F463568

General Info

Members Datasets Scaffolds Average Seq Length
559 243 559 289

Family's Representative Sequence

Representative Sequence 3300025941|Ga0207711_10075582|Ga0207711_100755824
Length 317
Sequence VASDWWLEGSSTRPVTRNQPLATSLYMRNAVLLMAHGTPASLDDMPEYLRLVRGGRPPSPELVAEMRHNYAAIGGRSPLTDITLAQADALRARLRDSASVAVGMRTWRPFIKDALTDLAAGGHTRVIGIPMAPQFSSVSVQKYVDAAVAALPGHMQFQAVRSFSTHPLLVRAFAEKLRAAQPAHDELVVFTAHSVPLRVIEGGDAYAEEVSATASAVAAEAGVTQFALGYQSAGRTPEPWIGPELGELIAQRSAAGVQRFLIVPIGFVCDHTEILFDIDIQAASVARERGASLRRTESLNTSPTFIAMLEDLVRGML

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
156 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 2.5
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10014354 3300005289 Bacteria 2349
2 Ga0065712_10081924 3300005290 Bacteria 2963
3 Ga0065715_10101837 3300005293 Unclassified 3166
4 Ga0065715_10324391 3300005293 Unclassified 996
5 Ga0065707_10007249 3300005295 Bacteria 4108
6 Ga0070658_10020544 3300005327 Bacteria 5294
7 Ga0070676_10004539 3300005328 Bacteria 7314
8 Ga0070676_10303671 3300005328 Bacteria 1083
9 Ga0070676_10317668 3300005328 Bacteria 1061
10 Ga0070683_100546148 3300005329 Unclassified 1108
11 Ga0070690_100049064 3300005330 Bacteria 2690
12 Ga0070670_100017684 3300005331 Bacteria 6116
13 Ga0070670_100239071 3300005331 Bacteria 1581
14 Ga0068869_100225879 3300005334 Bacteria 1486
15 Ga0070666_10014454 3300005335 Bacteria 5026
16 Ga0070666_10047706 3300005335 Unclassified 2876
17 Ga0070666_10068302 3300005335 Unclassified 2415
18 Ga0068868_100054469 3300005338 Bacteria 3152
19 Ga0068868_100129526 3300005338 Bacteria 2064
20 Ga0068868_100170026 3300005338 Unclassified 1804
21 Ga0070660_100025972 3300005339 Bacteria 4358
22 Ga0070689_100025889 3300005340 Bacteria 4411
23 Ga0070689_100034083 3300005340 Bacteria 3883
24 Ga0070689_100038631 3300005340 Bacteria 3653
25 Ga0070691_10000274 3300005341 Bacteria 18037
26 Ga0070687_100017413 3300005343 Bacteria 3303
27 Ga0070661_100037927 3300005344 Bacteria 3507
28 Ga0070692_10023588 3300005345 Bacteria 3016
29 Ga0070692_10076979 3300005345 Bacteria 1789
30 Ga0070668_100015978 3300005347 Bacteria 5615
31 Ga0070668_100210168 3300005347 Bacteria 1600
32 Ga0070669_100073930 3300005353 Bacteria 2526
33 Ga0070669_100170803 3300005353 Bacteria 1695
34 Ga0070675_100004928 3300005354 Bacteria 10178
35 Ga0070675_100180122 3300005354 Bacteria 1827
36 Ga0070675_100318894 3300005354 Bacteria 1373
37 Ga0070675_100420011 3300005354 Bacteria 1196
38 Ga0070671_100051679 3300005355 Bacteria 3418
39 Ga0070671_100327242 3300005355 Bacteria 1306
40 Ga0070674_100011077 3300005356 Bacteria 5474
41 Ga0070674_100055322 3300005356 Bacteria 2747
42 Ga0070674_100216908 3300005356 Bacteria 1486
43 Ga0070673_100019928 3300005364 Bacteria 4827
44 Ga0070673_100067748 3300005364 Bacteria 2856
45 Ga0070688_100005782 3300005365 Bacteria 6538
46 Ga0070688_100008705 3300005365 Bacteria 5520
47 Ga0070688_100034522 3300005365 Bacteria 3064
48 Ga0070688_100063590 3300005365 Bacteria 2339
49 Ga0070667_100009819 3300005367 Bacteria 7934
50 Ga0070667_100214229 3300005367 Bacteria 1713
51 Ga0070703_10010060 3300005406 Bacteria 2668
52 Ga0070703_10017728 3300005406 Bacteria 2052
53 Ga0070703_10077739 3300005406 Bacteria 1123
54 Ga0070709_10034351 3300005434 Bacteria 3074
55 Ga0070713_100035047 3300005436 Bacteria 4038
56 Ga0070701_10001571 3300005438 Bacteria 8487
57 Ga0070701_10006090 3300005438 Bacteria 5046
58 Ga0070700_100002015 3300005441 Bacteria 10319
59 Ga0070700_100016335 3300005441 Bacteria 4227
60 Ga0070694_100011154 3300005444 Bacteria 5566
61 Ga0070694_100012519 3300005444 Bacteria 5276
62 Ga0070708_100048006 3300005445 Bacteria 3773
63 Ga0070708_100304795 3300005445 Bacteria 1500
64 Ga0070663_100152004 3300005455 Bacteria 1776
65 Ga0070678_100281447 3300005456 Bacteria 1407
66 Ga0070662_100194721 3300005457 Bacteria 1605
67 Ga0070662_100255968 3300005457 Bacteria 1409
68 Ga0070662_100312798 3300005457 Bacteria 1279
69 Ga0070681_10491781 3300005458 Bacteria 1140
70 Ga0068867_100052213 3300005459 Bacteria 3016
71 Ga0068867_100155632 3300005459 Bacteria 1799
72 Ga0070685_10040027 3300005466 Bacteria 2666
73 Ga0070685_10146479 3300005466 Unclassified 1492
74 Ga0070706_100018306 3300005467 Bacteria 6464
75 Ga0070706_100072481 3300005467 Bacteria 3187
76 Ga0070706_100600094 3300005467 Unclassified 1023
77 Ga0070707_100012986 3300005468 Bacteria 7782
78 Ga0070707_100047956 3300005468 Bacteria 4091
79 Ga0070698_100033253 3300005471 Bacteria 5341
80 Ga0070698_100088617 3300005471 Bacteria 3079
81 Ga0070698_100354386 3300005471 Bacteria 1399
82 Ga0070699_100004418 3300005518 Bacteria 12429
83 Ga0070699_100343002 3300005518 Bacteria 1345
84 Ga0070679_100086742 3300005530 Bacteria 3117
85 Ga0070679_100144840 3300005530 Bacteria 2354
86 Ga0070679_100212496 3300005530 Bacteria 1898
87 Ga0070697_100011554 3300005536 Bacteria 6898
88 Ga0070697_100063158 3300005536 Bacteria 3024
89 Ga0070672_100029038 3300005543 Bacteria 4143
90 Ga0070672_100210341 3300005543 Unclassified 1629
91 Ga0070672_100319680 3300005543 Bacteria 1319
92 Ga0070672_100374092 3300005543 Bacteria 1218
93 Ga0070686_100040577 3300005544 Unclassified 2904
94 Ga0070686_100041254 3300005544 Bacteria 2884
95 Ga0070686_100404471 3300005544 Bacteria 1039
96 Ga0070695_100002600 3300005545 Bacteria 10428
97 Ga0070695_100007879 3300005545 Bacteria 6307
98 Ga0070695_100075314 3300005545 Unclassified 2220
99 Ga0070696_100009271 3300005546 Bacteria 6589
100 Ga0070665_100007922 3300005548 Bacteria 10770
101 Ga0070665_100020938 3300005548 Bacteria 6572
102 Ga0070665_100044139 3300005548 Bacteria 4477
103 Ga0070704_100023462 3300005549 Bacteria 4030
104 Ga0070704_100173075 3300005549 Bacteria 1719
105 Ga0068855_100066898 3300005563 Bacteria 4188
106 Ga0068855_100262159 3300005563 Unclassified 1925
107 Ga0070664_100195701 3300005564 Bacteria 1802
108 Ga0068857_100113972 3300005577 Bacteria 2431
109 Ga0068856_100066705 3300005614 Bacteria 3556
110 Ga0068859_100007252 3300005617 Bacteria 11245
111 Ga0068859_100140632 3300005617 Bacteria 2487
112 Ga0068859_100323608 3300005617 Bacteria 1636
113 Ga0068859_100859880 3300005617 Bacteria 993
114 Ga0068864_100008563 3300005618 Bacteria 8442
115 Ga0068864_100174096 3300005618 Bacteria 1964
116 Ga0068864_100276544 3300005618 Bacteria 1566
117 Ga0068866_10008777 3300005718 Bacteria 4272
118 Ga0068866_10068985 3300005718 Bacteria 1861
119 Ga0068861_100023858 3300005719 Bacteria 4417
120 Ga0068861_100076205 3300005719 Bacteria 2613
121 Ga0068861_100128147 3300005719 Bacteria 2056
122 Ga0068861_100163866 3300005719 Bacteria 1836
123 Ga0068851_10038577 3300005834 Bacteria 2397
124 Ga0068863_100094489 3300005841 Unclassified 2838
125 Ga0068863_100171654 3300005841 Bacteria 2080
126 Ga0068863_100507728 3300005841 Bacteria 1188
127 Ga0068858_100012005 3300005842 Bacteria 8166
128 Ga0068858_100054555 3300005842 Bacteria 3695
129 Ga0068858_100090169 3300005842 Bacteria 2853
130 Ga0068858_100114481 3300005842 Bacteria 2520
131 Ga0068858_100216047 3300005842 Bacteria 1815
132 Ga0068858_100240155 3300005842 Bacteria 1719
133 Ga0068858_100267889 3300005842 Unclassified 1625
134 Ga0068858_100374353 3300005842 Bacteria 1366
135 Ga0068860_100064023 3300005843 Bacteria 3493
136 Ga0068860_100073390 3300005843 Bacteria 3252
137 Ga0068860_100086709 3300005843 Bacteria 2980
138 Ga0068860_100249492 3300005843 Unclassified 1728
139 Ga0068860_100512190 3300005843 Unclassified 1199
140 Ga0068860_100599346 3300005843 Bacteria 1107
141 Ga0068862_100034766 3300005844 Bacteria 4266
142 Ga0068862_100074342 3300005844 Bacteria 2937
143 Ga0068862_100097437 3300005844 Bacteria 2568
144 Ga0068862_100196426 3300005844 Bacteria 1818
145 Ga0081539_10012417 3300005985 Bacteria 6566
146 Ga0075365_10224997 3300006038 Bacteria 1316
147 Ga0075363_100138521 3300006048 Bacteria 1369
148 Ga0070712_100212302 3300006175 Bacteria 1527
149 Ga0075367_10067146 3300006178 Bacteria 2150
150 Ga0075366_10036344 3300006195 Bacteria 2904
151 Ga0097621_100155449 3300006237 Bacteria 1963
