F463596
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 559 | 298 | 1118 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300046616|Ga0495668_0002833|Ga0495668_0002833_11275_12087 |
| Length | 270 |
| Sequence | MQQYLDLLQHIIDKGVTKTDRTGTGTTSCFGYQMRFDLQQGFPLVTTKKLHLKSIVYELLWFLQGDTNTRYLKEHNVSIWDEWADENGNLGPVYGKQWRSWQGANGKTIDQISDALNQIKNNPDSRRIIVSAWNVAELPEMALMPCHALFQFYVAPGVNGGKGKLSCQLYQRSADVFLGVPFNIASYALLTMMMAQVCDLEPGDFVHTFGDVHLYSNHIEQARLQLTRTPNALPTMKLNPAVKDLFSFTFEDFTLENYQPHPAIKAPVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 141 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 142 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 144 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 152 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 153 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 154 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 155 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 156 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 157 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 158 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 159 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 160 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 161 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 162 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 163 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 164 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 168 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 231 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 240 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 241 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 242 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 243 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 244 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 258 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 259 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 260 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 261 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 266 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 267 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 268 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 274 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 277 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 279 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 280 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 281 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 282 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 283 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 288 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 289 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 290 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 291 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 292 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 293 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 294 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 295 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 296 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 297 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 298 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.14 |
| Metatranscriptomes | 0.72 |
| Isolates | 2.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.58 |
| Nodule | 0.54 |
| Rhizoplane | 2.5 |
