10001211
750 Ga0105249_10007479
751 Ga0105249_10008699
752 Ga0105249_10009806
753 Ga0105249_10012755
754 Ga0105249_10013556
755 Ga0105249_10030935
756 Ga0105249_10053900
757 Ga0105239_10000184
758 Ga0105239_10060135
759 Ga0105239_10070500
760 Ga0105239_10092949
761 Ga0105239_10182435
762 Ga0157373_10000350
763 Ga0157373_10002372
764 Ga0157371_10001497
765 Ga0157371_10002643
766 Ga0157371_10003906
767 Ga0157371_10004594
768 Ga0157371_10007068
769 Ga0157371_10008419
770 Ga0157371_10012637
771 Ga0157371_10018133
772 Ga0157371_10057765
773 Ga0157371_10067778
774 Ga0157370_10000839
775 Ga0157370_10004162
776 Ga0157370_10012033
777 Ga0157370_10023019
778 Ga0157370_10062692
779 Ga0157370_10087093
780 Ga0157370_10119709
781 Ga0157370_10136300
782 Ga0157369_10007843
783 Ga0157369_10033474
784 Ga0157369_10071888
785 Ga0157374_10008934
786 Ga0157374_10008935
787 Ga0157374_10016485
788 Ga0157374_10134602
789 Ga0157374_10152079
790 Ga0157374_10349969
791 Ga0157378_10001602
792 Ga0157378_10008492
793 Ga0157378_10037390
794 Ga0157378_10073004
795 Ga0157378_10193193
796 Ga0157378_10212930
797 Ga0163162_10000705
798 Ga0163162_10001117
799 Ga0163162_10009987
800 Ga0163162_10011005
801 Ga0163162_10024996
802 Ga0163162_10162881
803 Ga0163162_10185254
804 Ga0157372_10002887
805 Ga0157372_10008365
806 Ga0157372_10024406
807 Ga0157372_10034569
808 Ga0157372_10039913
809 Ga0157372_10041668
810 Ga0157372_10054732
811 Ga0157372_10191202
812 Ga0157372_10346872
813 Ga0157375_10007105
814 Ga0157375_10010656
815 Ga0157375_10086371
816 Ga0157375_10157660
817 Ga0157375_10176067
818 Ga0157375_10262465
819 Ga0163163_10000198
820 Ga0163163_10000557
821 Ga0163163_10026596
822 Ga0163163_10091728
823 Ga0163163_10106051
824 Ga0163163_10164040
825 Ga0157377_10053067
826 Ga0157377_10063330
827 Ga0157379_10051444
828 Ga0157379_10076667
829 Ga0157379_10080203
830 Ga0157379_10112234
831 Ga0157379_10174549
832 Ga0157379_10206863
833 Ga0157376_10066557
834 Ga0157376_10077425
835 Ga0157376_10082958
836 Ga0157376_10132271
837 Ga0182005_1000109
838 Ga0163161_10000189
839 Ga0163161_10013189
840 Ga0163161_10026859
841 Ga0213876_10014288
842 Ga0213876_10015759
843 Ga0209436_100626
844 Ga0209258_100378
845 Ga0209148_1000391
846 Ga0207426_1007502
847 Ga0209257_1000001
848 Ga0207682_10029421
849 Ga0207710_10009235
850 Ga0207680_10000834
851 Ga0207680_10042985
852 Ga0207647_10001371
853 Ga0207647_10009967
854 Ga0207647_10016593
855 Ga0207685_10012112
856 Ga0207645_10010374
857 Ga0207645_10011044
858 Ga0207643_10038872
859 Ga0207705_10005162
860 Ga0207705_10017399
861 Ga0207705_10063880
862 Ga0207705_10082967
863 Ga0207705_10091242
864 Ga0207654_10000685
865 Ga0207654_10007011
866 Ga0207707_10015678
867 Ga0207707_10015774
868 Ga0207707_10118863
869 Ga0207695_10000020
870 Ga0207695_10003728
871 Ga0207695_10023032
872 Ga0207695_10068921
873 Ga0207695_10076614
874 Ga0207671_10000025
875 Ga0207671_10001126
876 Ga0207671_10007029
877 Ga0207671_10039959
878 Ga0207671_10093699
879 Ga0207660_10004753
880 Ga0207660_10095889
881 Ga0207662_10091740
882 Ga0207657_10004855
883 Ga0207657_10011713
884 Ga0207657_10089855
885 Ga0207657_10120429
886 Ga0207649_10002116
887 Ga0207649_10073520
888 Ga0207652_10000011
889 Ga0207652_10001308
890 Ga0207652_10003341
891 Ga0207681_10094932
892 Ga0207650_10003727
893 Ga0207659_10011219
894 Ga0207664_10000048
895 Ga0207706_10001784
896 Ga0207706_10002489
897 Ga0207706_10007739
898 Ga0207706_10077167
899 Ga0207686_10000715
900 Ga0207686_10033261
901 Ga0207670_10006016
902 Ga0207691_10085710
903 Ga0207689_10001497
904 Ga0207689_10002441
905 Ga0207689_10053082
906 Ga0207689_10053580
907 Ga0207689_10058662
908 Ga0207661_10003258
909 Ga0207661_10010722
910 Ga0207661_10018303
911 Ga0207661_10023950
912 Ga0207679_10000915
913 Ga0207679_10007237
914 Ga0207679_10097647
915 Ga0207679_10164514
916 Ga0207667_10000222
917 Ga0207667_10053470
918 Ga0207667_10093867
919 Ga0207667_10133916
920 Ga0207667_10218890
921 Ga0207651_10065340
922 Ga0207651_10067053
923 Ga0207651_10107050
924 Ga0207651_10178936
925 Ga0207712_10001188
926 Ga0207712_10003348
927 Ga0207712_10012872
928 Ga0207712_10033185
929 Ga0207712_10063540
930 Ga0207712_10077614
931 Ga0207640_10070234
932 Ga0207640_10112472
933 Ga0207658_10035215
934 Ga0207658_10099259