152 Ga0097621_100309655 3300006237 Bacteria 1397
153 Ga0068871_100002793 3300006358 Bacteria 11934
154 Ga0068871_100003046 3300006358 Bacteria 11499
155 Ga0068871_100007740 3300006358 Bacteria 7693
156 Ga0068871_100056343 3300006358 Bacteria 3195
157 Ga0068871_100361633 3300006358 Bacteria 1285
158 Ga0075428_100019003 3300006844 Bacteria 7601
159 Ga0075428_100048963 3300006844 Bacteria 4637
160 Ga0075428_100504861 3300006844 Bacteria 1294
161 Ga0075431_100002975 3300006847 Bacteria 16397
162 Ga0075431_100158747 3300006847 Bacteria 2326
163 Ga0075433_10009293 3300006852 Bacteria 7861
164 Ga0075433_10026002 3300006852 Bacteria 4952
165 Ga0075433_10031623 3300006852 Bacteria 4525
166 Ga0075433_10083085 3300006852 Bacteria 2826
167 Ga0075433_10117990 3300006852 Bacteria 2355
168 Ga0075433_10172689 3300006852 Bacteria 1923
169 Ga0075433_10297312 3300006852 Bacteria 1430
170 Ga0075434_100002495 3300006871 Bacteria 16216
171 Ga0075434_100003115 3300006871 Bacteria 14769
172 Ga0075434_100089678 3300006871 Bacteria 3076
173 Ga0075434_100122620 3300006871 Bacteria 2615
174 Ga0075434_100191136 3300006871 Bacteria 2068
175 Ga0075434_100234453 3300006871 Bacteria 1855
176 Ga0075434_100257746 3300006871 Bacteria 1763
177 Ga0075434_100292667 3300006871 Bacteria 1648
178 Ga0075434_100504963 3300006871 Bacteria 1230
179 Ga0075434_100611590 3300006871 Bacteria 1109
180 Ga0075429_100005439 3300006880 Bacteria 10969
181 Ga0075429_100007300 3300006880 Bacteria 9590
182 Ga0075429_100249524 3300006880 Bacteria 1554
183 Ga0068865_100005193 3300006881 Bacteria 7874
184 Ga0068865_100043609 3300006881 Bacteria 3066
185 Ga0068865_100059897 3300006881 Bacteria 2664
186 Ga0068865_100112597 3300006881 Bacteria 2010
187 Ga0068865_100329734 3300006881 Bacteria 1230
188 Ga0075436_100001718 3300006914 Bacteria 14994
189 Ga0075436_100023449 3300006914 Bacteria 4238
190 Ga0075436_100024319 3300006914 Bacteria 4163
191 Ga0075436_100123605 3300006914 Unclassified 1812
192 Ga0075436_100135912 3300006914 Bacteria 1726
193 Ga0075436_100143818 3300006914 Bacteria 1677
194 Ga0097620_100007252 3300006931 Bacteria 11245
195 Ga0097620_100140635 3300006931 Bacteria 2487
196 Ga0097620_100323588 3300006931 Bacteria 1636
197 Ga0097620_100859914 3300006931 Bacteria 993
198 Ga0075435_100000189 3300007076 Bacteria 36888
199 Ga0075435_100004108 3300007076 Bacteria 9977
200 Ga0075435_100006656 3300007076 Bacteria 8190
201 Ga0075435_100041383 3300007076 Bacteria 3683
202 Ga0075435_100062151 3300007076 Bacteria 3030
203 Ga0075435_100124593 3300007076 Bacteria 2153
204 Ga0075435_100157128 3300007076 Bacteria 1914
205 Ga0075435_100267729 3300007076 Bacteria 1457
206 Ga0105240_10007971 3300009093 Bacteria 15273
207 Ga0105240_10044110 3300009093 Bacteria 5669
208 Ga0105240_10251276 3300009093 Unclassified 2045
209 Ga0111539_10000113 3300009094 Bacteria 89042
210 Ga0111539_10001163 3300009094 Bacteria 34801
211 Ga0111539_10005541 3300009094 Bacteria 16324
212 Ga0111539_10015377 3300009094 Bacteria 9524
213 Ga0111539_10041743 3300009094 Bacteria 5513
214 Ga0111539_10063221 3300009094 Bacteria 4380
215 Ga0111539_10481695 3300009094 Unclassified 1445
216 Ga0111539_10548251 3300009094 Bacteria 1347
217 Ga0105245_10172751 3300009098 Bacteria 2059
218 Ga0105245_10350831 3300009098 Bacteria 1462
219 Ga0105245_10450860 3300009098 Bacteria 1295
220 Ga0105245_10668891 3300009098 Bacteria 1070
221 Ga0105247_10020269 3300009101 Bacteria 3998
222 Ga0105247_10061636 3300009101 Bacteria 2326
223 Ga0114129_10000304 3300009147 Bacteria 57173
224 Ga0114129_10000973 3300009147 Bacteria 37498
225 Ga0114129_10001441 3300009147 Bacteria 32078
226 Ga0114129_10008836 3300009147 Bacteria 14376
227 Ga0114129_10010838 3300009147 Bacteria 12990
228 Ga0114129_10028157 3300009147 Bacteria 7961
229 Ga0114129_10032236 3300009147 Bacteria 7406
230 Ga0114129_10076604 3300009147 Bacteria 4656
231 Ga0114129_10093085 3300009147 Bacteria 4176
232 Ga0114129_10111041 3300009147 Bacteria 3784
233 Ga0114129_10175097 3300009147 Bacteria 2923
234 Ga0114129_10186811 3300009147 Bacteria 2816
235 Ga0114129_10194362 3300009147 Bacteria 2753
236 Ga0114129_10248595 3300009147 Bacteria 2388
237 Ga0114129_10249543 3300009147 Bacteria 2383
238 Ga0114129_10812831 3300009147 Unclassified 1192
239 Ga0114129_10961935 3300009147 Bacteria 1078
240 Ga0114129_11085990 3300009147 Unclassified 1003
241 Ga0105243_10023948 3300009148 Bacteria 4652
242 Ga0105243_10091083 3300009148 Bacteria 2511
243 Ga0105243_10581861 3300009148 Bacteria 1075
244 Ga0105241_10288400 3300009174 Bacteria 1404
245 Ga0105242_10007403 3300009176 Bacteria 8452
246 Ga0105242_10019556 3300009176 Bacteria 5308
247 Ga0105242_10078318 3300009176 Bacteria 2759
248 Ga0105242_10136644 3300009176 Bacteria 2123
249 Ga0105242_10147674 3300009176 Bacteria 2047
250 Ga0105242_10189993 3300009176 Bacteria 1818
251 Ga0105248_10012470 3300009177 Bacteria 9374
252 Ga0105248_10018908 3300009177 Bacteria 7618
253 Ga0105248_10027872 3300009177 Bacteria 6289
254 Ga0105248_10048116 3300009177 Bacteria 4783
255 Ga0105248_10124011 3300009177 Bacteria 2914
256 Ga0105248_10125905 3300009177 Bacteria 2891
257 Ga0105248_10142530 3300009177 Unclassified 2703
258 Ga0105248_10312655 3300009177 Bacteria 1769
259 Ga0105238_10282816 3300009551 Bacteria 1640
260 Ga0105249_10121234 3300009553 Bacteria 2485
261 Ga0105249_10197217 3300009553 Unclassified 1968
262 Ga0105249_10541655 3300009553 Bacteria 1214
263 Ga0157374_10552587 3300013296 Unclassified 1159
264 Ga0157378_10116970 3300013297 Bacteria 2452
265 Ga0157378_10422239 3300013297 Bacteria 1318
266 Ga0163162_10115562 3300013306 Bacteria 2784
267 Ga0163162_10165603 3300013306 Unclassified 2334
268 Ga0163162_10371105 3300013306 Bacteria 1564
269 Ga0163162_10715711 3300013306 Unclassified 1122
270 Ga0157375_10083553 3300013308 Bacteria 3238
271 Ga0157375_10086789 3300013308 Bacteria 3181
272 Ga0163163_10083922 3300014325 Bacteria 3191
273 Ga0157380_10044104 3300014326 Bacteria 3493
274 Ga0157380_10082179 3300014326 Bacteria 2636
275 Ga0157377_10103805 3300014745 Bacteria 1698
276 Ga0157379_10010988 3300014968 Bacteria 7895
277 Ga0157379_10074736 3300014968 Bacteria 3033
278 Ga0157376_10012899 3300014969 Bacteria 6218
279 Ga0157376_10016785 3300014969 Bacteria 5569
280 Ga0157376_10029287 3300014969 Bacteria 4386
281 Ga0157376_10029487 3300014969 Bacteria 4370
282 Ga0157376_10115996 3300014969 Bacteria 2365
283 Ga0157376_10253122 3300014969 Bacteria 1646
284 Ga0207656_10160819 3300025321 Unclassified 1069
285 Ga0207653_10019824 3300025885 Bacteria 2123
286 Ga0207642_10003940 3300025899 Bacteria 4735
287 Ga0207710_10009810 3300025900 Bacteria 4024
288 Ga0207688_10049142 3300025901 Unclassified 2357
289 Ga0207680_10215415 3300025903 Unclassified 1314
290 Ga0207699_10029078 3300025906 Bacteria 3078
291 Ga0207645_10009489 3300025907 Bacteria 6725
292 Ga0207684_10476332 3300025910 Bacteria 1071
293 Ga0207707_10273751 3300025912 Bacteria 1463
294 Ga0207695_10147777 3300025913 Bacteria 2292
295 Ga0207662_10021170 3300025918 Unclassified 3713
296 Ga0207662_10059719 3300025918 Unclassified 2286
297 Ga0207657_10006081 3300025919 Bacteria 12554
298 Ga0207652_10044663 3300025921 Bacteria 3776
299 Ga0207652_10052787 3300025921 Bacteria 3491
300 Ga0207646_10008996 3300025922 Bacteria 9929
301 Ga0207646_10029177 3300025922 Bacteria 5016
302 Ga0207646_10138982 3300025922 Bacteria 2187
303 Ga0207646_10197216 3300025922 Bacteria 1818
304 Ga0207646_10225558 3300025922 Bacteria 1692
305 Ga0207681_10153492 3300025923 Unclassified 1728
306 Ga0207681_10298786 3300025923 Bacteria 1273
307 Ga0207650_10202942 3300025925 Bacteria 1589
308 Ga0207659_10000637 3300025926 Bacteria 20834
309 Ga0207687_10056811 3300025927 Bacteria 2746
310 Ga0207644_10006773 3300025931 Bacteria 7466
311 Ga0207706_10156859 3300025933 Bacteria 2001
312 Ga0207706_10183201 3300025933 Bacteria 1839
313 Ga0207670_10014648 3300025936 Bacteria 4662
314 Ga0207670_10018420 3300025936 Bacteria 4244