| Rhizosphere | 87.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495668_0002833 | 3300046616 | Bacteria | 13784 |
| 2 | SwRhRL2b_contig_3160980 | 2162886007 | Bacteria | 4069 |
| 3 | JGI24740J21852_10019370 | 3300001979 | Bacteria | 2397 |
| 4 | JGI25156J39149_1001190 | 3300002705 | Bacteria | 11580 |
| 5 | JGI25162J39368_1004954 | 3300002737 | Bacteria | 2824 |
| 6 | JGI25154J39366_1000986 | 3300002738 | Bacteria | 11547 |
| 7 | JGI25157J39369_1001849 | 3300002741 | Bacteria | 6593 |
| 8 | JGI25406J46586_10012099 | 3300003203 | Bacteria | 3757 |
| 9 | rootH2_10013019 | 3300003320 | Bacteria | 26132 |
| 10 | rootL2_10241602 | 3300003322 | Bacteria | 2435 |
| 11 | JGI25160J50197_1000425 | 3300003354 | Bacteria | 26592 |
| 12 | Ga0055532_1000077 | 3300003758 | Bacteria | 122193 |
| 13 | Ga0055525_1000008 | 3300003759 | Bacteria | 604287 |
| 14 | Ga0055542_1012403 | 3300003762 | Bacteria | 1475 |
| 15 | Ga0065704_10072654 | 3300005289 | Bacteria | 8196 |
| 16 | Ga0070658_10025472 | 3300005327 | Bacteria | 4741 |
| 17 | Ga0070658_10028978 | 3300005327 | Bacteria | 4446 |
| 18 | Ga0070658_10196661 | 3300005327 | Bacteria | 1700 |
| 19 | Ga0070676_10120820 | 3300005328 | Bacteria | 1644 |
| 20 | Ga0070683_100007781 | 3300005329 | Bacteria | 9072 |
| 21 | Ga0070683_100522899 | 3300005329 | Bacteria | 1134 |
| 22 | Ga0070670_100050548 | 3300005331 | Bacteria | 3572 |
| 23 | Ga0070670_100210256 | 3300005331 | Bacteria | 1691 |
| 24 | Ga0068869_100010056 | 3300005334 | Bacteria | 6154 |
| 25 | Ga0068869_100017750 | 3300005334 | Bacteria | 4833 |
| 26 | Ga0070666_10000736 | 3300005335 | Bacteria | 19845 |
| 27 | Ga0070666_10089513 | 3300005335 | Bacteria | 2112 |
| 28 | Ga0070680_100000088 | 3300005336 | Bacteria | 51479 |
| 29 | Ga0070680_100038613 | 3300005336 | Bacteria | 3861 |
| 30 | Ga0068868_100025378 | 3300005338 | Bacteria | 4508 |
| 31 | Ga0068868_100045260 | 3300005338 | Bacteria | 3443 |
| 32 | Ga0068868_100224499 | 3300005338 | Bacteria | 1574 |
| 33 | Ga0070660_100042601 | 3300005339 | Bacteria | 3465 |
| 34 | Ga0070660_100058718 | 3300005339 | Bacteria | 2982 |
| 35 | Ga0070660_100080999 | 3300005339 | Bacteria | 2548 |
| 36 | Ga0070660_100105690 | 3300005339 | Bacteria | 2235 |
| 37 | Ga0070660_100132997 | 3300005339 | Bacteria | 1992 |
| 38 | Ga0070660_100260270 | 3300005339 | Bacteria | 1416 |
| 39 | Ga0070689_100026131 | 3300005340 | Bacteria | 4393 |
| 40 | Ga0070661_100017437 | 3300005344 | Bacteria | 5095 |
| 41 | Ga0070668_100036467 | 3300005347 | Bacteria | 3753 |
| 42 | Ga0070668_100189194 | 3300005347 | Bacteria | 1685 |
| 43 | Ga0070669_100147955 | 3300005353 | Bacteria | 1816 |
| 44 | Ga0070675_100038520 | 3300005354 | Bacteria | 3897 |
| 45 | Ga0070671_100014761 | 3300005355 | Bacteria | 6312 |
| 46 | Ga0070671_100110999 | 3300005355 | Bacteria | 2304 |
| 47 | Ga0070674_100121079 | 3300005356 | Bacteria | 1937 |
| 48 | Ga0070673_100023997 | 3300005364 | Bacteria | 4463 |
| 49 | Ga0070673_100536616 | 3300005364 | Bacteria | 1061 |
| 50 | Ga0070688_100008462 | 3300005365 | Bacteria | 5584 |
| 51 | Ga0070659_100010190 | 3300005366 | Bacteria | 6915 |
| 52 | Ga0070659_100043243 | 3300005366 | Bacteria | 3523 |
| 53 | Ga0070659_100078813 | 3300005366 | Bacteria | 2629 |
| 54 | Ga0070659_100082890 | 3300005366 | Bacteria | 2562 |
| 55 | Ga0070663_100375911 | 3300005455 | Bacteria | 1156 |
| 56 | Ga0070678_100013458 | 3300005456 | Bacteria | 5131 |
| 57 | Ga0070678_100131890 | 3300005456 | Bacteria | 1986 |