935 Ga0207677_10040572
936 Ga0207677_10120049
937 Ga0207677_10227030
938 Ga0207703_10017694
939 Ga0207639_10015099
940 Ga0207639_10017528
941 Ga0207639_10089995
942 Ga0207639_10197452
943 Ga0207639_10239888
944 Ga0207678_10005810
945 Ga0207678_10161103
946 Ga0207702_10065338
947 Ga0207702_10073034
948 Ga0207641_10000213
949 Ga0207641_10002072
950 Ga0207641_10046045
951 Ga0207641_10095701
952 Ga0207648_10002070
953 Ga0207648_10015356
954 Ga0207676_10006342
955 Ga0207676_10007606
956 Ga0207676_10031454
957 Ga0207676_10058002
958 Ga0207676_10079700
959 Ga0207676_10092097
960 Ga0207676_10126522
961 Ga0207674_10003090
962 Ga0207674_10043911
963 Ga0207674_10284343
964 Ga0207675_100015939
965 Ga0207675_100034661
966 Ga0207675_100069249
967 Ga0207683_10028015
968 Ga0207683_10120621
969 Ga0207698_10013920
970 Ga0207698_10034075
971 Ga0207698_10035341
972 Ga0207698_10117317
973 Ga0207698_10245657
974 Ga0209974_10017345
975 Ga0268266_10019494
976 Ga0268266_10050321
977 Ga0268266_10168931
978 Ga0268265_10156368
979 Ga0268265_10203632
980 Ga0268264_10004982
981 Ga0268264_10026700
982 Ga0268264_10047532
983 Ga0268264_10074819
984 Ga0307515_10000002
985 Ga0307515_10000003
986 Ga0307515_10000057
987 Ga0265770_1004706
988 Ga0265339_10033963
989 Ga0265327_10000022
990 Ga0265327_10000508
991 Ga0265327_10000531
992 Ga0265327_10002921
993 Ga0265327_10008280
994 Ga0265316_10102991
995 Ga0307513_10165914
996 Ga0307509_10019004
997 Ga0307509_10085076
998 Ga0307408_100001708
999 Ga0307408_100128506
1000 Ga0265313_10028008
1001 Ga0307516_10002728
1002 Ga0307406_10038797
1003 Ga0373925_0128101
1004 Ga0395899_0010903
1005 Ga0395899_0022227
1006 Ga0395899_0034322
1007 Ga0395900_0001729
1008 Ga0395900_0017872
1009 Ga0395900_0034145
1010 Ga0395900_0071909
1011 Ga0395898_0001712
1012 Ga0395898_0031083
1013 Ga0395898_0128909
1014 Ga0395905_0007067
1015 Ga0395905_0021319
1016 Ga0395905_0053813
1017 Ga0395901_0008316
1018 Ga0395901_0009041
1019 Ga0395901_0033777
1020 Ga0395901_0043947
1021 Ga0395901_0058758
1022 Ga0436365_0577581
1023 Ga0436365_0905724
1024 Ga0436365_1553484
1025 Ga0451577_0000202
1026 Ga0451577_0291577
1027 Ga0466972_0000003
1028 Ga0466972_0016561
1029 Ga0466982_0091555
1030 Ga0453684_0000004
1031 Ga0453684_0146283
1032 Ga0466968_0008949
1033 Ga0466970_0005150
1034 Ga0466970_0065640
1035 Ga0466959_0058878
1036 Ga0466967_0079540
1037 Ga0466967_0361760
1038 Ga0495618_0100987
1039 Ga0495598_0030983
1040 Ga0495645_0086927
1041 Ga0495668_0000367
1042 Ga0495668_0002380
1043 Ga0495634_0027616
1044 Ga0495670_0086465
1045 Ga0495604_0087105
1046 Ga0495636_0000037
1047 Ga0495672_0067722
1048 Ga0495686_0006810
1049 Ga0495686_0014544
1050 Ga0496101_0150373
1051 Ga0496110_0136356
1052 Ga0496121_0000054
1053 Ga0496124_0074226
1054 Ga0496126_0005325
1055 Ga0501031_0004536
1056 Ga0501031_0082837
1057 Ga0501032_0019989
1058 Ga0501034_0000002
1059 Ga0501036_0000630
1060 Ga0501036_0001356
1061 Ga0501037_0041256
1062 Ga0501038_0029224
1063 Ga0501039_0045873
1064 Ga0501043_0005661
1065 Ga0501043_0083719
1066 Ga0501047_0004450
1067 Ga0501047_0064657
1068 Ga0501070_0008454
1069 Ga0501070_0113866
1070 Ga0501072_0245875
1071 Ga0501073_0004829
1072 Ga0501074_0010705
1073 Ga0501247_000069
1074 Ga0501251_002312
1075 Ga0501080_0015066
1076 Ga0501081_0015376
1077 Ga0501083_0047809
1078 Ga0501269_002671
1079 Ga0501035_0023263
1080 Ga0501035_0029077
1081 Ga0501035_0083413
1082 Ga0501044_0015980
1083 Ga0501044_0018446
1084 Ga0501044_0039768
1085 nmdc:mga0k408_27056_c1
1086 nmdc:mga0k408_44427_c1
1087 nmdc:mga09592_16021_c1
1088 nmdc:mga09592_4462_c1
1089 nmdc:mga0qj67_39163_c1
1090 nmdc:mga08y16_171971_c1
1091 Ga0495619_0027624
1092 Ga0500644_0000048
1093 Ga0500581_076207
1094 Ga0500562_000029
1095 Ga0500569_002995
1096 Ga0500642_0009154
1097 Ga0500658_0010954
1098 Ga0500568_0003381
1099 Ga0500604_0002867
1100 Ga0500616_0004167
1101 Ga0500622_0000015
1102 Ga0500622_0000022
1103 Ga0500622_0000193
1104 Ga0500622_0001004
1105 Ga0500611_000069
1106 Ga0500645_036197
1107 Ga0501084_0114609
1108 2740031859
1109 2819574187
1110 2819588655
1111 2821137499
1112 2852625544
1113 2884934549
1114 2904467760
1115 2914762787
1116 2929157664
1117 2929242218
1118 2977233084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00324