315 Ga0207670_10120912 3300025936 Bacteria 1903
316 Ga0207670_10250889 3300025936 Bacteria 1368
317 Ga0207704_10025513 3300025938 Bacteria 3226
318 Ga0207704_10312898 3300025938 Eukaryota 1208
319 Ga0207691_10041284 3300025940 Bacteria 4260
320 Ga0207691_10049047 3300025940 Bacteria 3869
321 Ga0207691_10104183 3300025940 Bacteria 2529
322 Ga0207691_10108565 3300025940 Bacteria 2469
323 Ga0207691_10185676 3300025940 Unclassified 1815
324 Ga0207691_10356303 3300025940 Bacteria 1251
325 Ga0207711_10021266 3300025941 Bacteria 5419
326 Ga0207711_10064776 3300025941 Bacteria 3157
327 Ga0207711_10075582 3300025941 Bacteria 2932
328 Ga0207711_10104539 3300025941 Unclassified 2510
329 Ga0207711_10176089 3300025941 Bacteria 1943
330 Ga0207711_10197396 3300025941 Bacteria 1835
331 Ga0207711_10200636 3300025941 Bacteria 1820
332 Ga0207689_10083758 3300025942 Bacteria 2622
333 Ga0207661_10413208 3300025944 Unclassified 1225
334 Ga0207667_10032095 3300025949 Bacteria 5661
335 Ga0207651_10023585 3300025960 Bacteria 3789
336 Ga0207712_10279397 3300025961 Bacteria 1362
337 Ga0207668_10082952 3300025972 Bacteria 2331
338 Ga0207668_10112464 3300025972 Unclassified 2046
339 Ga0207658_10070304 3300025986 Bacteria 2648
340 Ga0207677_10268525 3300026023 Unclassified 1394
341 Ga0207703_10035321 3300026035 Bacteria 3972
342 Ga0207703_10100775 3300026035 Bacteria 2448
343 Ga0207703_10119294 3300026035 Bacteria 2262
344 Ga0207703_10123739 3300026035 Bacteria 2224
345 Ga0207703_10152783 3300026035 Bacteria 2014
346 Ga0207703_10215820 3300026035 Unclassified 1713
347 Ga0207703_10223506 3300026035 Bacteria 1685
348 Ga0207639_10518701 3300026041 Bacteria 1091
349 Ga0207678_10121146 3300026067 Bacteria 2232
350 Ga0207708_10014526 3300026075 Bacteria 5893
351 Ga0207708_10022163 3300026075 Bacteria 4797
352 Ga0207708_10053907 3300026075 Bacteria 3065
353 Ga0207708_10078054 3300026075 Bacteria 2542
354 Ga0207708_10330531 3300026075 Bacteria 1246
355 Ga0207641_10001439 3300026088 Bacteria 23394
356 Ga0207641_10233301 3300026088 Bacteria 1711
357 Ga0207641_10465942 3300026088 Bacteria 1223
358 Ga0207648_10047251 3300026089 Bacteria 3774
359 Ga0207648_10105001 3300026089 Bacteria 2478
360 Ga0207648_10122503 3300026089 Bacteria 2287
361 Ga0207648_10129684 3300026089 Bacteria 2219
362 Ga0207648_10181037 3300026089 Bacteria 1865
363 Ga0207648_10186136 3300026089 Bacteria 1839
364 Ga0207676_10038195 3300026095 Bacteria 3662
365 Ga0207676_10232968 3300026095 Bacteria 1647
366 Ga0207676_10501400 3300026095 Bacteria 1153
367 Ga0207674_10067564 3300026116 Bacteria 3599
368 Ga0207674_10190453 3300026116 Bacteria 2001
369 Ga0207675_100009897 3300026118 Bacteria 8920
370 Ga0207675_100015185 3300026118 Bacteria 7183
371 Ga0207675_100127048 3300026118 Bacteria 2416
372 Ga0207675_100145097 3300026118 Bacteria 2256
373 Ga0207675_100222697 3300026118 Bacteria 1818
374 Ga0207675_100478040 3300026118 Bacteria 1238
375 Ga0207683_10370443 3300026121 Bacteria 1316
376 Ga0209813_10049973 3300027866 Bacteria 1303
377 Ga0207428_10000197 3300027907 Bacteria 84315
378 Ga0207428_10006958 3300027907 Bacteria 10365
379 Ga0207428_10049506 3300027907 Unclassified 3367
380 Ga0268266_10027582 3300028379 Bacteria 4828
381 Ga0268266_10037300 3300028379 Bacteria 4141
382 Ga0268266_10234509 3300028379 Bacteria 1691
383 Ga0268265_10133297 3300028380 Bacteria 2068
384 Ga0268265_10288278 3300028380 Bacteria 1472
385 Ga0268265_10558858 3300028380 Bacteria 1087
386 Ga0268264_10049807 3300028381 Bacteria 3487
387 Ga0268264_10125572 3300028381 Bacteria 2267
388 Ga0268264_10127840 3300028381 Bacteria 2248
389 Ga0268264_10153185 3300028381 Unclassified 2069
390 Ga0268264_10366103 3300028381 Archaea 1377
391 Ga0268264_10429891 3300028381 Bacteria 1275
392 Ga0268264_10549416 3300028381 Bacteria 1133
393 Ga0265318_10030126 3300028577 Bacteria 2112
394 Ga0265332_10079164 3300031238 Bacteria 1395
395 Ga0307408_100314931 3300031548 Bacteria 1316
396 Ga0316579_10068388 3300031691 Bacteria 1680
397 Ga0316576_10053347 3300031727 Unclassified 2946
398 Ga0373948_0002304 3300034817 Bacteria 2801
399 Ga0373958_0001439 3300034819 Bacteria 3202
400 Ga0373958_0022102 3300034819 Unclassified 1186
401 Ga0373959_0002109 3300034820 Bacteria 3174
402 Ga0373928_0026791 3300035084 Bacteria 1250
403 Ga0373934_0029184 3300035086 Bacteria 2153
404 Ga0373944_0140014 3300035089 Bacteria 847
405 Ga0373949_0009791 3300035090 Bacteria 2098
406 Ga0373951_0000437 3300035091 Bacteria 12172
407 Ga0373932_0000260 3300035112 Bacteria 16071
408 Ga0373932_0100679 3300035112 Bacteria 940
409 Ga0373936_0015593 3300035113 Bacteria 2912
410 Ga0373939_0051116 3300035114 Unclassified 1284
411 Ga0373941_0001741 3300035115 Bacteria 4674
412 Ga0373945_0110471 3300035116 Bacteria 1084
413 Ga0373956_0083092 3300035119 Bacteria 1471
414 Ga0373960_0005132 3300035121 Bacteria 3020
415 Ga0373943_0016170 3300035170 Bacteria 3399
416 Ga0373955_0209365 3300035172 Bacteria 1162
417 Ga0373955_0433230 3300035172 Bacteria 801
418 Ga0373942_0021012 3300035207 Bacteria 1643
419 Ga0373961_0005667 3300035241 Bacteria 2998
420 Ga0373962_0018097 3300035242 Bacteria 1830
421 Ga0373924_0006482 3300035410 Bacteria 4193
422 Ga0373931_0000499 3300035691 Bacteria 16005
423 Ga0373935_0028970 3300035692 Bacteria 3425
424 Ga0373947_0036676 3300035725 Bacteria 2908
425 Ga0373937_0069370 3300036401 Bacteria 3250
426 Ga0373937_0232782 3300036401 Bacteria 1735
427 Ga0316582_0155596 3300036647 Bacteria 1547
428 Ga0373925_0032196 3300037068 Bacteria 3858
429 Ga0439435_0014072 3300042436 Bacteria 1971
430 Ga0439435_0048730 3300042436 Bacteria 1207
431 Ga0439460_0010280 3300042461 Bacteria 2392
432 Ga0451576_0042753 3300045051 Bacteria 4784
433 Ga0451576_0186552 3300045051 Bacteria 2166
434 Ga0495629_0091337 3300046459 Bacteria 2125
435 Ga0495629_0187549 3300046459 Bacteria 1432
436 Ga0495580_0060989 3300046472 Bacteria 2649
437 Ga0495582_0059879 3300046473 Bacteria 2101
438 Ga0495582_0318747 3300046473 Bacteria 894
439 Ga0495628_0093436 3300046516 Bacteria 2326
440 Ga0495630_0016635 3300046517 Bacteria 5379
441 Ga0495640_0103470 3300046533 Bacteria 1867
442 Ga0495586_0214363 3300046535 Bacteria 1093
443 Ga0495645_0045725 3300046543 Bacteria 3194
444 Ga0495645_0219238 3300046543 Bacteria 1280
445 Ga0495634_0066324 3300046642 Bacteria 2390
446 Ga0495659_0119147 3300046664 Bacteria 1038
447 Ga0495658_0010929 3300046683 Bacteria 4550
448 Ga0495658_0186868 3300046683 Bacteria 1287
449 Ga0495669_0000747 3300046684 Bacteria 13962
450 Ga0495613_0001615 3300046689 Bacteria 17153
451 Ga0495613_0216985 3300046689 Bacteria 1344
452 Ga0495600_0098037 3300046809 Bacteria 1911
453 Ga0495581_0101192 3300047315 Bacteria 1674
454 Ga0495604_0190262 3300047317 Bacteria 1430
455 Ga0495674_0221165 3300047319 Bacteria 1565
456 Ga0495684_0000581 3300047471 Bacteria 29549
457 Ga0496100_0095002 3300048903 Bacteria 2043
458 Ga0496102_0302435 3300048905 Bacteria 1508
459 Ga0496104_0127006 3300048907 Bacteria 2449
460 Ga0496104_0135810 3300048907 Bacteria 2363
461 Ga0496104_0450943 3300048907 Archaea 1198
462 Ga0496105_0246290 3300048908 Bacteria 1449
463 Ga0496106_0120833 3300048909 Bacteria 2048
464 Ga0496108_0103897 3300048911 Bacteria 2424
465 Ga0496109_0176107 3300048912 Bacteria 2008
466 Ga0496112_0020556 3300048915 Bacteria 6259
467 Ga0496112_0652549 3300048915 Unclassified 982
468 Ga0496113_0419995 3300048916 Bacteria 1074
469 Ga0496114_0000233 3300048917 Bacteria 40546
470 Ga0496115_0039023 3300048918 Unclassified 3771
471 Ga0501042_0197590 3300049578 Unclassified 1450
472 Ga0501046_0003192 3300049580 Bacteria 15097
473 Ga0501046_0331538 3300049580 Unclassified 1107
474 Ga0501048_0046658 3300049582 Bacteria 3092
475 Ga0501048_0079879 3300049582 Bacteria 2308
476 Ga0501071_0065675 3300049587 Bacteria 2635
477 Ga0501072_0102127 3300049588 Bacteria 2279
478 Ga0501072_0105104 3300049588 Bacteria 2245
479 Ga0501074_0055058 3300049590 Bacteria 2868
480 Ga0501075_0125828 3300049591 Bacteria 1951
481 Ga0501075_0216593 3300049591 Unclassified 1461