AA_permease

Amino acid permease

64

487

0.82

PF13520

AA_permease_2

Amino acid permease

60

474

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6li9-assembly1.cif.gz_B heteromeric amino acid transporter b0,+at-rbat complex bound with arginine 0.8532 11 391
7dsk-assembly1.cif.gz_B overall structure of the lat1-4f2hc bound with jx-075 0.8515 7 394
6f34-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. 0.8343 7 418
5oqt-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue 0.8268 7 418
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8195 12 418
ID Description Score Start End Superfamily
af_B5DFJ0_32_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9006 7 379 1.20.1740.10
af_Q50E62_26_473_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8971 7 392 1.20.1740.10
af_P71892_30_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8922 7 395 1.20.1740.10
af_K7TR83_40_488_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8874 7 378 1.20.1740.10
af_P24207_19_458_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8865 7 396 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A3A4WG40-F1-model_v4 Amino acid permease 0.9166 8 381 GO:0016020
GO:0055085
AF-A0A2V9LP62-F1-model_v4 Amino acid permease 0.9154 8 403 GO:0005886
GO:0015179
AF-A0A651DNE3-F1-model_v4 Universal stress protein 0.9101 7 396 GO:0005886
GO:0022857
AF-A0A3B3YDD7-F1-model_v4 Solute carrier family 7 member 9 0.908 6 393 GO:0015179
GO:0016020
AF-A0A497IE33-F1-model_v4 Amino acid transporter 0.905 7 390 GO:0005886
GO:0022857

Map