482 Ga0501076_0076141 3300049592 Bacteria 2691
483 Ga0501076_0158887 3300049592 Bacteria 1841
484 Ga0501079_0352405 3300049741 Bacteria 1153
485 Ga0501081_0001723 3300049743 Bacteria 13581
486 Ga0501081_0020512 3300049743 Bacteria 4404
487 Ga0501081_0173181 3300049743 Bacteria 1559
488 Ga0501081_0246133 3300049743 Bacteria 1304
489 Ga0501035_0052943 3300049822 Bacteria 3631
490 Ga0501045_0093692 3300049824 Unclassified 2221
491 Ga0501045_0235953 3300049824 Bacteria 1362
492 nmdc:mga03n38_71036_c1 3300050490 Bacteria 1611
493 nmdc:mga0yw44_5567_c1 3300050492 Bacteria 5976
494 nmdc:mga0k408_196_c1 3300050493 Bacteria 31871
495 nmdc:mga06z11_780_c1 3300050494 Bacteria 11625
496 nmdc:mga05p37_110685_c1 3300050507 Bacteria 3378
497 nmdc:mga05p37_11442_c1 3300050507 Bacteria 10566
498 nmdc:mga05p37_12782_c1 3300050507 Bacteria 10033
499 nmdc:mga05p37_1569_c2 3300050507 Bacteria 4882
500 nmdc:mga05p37_194227_c1 3300050507 Bacteria 2462
501 nmdc:mga05p37_251179_c1 3300050507 Bacteria 2121
502 nmdc:mga05p37_281364_c1 3300050507 Bacteria 1984
503 nmdc:mga05p37_33124_c1 3300050507 Bacteria 6328
504 nmdc:mga05p37_354068_c1 3300050507 Bacteria 1728
505 nmdc:mga05p37_6071_c1 3300050507 Bacteria 14221
506 nmdc:mga05p37_692388_c1 3300050507 Bacteria 1134
507 nmdc:mga09592_4461_c1 3300050508 Bacteria 11320
508 nmdc:mga06r32_223957_c1 3300050510 Bacteria 1869
509 nmdc:mga06r32_295814_c1 3300050510 Bacteria 1605
510 nmdc:mga06r32_3842_c1 3300050510 Bacteria 13442
511 nmdc:mga08y16_10700_c1 3300050511 Bacteria 9626
512 nmdc:mga08y16_136164_c1 3300050511 Unclassified 2553
513 nmdc:mga08y16_322284_c1 3300050511 Bacteria 1591
514 nmdc:mga08y16_3313_c1 3300050511 Bacteria 16684
515 nmdc:mga08y16_574404_c1 3300050511 Bacteria 1139
516 nmdc:mga0n895_121_c1 3300050512 Bacteria 46448
517 nmdc:mga0n895_128071_c1 3300050512 Bacteria 2563
518 nmdc:mga0n895_225816_c1 3300050512 Bacteria 1901
519 nmdc:mga0n895_27863_c1 3300050512 Bacteria 5368
520 nmdc:mga0n895_428595_c1 3300050512 Unclassified 1337
521 nmdc:mga0n895_451814_c1 3300050512 Unclassified 1297
522 nmdc:mga0n895_462583_c1 3300050512 Unclassified 1280
523 nmdc:mga0n895_552389_c1 3300050512 Bacteria 1157
524 nmdc:mga0n895_80056_c1 3300050512 Bacteria 3254
525 nmdc:mga0n895_91077_c1 3300050512 Bacteria 3051
526 nmdc:mga0rr50_107_c1 3300050513 Bacteria 46254
527 nmdc:mga0rr50_168574_c1 3300050513 Bacteria 1782
528 nmdc:mga0rr50_198153_c1 3300050513 Bacteria 1649
529 nmdc:mga0rr50_322070_c1 3300050513 Bacteria 1296
530 nmdc:mga0rr50_367782_c1 3300050513 Bacteria 1211
531 nmdc:mga0rr50_42030_c1 3300050513 Bacteria 3335
532 nmdc:mga0rr50_532376_c1 3300050513 Bacteria 1000
533 nmdc:mga0rr50_551305_c1 3300050513 Bacteria 982
534 nmdc:mga0rr50_673_c1 3300050513 Bacteria 18292
535 nmdc:mga0rr50_77998_c1 3300050513 Bacteria 2548
536 nmdc:mga08x19_122502_c1 3300050514 Bacteria 1744
537 nmdc:mga08x19_37494_c1 3300050514 Bacteria 3077
538 nmdc:mga08x19_967_c1 3300050514 Bacteria 17964
539 nmdc:mga0a205_110801_c1 3300050515 Bacteria 2644
540 nmdc:mga0a205_11152_c1 3300050515 Bacteria 8272
541 nmdc:mga0a205_13590_c1 3300050515 Bacteria 3984
542 nmdc:mga0a205_146602_c1 3300050515 Bacteria 2260
543 nmdc:mga0a205_244793_c1 3300050515 Bacteria 1674
544 nmdc:mga0a205_32323_c1 3300050515 Bacteria 5017
545 nmdc:mga0a205_340469_c1 3300050515 Unclassified 1368
546 nmdc:mga0a205_8826_c1 3300050515 Bacteria 9180
547 nmdc:mga0a205_9954_c1 3300050515 Bacteria 8722
548 Ga0495601_0005915 3300053077 Bacteria 7135
549 Ga0495601_0094773 3300053077 Bacteria 1924
550 Ga0495595_0032613 3300053084 Bacteria 2347
551 Ga0495595_0070600 3300053084 Bacteria 1650
552 Ga0495619_0000721 3300053085 Bacteria 21611
553 Ga0495619_0019689 3300053085 Bacteria 4293
554 Ga0495619_0038074 3300053085 Bacteria 3136
555 Ga0501084_0415332 3300054114 Bacteria 1137
556 Ga0501082_0029670 3300060353 Bacteria 4713
557 Ga0501082_0338397 3300060353 Bacteria 1311
558 Ga0530510_0226205 3300061734 Bacteria 1391
559 Ga0530510_0634211 3300061734 Bacteria 813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035089 Ga0373944_0140014 Ga0373944_0140014_14_658 213
2 3300035172 Ga0373955_0433230 Ga0373955_0433230_28_672 213
3 3300046535 Ga0495586_0214363 Ga0495586_0214363_437_1081 213
4 3300050513 nmdc:mga0rr50_367782_c1 nmdc:mga0rr50_367782_c1_518_1162 213
5 3300035084 Ga0373928_0026791 Ga0373928_0026791_455_1216 251
6 3300049578 Ga0501042_0197590 Ga0501042_0197590_628_1404 251
7 3300061734 Ga0530510_0634211 Ga0530510_0634211_27_803 251
8 3300050513 nmdc:mga0rr50_532376_c1 nmdc:mga0rr50_532376_c1_130_960 259
9 3300050514 nmdc:mga08x19_37494_c1 nmdc:mga08x19_37494_c1_1091_1972 259
10 3300009177 Ga0105248_10012470 Ga0105248_100124707 263
11 3300025941 Ga0207711_10064776 Ga0207711_100647763 263
12 3300006914 Ga0075436_100123605 Ga0075436_1001236052 266
13 3300007076 Ga0075435_100124593 Ga0075435_1001245932 266
14 3300026089 Ga0207648_10122503 Ga0207648_101225033 266
15 3300005458 Ga0070681_10491781 Ga0070681_104917811 268
16 3300005530 Ga0070679_100212496 Ga0070679_1002124962 268
17 3300028381 Ga0268264_10049807 Ga0268264_100498074 270
18 3300005327 Ga0070658_10020544 Ga0070658_100205444 271
19 3300005339 Ga0070660_100025972 Ga0070660_1000259722 271
20 3300005530 Ga0070679_100144840 Ga0070679_1001448403 271
21 3300005563 Ga0068855_100066898 Ga0068855_1000668982 271
22 3300006358 Ga0068871_100056343 Ga0068871_1000563432 271
23 3300025919 Ga0207657_10006081 Ga0207657_100060819 271
24 3300025921 Ga0207652_10044663 Ga0207652_100446632 271
25 3300025949 Ga0207667_10032095 Ga0207667_100320953 271
26 3300009101 Ga0105247_10020269 Ga0105247_100202694 272
27 3300014968 Ga0157379_10074736 Ga0157379_100747363 272
28 3300035112 Ga0373932_0100679 Ga0373932_0100679_13_834 272
29 3300048907 Ga0496104_0135810 Ga0496104_0135810_425_1243 272
30 3300048911 Ga0496108_0103897 Ga0496108_0103897_1264_2082 272
31 3300048912 Ga0496109_0176107 Ga0496109_0176107_1026_1844 272
32 3300048916 Ga0496113_0419995 Ga0496113_0419995_246_1064 272
33 3300049824 Ga0501045_0093692 Ga0501045_0093692_1365_2204 272
34 3300050513 nmdc:mga0rr50_322070_c1 nmdc:mga0rr50_322070_c1_10_828 272
35 3300005617 Ga0068859_100859880 Ga0068859_1008598801 274
36 3300006931 Ga0097620_100859914 Ga0097620_1008599141 274
37 3300009147 Ga0114129_10249543 Ga0114129_102495432 274
38 3300050507 nmdc:mga05p37_194227_c1 nmdc:mga05p37_194227_c1_608_1489 274
39 3300009093 Ga0105240_10044110 Ga0105240_100441107 275
40 3300009147 Ga0114129_10961935 Ga0114129_109619351 275
41 3300025922 Ga0207646_10138982 Ga0207646_101389822 275
42 3300050513 nmdc:mga0rr50_551305_c1 nmdc:mga0rr50_551305_c1_50_880 275
43 3300050515 nmdc:mga0a205_110801_c1 nmdc:mga0a205_110801_c1_1373_2203 275
44 3300005536 Ga0070697_100011554 Ga0070697_1000115543 280
45 3300042436 Ga0439435_0048730 Ga0439435_0048730_154_1017 281
46 3300006914 Ga0075436_100143818 Ga0075436_1001438183 282
47 3300050507 nmdc:mga05p37_11442_c1 nmdc:mga05p37_11442_c1_6904_7755 282
48 3300050514 nmdc:mga08x19_122502_c1 nmdc:mga08x19_122502_c1_183_1034 282
49 3300050515 nmdc:mga0a205_32323_c1 nmdc:mga0a205_32323_c1_3406_4257 282
50 3300005293 Ga0065715_10101837 Ga0065715_101018372 283
51 3300005329 Ga0070683_100546148 Ga0070683_1005461481 283
52 3300005335 Ga0070666_10068302 Ga0070666_100683022 283
53 3300005344 Ga0070661_100037927 Ga0070661_1000379273 283
54 3300005354 Ga0070675_100004928 Ga0070675_10000492810 283
55 3300005355 Ga0070671_100327242 Ga0070671_1003272422 283
56 3300005365 Ga0070688_100005782 Ga0070688_1000057824 283
57 3300005406 Ga0070703_10010060 Ga0070703_100100602 283
58 3300005406 Ga0070703_10077739 Ga0070703_100777391 283
59 3300005434 Ga0070709_10034351 Ga0070709_100343512 283
60 3300005436 Ga0070713_100035047 Ga0070713_1000350473 283
61 3300005444 Ga0070694_100011154 Ga0070694_1000111547 283
62 3300005445 Ga0070708_100304795 Ga0070708_1003047952 283
63 3300005457 Ga0070662_100312798 Ga0070662_1003127982 283
64 3300005466 Ga0070685_10040027 Ga0070685_100400273 283
65 3300005467 Ga0070706_100600094 Ga0070706_1006000941 283
66 3300005471 Ga0070698_100354386 Ga0070698_1003543862 283
67 3300005530 Ga0070679_100086742 Ga0070679_1000867424 283
68 3300005536 Ga0070697_100063158 Ga0070697_1000631583 283
69 3300005544 Ga0070686_100040577 Ga0070686_1000405771 283
70 3300005545 Ga0070695_100002600 Ga0070695_10000260010 283
71 3300005545 Ga0070695_100075314 Ga0070695_1000753142 283
72 3300005546 Ga0070696_100009271 Ga0070696_1000092718 283
73 3300005549 Ga0070704_100023462 Ga0070704_1000234624 283
74 3300005563 Ga0068855_100262159 Ga0068855_1002621592 283
75 3300005617 Ga0068859_100007252 Ga0068859_10000725210 283
76 3300005617 Ga0068859_100323608 Ga0068859_1003236082 283
77 3300005719 Ga0068861_100076205 Ga0068861_1000762052 283
78 3300005841 Ga0068863_100094489 Ga0068863_1000944891 283
79 3300005842 Ga0068858_100012005 Ga0068858_1000120053 283
80 3300005842 Ga0068858_100114481 Ga0068858_1001144812 283
81 3300005843 Ga0068860_100599346 Ga0068860_1005993462 283
82 3300005844 Ga0068862_100097437 Ga0068862_1000974373 283
83 3300006175 Ga0070712_100212302 Ga0070712_1002123022 283
84 3300006237 Ga0097621_100155449 Ga0097621_1001554492 283
85 3300006358 Ga0068871_100007740 Ga0068871_1000077402 283
86 3300006358 Ga0068871_100361633 Ga0068871_1003616332 283
87 3300006847 Ga0075431_100158747 Ga0075431_1001587472 283
88 3300006852 Ga0075433_10083085 Ga0075433_100830852 283
89 3300006852 Ga0075433_10117990 Ga0075433_101179902 283
90 3300006852 Ga0075433_10297312 Ga0075433_102973121 283
91 3300006871 Ga0075434_100504963 Ga0075434_1005049632 283
92 3300006880 Ga0075429_100249524 Ga0075429_1002495241 283
93 3300006881 Ga0068865_100059897 Ga0068865_1000598972 283
94 3300006914 Ga0075436_100135912 Ga0075436_1001359121 283
95 3300006931 Ga0097620_100007252 Ga0097620_1000072525 283
96 3300006931 Ga0097620_100323588 Ga0097620_1003235882 283
97 3300007076 Ga0075435_100157128 Ga0075435_1001571282 283
98 3300009093 Ga0105240_10251276 Ga0105240_102512761 283
99 3300009094 Ga0111539_10548251 Ga0111539_105482512 283
100 3300009147 Ga0114129_10000304 Ga0114129_100003046 283
101 3300009147 Ga0114129_10032236 Ga0114129_100322366 283
102 3300009147 Ga0114129_10076604 Ga0114129_100766043 283
103 3300009147 Ga0114129_10175097 Ga0114129_101750972 283
104 3300009147 Ga0114129_10194362 Ga0114129_101943624 283
105 3300009147 Ga0114129_10812831 Ga0114129_108128311 283
106 3300009148 Ga0105243_10581861 Ga0105243_105818611 283
107 3300009174 Ga0105241_10288400 Ga0105241_102884002 283
108 3300009177 Ga0105248_10027872 Ga0105248_100278725 283
109 3300009177 Ga0105248_10048116 Ga0105248_100481162 283
110 3300009177 Ga0105248_10312655 Ga0105248_103126551 283
111 3300013308 Ga0157375_10083553 Ga0157375_100835532 283
112 3300014325 Ga0163163_10083922 Ga0163163_100839224 283
113 3300014969 Ga0157376_10016785 Ga0157376_100167856 283
114 3300025903 Ga0207680_10215415 Ga0207680_102154152 283
115 3300025906 Ga0207699_10029078 Ga0207699_100290781 283
116 3300025910 Ga0207684_10476332 Ga0207684_104763321 283
117 3300025912 Ga0207707_10273751 Ga0207707_102737512 283
118 3300025918 Ga0207662_10021170 Ga0207662_100211702 283
119 3300025921 Ga0207652_10052787 Ga0207652_100527871 283
120 3300025923 Ga0207681_10298786 Ga0207681_102987862 283
121 3300025926 Ga0207659_10000637 Ga0207659_1000063719 283
122 3300025936 Ga0207670_10120912 Ga0207670_101209122 283
123 3300025936 Ga0207670_10250889 Ga0207670_102508891 283
124 3300025940 Ga0207691_10185676 Ga0207691_101856762 283
125 3300025941 Ga0207711_10021266 Ga0207711_100212664 283
126 3300025941 Ga0207711_10200636 Ga0207711_102006362 283
127 3300026088 Ga0207641_10001439 Ga0207641_1000143911 283
128 3300026089 Ga0207648_10105001 Ga0207648_101050012 283
129 3300026089 Ga0207648_10181037 Ga0207648_101810372 283
130 3300026118 Ga0207675_100127048 Ga0207675_1001270482 283
131 3300026118 Ga0207675_100145097 Ga0207675_1001450972 283
132 3300027907 Ga0207428_10049506 Ga0207428_100495063 283
133 3300028380 Ga0268265_10558858 Ga0268265_105588581 283
134 3300028381 Ga0268264_10125572 Ga0268264_101255721 283
135 3300028381 Ga0268264_10549416 Ga0268264_105494161 283
136 3300028577 Ga0265318_10030126 Ga0265318_100301262 283
137 3300031238 Ga0265332_10079164 Ga0265332_100791642 283
138 3300031548 Ga0307408_100314931 Ga0307408_1003149311 283
139 3300034817 Ga0373948_0002304 Ga0373948_0002304_1572_2429 283
140 3300034819 Ga0373958_0001439 Ga0373958_0001439_2149_3006 283
141 3300034819 Ga0373958_0022102 Ga0373958_0022102_258_1109 283
142 3300034820 Ga0373959_0002109 Ga0373959_0002109_71_928 283
143 3300035090 Ga0373949_0009791 Ga0373949_0009791_100_957 283
144 3300035091 Ga0373951_0000437 Ga0373951_0000437_3614_4471 283
145 3300035112 Ga0373932_0000260 Ga0373932_0000260_13524_14381 283
146 3300035113 Ga0373936_0015593 Ga0373936_0015593_2023_2877 283
147 3300035115 Ga0373941_0001741 Ga0373941_0001741_2844_3701 283
148 3300035116 Ga0373945_0110471 Ga0373945_0110471_130_984 283
149 3300035119 Ga0373956_0083092 Ga0373956_0083092_115_969 283
150 3300035121 Ga0373960_0005132 Ga0373960_0005132_1368_2225 283
151 3300035170 Ga0373943_0016170 Ga0373943_0016170_1466_2320 283
152 3300035172 Ga0373955_0209365 Ga0373955_0209365_133_987 283
153 3300035207 Ga0373942_0021012 Ga0373942_0021012_200_1057 283
154 3300035241 Ga0373961_0005667 Ga0373961_0005667_2116_2973 283
155 3300035242 Ga0373962_0018097 Ga0373962_0018097_525_1382 283
156 3300035410 Ga0373924_0006482 Ga0373924_0006482_2744_3598 283
157 3300035691 Ga0373931_0000499 Ga0373931_0000499_12699_13556 283
158 3300035692 Ga0373935_0028970 Ga0373935_0028970_523_1377 283
159 3300035725 Ga0373947_0036676 Ga0373947_0036676_1000_1854 283
160 3300036401 Ga0373937_0232782 Ga0373937_0232782_381_1235 283
161 3300037068 Ga0373925_0032196 Ga0373925_0032196_1789_2643 283
162 3300042436 Ga0439435_0014072 Ga0439435_0014072_287_1141 283
163 3300046459 Ga0495629_0091337 Ga0495629_0091337_514_1368 283
164 3300046472 Ga0495580_0060989 Ga0495580_0060989_248_1102 283
165 3300046473 Ga0495582_0318747 Ga0495582_0318747_23_877 283
166 3300046516 Ga0495628_0093436 Ga0495628_0093436_365_1219 283
167 3300046517 Ga0495630_0016635 Ga0495630_0016635_688_1542 283
168 3300046642 Ga0495634_0066324 Ga0495634_0066324_1480_2334 283
169 3300046664 Ga0495659_0119147 Ga0495659_0119147_140_1009 283
170 3300046689 Ga0495613_0001615 Ga0495613_0001615_13995_14849 283
171 3300046689 Ga0495613_0216985 Ga0495613_0216985_20_889 283
172 3300046809 Ga0495600_0098037 Ga0495600_0098037_757_1611 283
173 3300047315 Ga0495581_0101192 Ga0495581_0101192_112_966 283
174 3300047317 Ga0495604_0190262 Ga0495604_0190262_499_1353 283
175 3300047319 Ga0495674_0221165 Ga0495674_0221165_636_1490 283
176 3300047471 Ga0495684_0000581 Ga0495684_0000581_10100_10954 283
177 3300048905 Ga0496102_0302435 Ga0496102_0302435_246_1100 283
178 3300048909 Ga0496106_0120833 Ga0496106_0120833_1141_2013 283
179 3300048915 Ga0496112_0652549 Ga0496112_0652549_23_874 283
180 3300049591 Ga0501075_0216593 Ga0501075_0216593_497_1354 283
181 3300049743 Ga0501081_0173181 Ga0501081_0173181_471_1379 283
182 3300050507 nmdc:mga05p37_110685_c1 nmdc:mga05p37_110685_c1_2244_3110 283
183 3300050507 nmdc:mga05p37_33124_c1 nmdc:mga05p37_33124_c1_2751_3605 283
184 3300050507 nmdc:mga05p37_354068_c1 nmdc:mga05p37_354068_c1_714_1568 283
185 3300050510 nmdc:mga06r32_223957_c1 nmdc:mga06r32_223957_c1_414_1268 283
186 3300050511 nmdc:mga08y16_322284_c1 nmdc:mga08y16_322284_c1_585_1439 283
187 3300050512 nmdc:mga0n895_121_c1 nmdc:mga0n895_121_c1_28206_29102 283
188 3300050512 nmdc:mga0n895_428595_c1 nmdc:mga0n895_428595_c1_111_977 283
189 3300050512 nmdc:mga0n895_462583_c1 nmdc:mga0n895_462583_c1_311_1165 283
190 3300050513 nmdc:mga0rr50_107_c1 nmdc:mga0rr50_107_c1_28206_29102 283
191 3300050513 nmdc:mga0rr50_198153_c1 nmdc:mga0rr50_198153_c1_533_1387 283
192 3300050514 nmdc:mga08x19_967_c1 nmdc:mga08x19_967_c1_2608_3504 283
193 3300050515 nmdc:mga0a205_244793_c1 nmdc:mga0a205_244793_c1_728_1582 283
194 3300050515 nmdc:mga0a205_8826_c1 nmdc:mga0a205_8826_c1_2653_3519 283
195 3300053077 Ga0495601_0005915 Ga0495601_0005915_4998_5852 283
196 3300053077 Ga0495601_0094773 Ga0495601_0094773_1045_1899 283
197 3300053085 Ga0495619_0000721 Ga0495619_0000721_17776_18630 283
198 3300026035 Ga0207703_10223506 Ga0207703_102235062 284
199 3300050490 nmdc:mga03n38_71036_c1 nmdc:mga03n38_71036_c1_268_1128 284
200 3300050492 nmdc:mga0yw44_5567_c1 nmdc:mga0yw44_5567_c1_4207_5067 284
201 3300050493 nmdc:mga0k408_196_c1 nmdc:mga0k408_196_c1_2142_3002 284
202 3300050494 nmdc:mga06z11_780_c1 nmdc:mga06z11_780_c1_4755_5615 284
203 3300050510 nmdc:mga06r32_295814_c1 nmdc:mga06r32_295814_c1_34_894 284
204 3300050511 nmdc:mga08y16_3313_c1 nmdc:mga08y16_3313_c1_1213_2073 284
205 3300006844 Ga0075428_100019003 Ga0075428_1000190037 286
206 3300006880 Ga0075429_100005439 Ga0075429_1000054393 286
207 3300009147 Ga0114129_11085990 Ga0114129_110859901 286
208 3300050507 nmdc:mga05p37_1569_c2 nmdc:mga05p37_1569_c2_3707_4573 286
209 3300050508 nmdc:mga09592_4461_c1 nmdc:mga09592_4461_c1_7350_8216 286
210 3300005328 Ga0070676_10303671 Ga0070676_103036711 287
211 3300005330 Ga0070690_100049064 Ga0070690_1000490642 287
212 3300005334 Ga0068869_100225879 Ga0068869_1002258792 287
213 3300005338 Ga0068868_100054469 Ga0068868_1000544692 287
214 3300005340 Ga0070689_100038631 Ga0070689_1000386312 287
215 3300005345 Ga0070692_10076979 Ga0070692_100769792 287
216 3300005353 Ga0070669_100170803 Ga0070669_1001708032 287
217 3300005356 Ga0070674_100055322 Ga0070674_1000553223 287
218 3300005365 Ga0070688_100063590 Ga0070688_1000635902 287
219 3300005367 Ga0070667_100214229 Ga0070667_1002142292 287
220 3300005438 Ga0070701_10006090 Ga0070701_100060903 287
221 3300005445 Ga0070708_100048006 Ga0070708_1000480065 287
222 3300005455 Ga0070663_100152004 Ga0070663_1001520042 287
223 3300005456 Ga0070678_100281447 Ga0070678_1002814472 287
224 3300005459 Ga0068867_100052213 Ga0068867_1000522132 287
225 3300005471 Ga0070698_100088617 Ga0070698_1000886171 287
226 3300005543 Ga0070672_100029038 Ga0070672_1000290384 287
227 3300005544 Ga0070686_100041254 Ga0070686_1000412544 287
228 3300005617 Ga0068859_100140632 Ga0068859_1001406322 287
229 3300005618 Ga0068864_100174096 Ga0068864_1001740962 287
230 3300005719 Ga0068861_100128147 Ga0068861_1001281472 287
231 3300005843 Ga0068860_100073390 Ga0068860_1000733902 287
232 3300005844 Ga0068862_100074342 Ga0068862_1000743422 287
233 3300006038 Ga0075365_10224997 Ga0075365_102249972 287
234 3300006048 Ga0075363_100138521 Ga0075363_1001385212 287
235 3300006195 Ga0075366_10036344 Ga0075366_100363442 287
236 3300006847 Ga0075431_100002975 Ga0075431_1000029759 287
237 3300006852 Ga0075433_10031623 Ga0075433_100316234 287
238 3300006871 Ga0075434_100257746 Ga0075434_1002577462 287
239 3300006881 Ga0068865_100043609 Ga0068865_1000436092 287
240 3300006914 Ga0075436_100023449 Ga0075436_1000234493 287
241 3300006931 Ga0097620_100140635 Ga0097620_1001406352 287
242 3300007076 Ga0075435_100267729 Ga0075435_1002677291 287
243 3300009094 Ga0111539_10000113 Ga0111539_1000011321 287
244 3300009098 Ga0105245_10172751 Ga0105245_101727512 287
245 3300009147 Ga0114129_10111041 Ga0114129_101110412 287
246 3300009147 Ga0114129_10186811 Ga0114129_101868113 287
247 3300009148 Ga0105243_10091083 Ga0105243_100910832 287
248 3300009176 Ga0105242_10147674 Ga0105242_101476742 287
249 3300009177 Ga0105248_10124011 Ga0105248_101240113 287
250 3300009553 Ga0105249_10121234 Ga0105249_101212342 287
251 3300013306 Ga0163162_10115562 Ga0163162_101155622 287
252 3300014745 Ga0157377_10103805 Ga0157377_101038052 287
253 3300025922 Ga0207646_10029177 Ga0207646_100291772 287
254 3300025927 Ga0207687_10056811 Ga0207687_100568112 287
255 3300025933 Ga0207706_10156859 Ga0207706_101568592 287
256 3300025940 Ga0207691_10049047 Ga0207691_100490472 287
257 3300025941 Ga0207711_10197396 Ga0207711_101973962 287
258 3300025942 Ga0207689_10083758 Ga0207689_100837582 287
259 3300025961 Ga0207712_10279397 Ga0207712_102793972 287
260 3300025986 Ga0207658_10070304 Ga0207658_100703042 287
261 3300026035 Ga0207703_10100775 Ga0207703_101007753 287
262 3300026067 Ga0207678_10121146 Ga0207678_101211463 287
263 3300026075 Ga0207708_10022163 Ga0207708_100221634 287
264 3300026089 Ga0207648_10047251 Ga0207648_100472513 287
265 3300026095 Ga0207676_10501400 Ga0207676_105014002 287
266 3300026116 Ga0207674_10190453 Ga0207674_101904532 287
267 3300026118 Ga0207675_100478040 Ga0207675_1004780402 287
268 3300026121 Ga0207683_10370443 Ga0207683_103704432 287
269 3300027866 Ga0209813_10049973 Ga0209813_100499732 287
270 3300027907 Ga0207428_10000197 Ga0207428_1000019755 287
271 3300049582 Ga0501048_0079879 Ga0501048_0079879_1137_2006 287
272 3300049588 Ga0501072_0105104 Ga0501072_0105104_706_1575 287
273 3300049591 Ga0501075_0125828 Ga0501075_0125828_217_1086 287
274 3300049592 Ga0501076_0158887 Ga0501076_0158887_145_1014 287
275 3300049741 Ga0501079_0352405 Ga0501079_0352405_107_994 287
276 3300049743 Ga0501081_0246133 Ga0501081_0246133_146_1033 287
277 3300050507 nmdc:mga05p37_251179_c1 nmdc:mga05p37_251179_c1_1116_1985 287
278 3300050510 nmdc:mga06r32_3842_c1 nmdc:mga06r32_3842_c1_4910_5779 287
279 3300050513 nmdc:mga0rr50_168574_c1 nmdc:mga0rr50_168574_c1_236_1117 287
280 3300050515 nmdc:mga0a205_9954_c1 nmdc:mga0a205_9954_c1_4743_5612 287
281 3300054114 Ga0501084_0415332 Ga0501084_0415332_161_1030 287
282 3300060353 Ga0501082_0029670 Ga0501082_0029670_1879_2748 287
283 3300060353 Ga0501082_0338397 Ga0501082_0338397_287_1174 287
284 3300005345 Ga0070692_10023588 Ga0070692_100235882 288
285 3300005457 Ga0070662_100255968 Ga0070662_1002559681 288
286 3300005467 Ga0070706_100018306 Ga0070706_1000183062 288
287 3300005468 Ga0070707_100047956 Ga0070707_1000479563 288
288 3300005471 Ga0070698_100033253 Ga0070698_1000332533 288
289 3300006178 Ga0075367_10067146 Ga0075367_100671462 288
290 3300009147 Ga0114129_10000973 Ga0114129_1000097325 288
291 3300009147 Ga0114129_10248595 Ga0114129_102485952 288
292 3300025922 Ga0207646_10197216 Ga0207646_101972162 288
293 3300025922 Ga0207646_10225558 Ga0207646_102255582 288
294 3300026041 Ga0207639_10518701 Ga0207639_105187012 288
295 3300005290 Ga0065712_10081924 Ga0065712_100819242 289
296 3300005293 Ga0065715_10324391 Ga0065715_103243911 289
297 3300005328 Ga0070676_10317668 Ga0070676_103176681 289
298 3300005331 Ga0070670_100017684 Ga0070670_1000176842 289
299 3300005340 Ga0070689_100034083 Ga0070689_1000340833 289
300 3300005365 Ga0070688_100034522 Ga0070688_1000345223 289
301 3300005406 Ga0070703_10017728 Ga0070703_100177282 289
302 3300005457 Ga0070662_100194721 Ga0070662_1001947212 289
303 3300005467 Ga0070706_100072481 Ga0070706_1000724811 289
304 3300005468 Ga0070707_100012986 Ga0070707_1000129861 289
305 3300005543 Ga0070672_100210341 Ga0070672_1002103412 289
306 3300005543 Ga0070672_100319680 Ga0070672_1003196802 289
307 3300005548 Ga0070665_100044139 Ga0070665_1000441396 289
308 3300005549 Ga0070704_100173075 Ga0070704_1001730751 289
309 3300005564 Ga0070664_100195701 Ga0070664_1001957012 289
310 3300005577 Ga0068857_100113972 Ga0068857_1001139722 289
311 3300005841 Ga0068863_100507728 Ga0068863_1005077281 289
312 3300005842 Ga0068858_100090169 Ga0068858_1000901693 289
313 3300005842 Ga0068858_100216047 Ga0068858_1002160472 289
314 3300005843 Ga0068860_100086709 Ga0068860_1000867092 289
315 3300005985 Ga0081539_10012417 Ga0081539_100124173 289
316 3300006844 Ga0075428_100048963 Ga0075428_1000489633 289
317 3300006852 Ga0075433_10009293 Ga0075433_100092934 289
318 3300006852 Ga0075433_10172689 Ga0075433_101726892 289
319 3300006871 Ga0075434_100089678 Ga0075434_1000896782 289
320 3300006871 Ga0075434_100234453 Ga0075434_1002344532 289
321 3300006871 Ga0075434_100611590 Ga0075434_1006115902 289
322 3300006880 Ga0075429_100007300 Ga0075429_1000073004 289
323 3300006881 Ga0068865_100112597 Ga0068865_1001125972 289
324 3300007076 Ga0075435_100041383 Ga0075435_1000413833 289
325 3300009094 Ga0111539_10005541 Ga0111539_100055416 289
326 3300009094 Ga0111539_10015377 Ga0111539_100153776 289
327 3300009094 Ga0111539_10481695 Ga0111539_104816952 289
328 3300009098 Ga0105245_10350831 Ga0105245_103508312 289
329 3300009098 Ga0105245_10450860 Ga0105245_104508602 289
330 3300009147 Ga0114129_10001441 Ga0114129_1000144112 289
331 3300009147 Ga0114129_10008836 Ga0114129_1000883611 289
332 3300009147 Ga0114129_10010838 Ga0114129_100108382 289
333 3300009147 Ga0114129_10093085 Ga0114129_100930852 289
334 3300009176 Ga0105242_10078318 Ga0105242_100783182 289
335 3300009551 Ga0105238_10282816 Ga0105238_102828162 289
336 3300009553 Ga0105249_10541655 Ga0105249_105416551 289
337 3300013297 Ga0157378_10116970 Ga0157378_101169702 289
338 3300013306 Ga0163162_10371105 Ga0163162_103711052 289
339 3300025885 Ga0207653_10019824 Ga0207653_100198242 289
340 3300025922 Ga0207646_10008996 Ga0207646_100089969 289
341 3300025933 Ga0207706_10183201 Ga0207706_101832012 289
342 3300025936 Ga0207670_10018420 Ga0207670_100184202 289
343 3300025940 Ga0207691_10356303 Ga0207691_103563032 289
344 3300025941 Ga0207711_10104539 Ga0207711_101045391 289
345 3300026035 Ga0207703_10123739 Ga0207703_101237392 289
346 3300026035 Ga0207703_10152783 Ga0207703_101527832 289
347 3300026088 Ga0207641_10465942 Ga0207641_104659422 289
348 3300026116 Ga0207674_10067564 Ga0207674_100675642 289
349 3300028379 Ga0268266_10234509 Ga0268266_102345091 289
350 3300028381 Ga0268264_10127840 Ga0268264_101278403 289
351 3300035114 Ga0373939_0051116 Ga0373939_0051116_169_1038 289
352 3300042461 Ga0439460_0010280 Ga0439460_0010280_521_1411 289
353 3300048908 Ga0496105_0246290 Ga0496105_0246290_262_1134 289
354 3300048915 Ga0496112_0020556 Ga0496112_0020556_551_1423 289
355 3300049580 Ga0501046_0003192 Ga0501046_0003192_43_933 289
356 3300049587 Ga0501071_0065675 Ga0501071_0065675_651_1541 289
357 3300049588 Ga0501072_0102127 Ga0501072_0102127_1124_2014 289
358 3300049590 Ga0501074_0055058 Ga0501074_0055058_743_1633 289
359 3300049743 Ga0501081_0001723 Ga0501081_0001723_10727_11617 289
360 3300049822 Ga0501035_0052943 Ga0501035_0052943_1447_2337 289
361 3300050507 nmdc:mga05p37_12782_c1 nmdc:mga05p37_12782_c1_3108_3977 289
362 3300050507 nmdc:mga05p37_281364_c1 nmdc:mga05p37_281364_c1_1069_1953 289
363 3300050507 nmdc:mga05p37_692388_c1 nmdc:mga05p37_692388_c1_33_902 289
364 3300050511 nmdc:mga08y16_574404_c1 nmdc:mga08y16_574404_c1_106_978 289
365 3300050512 nmdc:mga0n895_225816_c1 nmdc:mga0n895_225816_c1_644_1519 289
366 3300050512 nmdc:mga0n895_27863_c1 nmdc:mga0n895_27863_c1_4102_4980 289
367 3300050512 nmdc:mga0n895_552389_c1 nmdc:mga0n895_552389_c1_123_1016 289
368 3300050513 nmdc:mga0rr50_42030_c1 nmdc:mga0rr50_42030_c1_1693_2571 289
369 3300050515 nmdc:mga0a205_11152_c1 nmdc:mga0a205_11152_c1_1421_2299 289
370 3300053085 Ga0495619_0019689 Ga0495619_0019689_1994_2866 289
371 3300005343 Ga0070687_100017413 Ga0070687_1000174131 290
372 3300005518 Ga0070699_100343002 Ga0070699_1003430021 290
373 3300005614 Ga0068856_100066705 Ga0068856_1000667054 290
374 3300005842 Ga0068858_100240155 Ga0068858_1002401552 290
375 3300005842 Ga0068858_100374353 Ga0068858_1003743532 290
376 3300006358 Ga0068871_100003046 Ga0068871_1000030468 290
377 3300006852 Ga0075433_10026002 Ga0075433_100260026 290
378 3300006871 Ga0075434_100122620 Ga0075434_1001226202 290
379 3300009093 Ga0105240_10007971 Ga0105240_100079719 290
380 3300009094 Ga0111539_10001163 Ga0111539_1000116334 290
381 3300009147 Ga0114129_10028157 Ga0114129_100281577 290
382 3300009176 Ga0105242_10136644 Ga0105242_101366442 290
383 3300014969 Ga0157376_10029287 Ga0157376_100292872 290
384 3300014969 Ga0157376_10115996 Ga0157376_101159962 290
385 3300014969 Ga0157376_10253122 Ga0157376_102531221 290
386 3300025913 Ga0207695_10147777 Ga0207695_101477772 290
387 3300025944 Ga0207661_10413208 Ga0207661_104132082 290
388 3300026035 Ga0207703_10119294 Ga0207703_101192942 290
389 3300026089 Ga0207648_10129684 Ga0207648_101296842 290
390 3300031691 Ga0316579_10068388 Ga0316579_100683882 290
391 3300031727 Ga0316576_10053347 Ga0316576_100533472 290
392 3300036647 Ga0316582_0155596 Ga0316582_0155596_356_1234 290
393 3300045051 Ga0451576_0042753 Ga0451576_0042753_2811_3686 290
394 3300046533 Ga0495640_0103470 Ga0495640_0103470_933_1808 290
395 3300046543 Ga0495645_0219238 Ga0495645_0219238_161_1036 290
396 3300046683 Ga0495658_0186868 Ga0495658_0186868_142_1017 290
397 3300048903 Ga0496100_0095002 Ga0496100_0095002_205_1080 290
398 3300048907 Ga0496104_0127006 Ga0496104_0127006_1348_2223 290
399 3300048917 Ga0496114_0000233 Ga0496114_0000233_21512_22387 290
400 3300050507 nmdc:mga05p37_6071_c1 nmdc:mga05p37_6071_c1_463_1365 290
401 3300050512 nmdc:mga0n895_91077_c1 nmdc:mga0n895_91077_c1_952_1854 290
402 3300050515 nmdc:mga0a205_13590_c1 nmdc:mga0a205_13590_c1_131_1033 290
403 3300050515 nmdc:mga0a205_146602_c1 nmdc:mga0a205_146602_c1_1117_1992 290
404 3300053084 Ga0495595_0032613 Ga0495595_0032613_564_1439 290
405 3300005289 Ga0065704_10014354 Ga0065704_100143542 291
406 3300005295 Ga0065707_10007249 Ga0065707_100072495 291
407 3300005328 Ga0070676_10004539 Ga0070676_100045393 291
408 3300005331 Ga0070670_100239071 Ga0070670_1002390711 291
409 3300005335 Ga0070666_10014454 Ga0070666_100144541 291
410 3300005335 Ga0070666_10047706 Ga0070666_100477062 291
411 3300005338 Ga0068868_100129526 Ga0068868_1001295262 291
412 3300005338 Ga0068868_100170026 Ga0068868_1001700262 291
413 3300005340 Ga0070689_100025889 Ga0070689_1000258892 291
414 3300005341 Ga0070691_10000274 Ga0070691_100002747 291
415 3300005347 Ga0070668_100015978 Ga0070668_1000159784 291
416 3300005347 Ga0070668_100210168 Ga0070668_1002101681 291
417 3300005353 Ga0070669_100073930 Ga0070669_1000739302 291
418 3300005354 Ga0070675_100180122 Ga0070675_1001801222 291
419 3300005354 Ga0070675_100318894 Ga0070675_1003188941 291
420 3300005354 Ga0070675_100420011 Ga0070675_1004200112 291
421 3300005355 Ga0070671_100051679 Ga0070671_1000516792 291
422 3300005356 Ga0070674_100011077 Ga0070674_1000110773 291
423 3300005356 Ga0070674_100216908 Ga0070674_1002169082 291
424 3300005364 Ga0070673_100019928 Ga0070673_1000199285 291
425 3300005364 Ga0070673_100067748 Ga0070673_1000677482 291
426 3300005365 Ga0070688_100008705 Ga0070688_1000087056 291
427 3300005367 Ga0070667_100009819 Ga0070667_1000098197 291
428 3300005438 Ga0070701_10001571 Ga0070701_100015717 291
429 3300005441 Ga0070700_100002015 Ga0070700_10000201510 291
430 3300005441 Ga0070700_100016335 Ga0070700_1000163352 291
431 3300005444 Ga0070694_100012519 Ga0070694_1000125192 291
432 3300005459 Ga0068867_100155632 Ga0068867_1001556322 291
433 3300005466 Ga0070685_10146479 Ga0070685_101464792 291
434 3300005518 Ga0070699_100004418 Ga0070699_1000044188 291
435 3300005543 Ga0070672_100374092 Ga0070672_1003740921 291
436 3300005544 Ga0070686_100404471 Ga0070686_1004044711 291
437 3300005545 Ga0070695_100007879 Ga0070695_1000078797 291
438 3300005548 Ga0070665_100007922 Ga0070665_1000079228 291
439 3300005548 Ga0070665_100020938 Ga0070665_1000209386 291
440 3300005618 Ga0068864_100008563 Ga0068864_1000085635 291
441 3300005618 Ga0068864_100276544 Ga0068864_1002765442 291
442 3300005718 Ga0068866_10008777 Ga0068866_100087774 291
443 3300005718 Ga0068866_10068985 Ga0068866_100689852 291
444 3300005719 Ga0068861_100023858 Ga0068861_1000238582 291
445 3300005719 Ga0068861_100163866 Ga0068861_1001638662 291
446 3300005834 Ga0068851_10038577 Ga0068851_100385772 291
447 3300005841 Ga0068863_100171654 Ga0068863_1001716542 291
448 3300005842 Ga0068858_100054555 Ga0068858_1000545554 291
449 3300005842 Ga0068858_100267889 Ga0068858_1002678892 291
450 3300005843 Ga0068860_100064023 Ga0068860_1000640232 291
451 3300005843 Ga0068860_100249492 Ga0068860_1002494922 291
452 3300005843 Ga0068860_100512190 Ga0068860_1005121901 291
453 3300005844 Ga0068862_100034766 Ga0068862_1000347662 291
454 3300005844 Ga0068862_100196426 Ga0068862_1001964261 291
455 3300006237 Ga0097621_100309655 Ga0097621_1003096551 291
456 3300006358 Ga0068871_100002793 Ga0068871_1000027938 291
457 3300006844 Ga0075428_100504861 Ga0075428_1005048612 291
458 3300006871 Ga0075434_100002495 Ga0075434_1000024954 291
459 3300006871 Ga0075434_100003115 Ga0075434_10000311513 291
460 3300006871 Ga0075434_100191136 Ga0075434_1001911362 291
461 3300006871 Ga0075434_100292667 Ga0075434_1002926672 291
462 3300006881 Ga0068865_100005193 Ga0068865_1000051932 291
463 3300006881 Ga0068865_100329734 Ga0068865_1003297341 291
464 3300006914 Ga0075436_100001718 Ga0075436_10000171811 291
465 3300006914 Ga0075436_100024319 Ga0075436_1000243194 291
466 3300007076 Ga0075435_100000189 Ga0075435_10000018912 291
467 3300007076 Ga0075435_100004108 Ga0075435_1000041081 291
468 3300007076 Ga0075435_100006656 Ga0075435_1000066569 291
469 3300007076 Ga0075435_100062151 Ga0075435_1000621512 291
470 3300009094 Ga0111539_10041743 Ga0111539_100417433 291
471 3300009094 Ga0111539_10063221 Ga0111539_100632214 291
472 3300009098 Ga0105245_10668891 Ga0105245_106688911 291
473 3300009101 Ga0105247_10061636 Ga0105247_100616363 291
474 3300009148 Ga0105243_10023948 Ga0105243_100239485 291
475 3300009176 Ga0105242_10007403 Ga0105242_100074033 291
476 3300009176 Ga0105242_10019556 Ga0105242_100195566 291
477 3300009176 Ga0105242_10189993 Ga0105242_101899932 291
478 3300009177 Ga0105248_10018908 Ga0105248_100189083 291
479 3300009177 Ga0105248_10125905 Ga0105248_101259052 291
480 3300009177 Ga0105248_10142530 Ga0105248_101425301 291
481 3300009553 Ga0105249_10197217 Ga0105249_101972172 291
482 3300013296 Ga0157374_10552587 Ga0157374_105525871 291
483 3300013297 Ga0157378_10422239 Ga0157378_104222392 291
484 3300013306 Ga0163162_10165603 Ga0163162_101656032 291
485 3300013306 Ga0163162_10715711 Ga0163162_107157111 291
486 3300013308 Ga0157375_10086789 Ga0157375_100867892 291
487 3300014326 Ga0157380_10044104 Ga0157380_100441044 291
488 3300014326 Ga0157380_10082179 Ga0157380_100821792 291
489 3300014968 Ga0157379_10010988 Ga0157379_100109887 291
490 3300014969 Ga0157376_10012899 Ga0157376_100128994 291
491 3300014969 Ga0157376_10029487 Ga0157376_100294873 291
492 3300025321 Ga0207656_10160819 Ga0207656_101608191 291
493 3300025899 Ga0207642_10003940 Ga0207642_100039404 291
494 3300025900 Ga0207710_10009810 Ga0207710_100098103 291
495 3300025901 Ga0207688_10049142 Ga0207688_100491422 291
496 3300025907 Ga0207645_10009489 Ga0207645_100094897 291
497 3300025918 Ga0207662_10059719 Ga0207662_100597192 291
498 3300025923 Ga0207681_10153492 Ga0207681_101534922 291
499 3300025925 Ga0207650_10202942 Ga0207650_102029422 291
500 3300025931 Ga0207644_10006773 Ga0207644_100067736 291
501 3300025936 Ga0207670_10014648 Ga0207670_100146482 291
502 3300025938 Ga0207704_10025513 Ga0207704_100255132 291
503 3300025938 Ga0207704_10312898 Ga0207704_103128981 291
504 3300025940 Ga0207691_10041284 Ga0207691_100412842 291
505 3300025940 Ga0207691_10104183 Ga0207691_101041832 291
506 3300025940 Ga0207691_10108565 Ga0207691_101085652 291
507 3300025941 Ga0207711_10075582 Ga0207711_100755824 291
508 3300025941 Ga0207711_10176089 Ga0207711_101760892 291
509 3300025960 Ga0207651_10023585 Ga0207651_100235855 291
510 3300025972 Ga0207668_10082952 Ga0207668_100829522 291
511 3300025972 Ga0207668_10112464 Ga0207668_101124642 291
512 3300026023 Ga0207677_10268525 Ga0207677_102685252 291
513 3300026035 Ga0207703_10035321 Ga0207703_100353214 291
514 3300026035 Ga0207703_10215820 Ga0207703_102158202 291
515 3300026075 Ga0207708_10014526 Ga0207708_100145266 291
516 3300026075 Ga0207708_10053907 Ga0207708_100539072 291
517 3300026075 Ga0207708_10078054 Ga0207708_100780542 291
518 3300026075 Ga0207708_10330531 Ga0207708_103305311 291
519 3300026088 Ga0207641_10233301 Ga0207641_102333012 291
520 3300026089 Ga0207648_10186136 Ga0207648_101861362 291
521 3300026095 Ga0207676_10038195 Ga0207676_100381955 291
522 3300026095 Ga0207676_10232968 Ga0207676_102329682 291
523 3300026118 Ga0207675_100009897 Ga0207675_1000098977 291
524 3300026118 Ga0207675_100015185 Ga0207675_1000151856 291
525 3300026118 Ga0207675_100222697 Ga0207675_1002226972 291
526 3300027907 Ga0207428_10006958 Ga0207428_100069588 291
527 3300028379 Ga0268266_10027582 Ga0268266_100275826 291
528 3300028379 Ga0268266_10037300 Ga0268266_100373005 291
529 3300028380 Ga0268265_10133297 Ga0268265_101332972 291
530 3300028380 Ga0268265_10288278 Ga0268265_102882781 291
531 3300028381 Ga0268264_10153185 Ga0268264_101531852 291
532 3300028381 Ga0268264_10366103 Ga0268264_103661031 291
533 3300028381 Ga0268264_10429891 Ga0268264_104298912 291
534 3300035086 Ga0373934_0029184 Ga0373934_0029184_747_1751 291
535 3300036401 Ga0373937_0069370 Ga0373937_0069370_170_1174 291
536 3300045051 Ga0451576_0186552 Ga0451576_0186552_196_1071 291
537 3300046459 Ga0495629_0187549 Ga0495629_0187549_218_1108 291
538 3300046473 Ga0495582_0059879 Ga0495582_0059879_587_1477 291
539 3300046543 Ga0495645_0045725 Ga0495645_0045725_980_1984 291
540 3300046683 Ga0495658_0010929 Ga0495658_0010929_854_1756 291
541 3300046684 Ga0495669_0000747 Ga0495669_0000747_12185_13117 291
542 3300048907 Ga0496104_0450943 Ga0496104_0450943_241_1131 291
543 3300048918 Ga0496115_0039023 Ga0496115_0039023_2840_3730 291
544 3300049580 Ga0501046_0331538 Ga0501046_0331538_76_990 291
545 3300049582 Ga0501048_0046658 Ga0501048_0046658_482_1396 291
546 3300049592 Ga0501076_0076141 Ga0501076_0076141_108_1022 291
547 3300049743 Ga0501081_0020512 Ga0501081_0020512_3271_4185 291
548 3300049824 Ga0501045_0235953 Ga0501045_0235953_372_1250 291
549 3300050511 nmdc:mga08y16_10700_c1 nmdc:mga08y16_10700_c1_4988_5863 291
550 3300050511 nmdc:mga08y16_136164_c1 nmdc:mga08y16_136164_c1_256_1131 291
551 3300050512 nmdc:mga0n895_128071_c1 nmdc:mga0n895_128071_c1_1388_2299 291
552 3300050512 nmdc:mga0n895_451814_c1 nmdc:mga0n895_451814_c1_371_1255 291
553 3300050512 nmdc:mga0n895_80056_c1 nmdc:mga0n895_80056_c1_1932_2828 291
554 3300050513 nmdc:mga0rr50_673_c1 nmdc:mga0rr50_673_c1_8965_9861 291
555 3300050513 nmdc:mga0rr50_77998_c1 nmdc:mga0rr50_77998_c1_1051_1962 291
556 3300050515 nmdc:mga0a205_340469_c1 nmdc:mga0a205_340469_c1_190_1095 291
557 3300053084 Ga0495595_0070600 Ga0495595_0070600_427_1431 291
558 3300053085 Ga0495619_0038074 Ga0495619_0038074_1088_2092 291
559 3300061734 Ga0530510_0226205 Ga0530510_0226205_215_1129 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

28

317

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.9548 3 290
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.9475 2 290
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.9421 3 290
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.9381 2 290
2q3j-assembly1.cif.gz_A crystal structure of the his183ala variant of bacillus subtilis ferrochelatase in complex with n-methyl mesoporphyrin 0.9315 3 290
ID Description Score Start End Superfamily
af_Q54IA8_246_365_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9196 161 270 3.40.50.1400
af_Q2FXA4_3_239_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9151 3 223 3.40.50.1400
af_Q9V9S8_189_328_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.908 141 270 3.40.50.1400
af_D3ZBM3_64_420_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9038 3 290 3.40.50.1400
1ak1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.902 141 271 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A2V8DR72-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9917 42 291 GO:0004325
GO:0005737
GO:0006783
AF-A0A3N5Z1G8-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9859 1 290 GO:0004325
GO:0005737
GO:0006783
AF-A0A2V8DR72-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.98 42 291 GO:0004325
GO:0005737
GO:0006783
AF-A0A3N5Z1G8-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9792 1 290 GO:0004325
GO:0005737
GO:0006783
AF-A0A2V7UMP2-F1-model_v4 coproporphyrin ferrochelatase (EC 4.99.1.9) 0.9772 4 240 GO:0004325
GO:0004729
GO:0006783

Feature Viewer

pLDDT pTM Quality
96.41 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map