| 58 | Ga0070662_100151157 | 3300005457 | Bacteria | 1808 |
| 59 | Ga0068867_100008426 | 3300005459 | Bacteria | 7272 |
| 60 | Ga0070679_100000003 | 3300005530 | Bacteria | 307836 |
| 61 | Ga0070679_100075145 | 3300005530 | Bacteria | 3369 |
| 62 | Ga0070679_100347760 | 3300005530 | Bacteria | 1430 |
| 63 | Ga0070672_100027937 | 3300005543 | Bacteria | 4214 |
| 64 | Ga0070665_100043589 | 3300005548 | Bacteria | 4508 |
| 65 | Ga0068855_100045035 | 3300005563 | Bacteria | 5219 |
| 66 | Ga0068855_100079309 | 3300005563 | Bacteria | 3808 |
| 67 | Ga0068855_100737942 | 3300005563 | Bacteria | 1051 |
| 68 | Ga0070664_100024674 | 3300005564 | Bacteria | 4977 |
| 69 | Ga0070664_100048325 | 3300005564 | Bacteria | 3595 |
| 70 | Ga0070664_100094830 | 3300005564 | Bacteria | 2588 |
| 71 | Ga0070664_100273688 | 3300005564 | Bacteria | 1521 |
| 72 | Ga0068857_100046969 | 3300005577 | Bacteria | 3832 |
| 73 | Ga0068857_100075562 | 3300005577 | Bacteria | 3004 |
| 74 | Ga0068854_100094454 | 3300005578 | Bacteria | 2231 |
| 75 | Ga0068859_100000037 | 3300005617 | Bacteria | 165480 |
| 76 | Ga0068859_100005033 | 3300005617 | Bacteria | 13412 |
| 77 | Ga0068859_100154534 | 3300005617 | Bacteria | 2371 |
| 78 | Ga0068859_100167475 | 3300005617 | Bacteria | 2277 |
| 79 | Ga0068859_100338016 | 3300005617 | Bacteria | 1600 |
| 80 | Ga0068864_100009579 | 3300005618 | Bacteria | 7987 |
| 81 | Ga0068864_100053693 | 3300005618 | Bacteria | 3477 |
| 82 | Ga0068864_100055678 | 3300005618 | Bacteria | 3415 |
| 83 | Ga0068864_100303277 | 3300005618 | Bacteria | 1496 |
| 84 | Ga0068866_10024844 | 3300005718 | Bacteria | 2810 |
| 85 | Ga0068861_100044059 | 3300005719 | Bacteria | 3353 |
| 86 | Ga0068851_10008075 | 3300005834 | Bacteria | 4857 |
| 87 | Ga0068851_10010366 | 3300005834 | Bacteria | 4350 |
| 88 | Ga0068851_10117872 | 3300005834 | Bacteria | 1424 |
| 89 | Ga0068870_10012327 | 3300005840 | Bacteria | 3992 |
| 90 | Ga0068863_100032377 | 3300005841 | Bacteria | 4984 |
| 91 | Ga0068858_100002312 | 3300005842 | Bacteria | 19265 |
| 92 | Ga0068858_100841454 | 3300005842 | Bacteria | 896 |
| 93 | Ga0068860_100003825 | 3300005843 | Bacteria | 15482 |
| 94 | Ga0068860_100026415 | 3300005843 | Bacteria | 5597 |
| 95 | Ga0068860_100030783 | 3300005843 | Bacteria | 5160 |
| 96 | Ga0081539_10000531 | 3300005985 | Bacteria | 79191 |
| 97 | Ga0075366_10107926 | 3300006195 | Bacteria | 1674 |
| 98 | Ga0097621_100032447 | 3300006237 | Bacteria | 4151 |
| 99 | Ga0097621_100068063 | 3300006237 | Bacteria | 2936 |
| 100 | Ga0068871_100083751 | 3300006358 | Bacteria | 2646 |
| 101 | Ga0097620_100000037 | 3300006931 | Bacteria | 165480 |
| 102 | Ga0097620_100005033 | 3300006931 | Bacteria | 13412 |
| 103 | Ga0097620_100154525 | 3300006931 | Bacteria | 2371 |
| 104 | Ga0097620_100167474 | 3300006931 | Bacteria | 2277 |
| 105 | Ga0097620_100338022 | 3300006931 | Bacteria | 1600 |
| 106 | Ga0105240_10051294 | 3300009093 | Bacteria | 5193 |
| 107 | Ga0105245_10057483 | 3300009098 | Bacteria | 3498 |
| 108 | Ga0105245_10181275 | 3300009098 | Bacteria | 2012 |
| 109 | Ga0105245_10386836 | 3300009098 | Bacteria | 1394 |
| 110 | Ga0105247_10045640 | 3300009101 | Bacteria | 2689 |
| 111 | Ga0105241_10001242 | 3300009174 | Bacteria | 19468 |
| 112 | Ga0105241_10063295 | 3300009174 | Bacteria | 2854 |
| 113 | Ga0105241_10119939 | 3300009174 | Bacteria | 2116 |
| 114 | Ga0105242_10031141 | 3300009176 | Bacteria | 4258 |
| 115 | Ga0105242_10119104 | 3300009176 | Bacteria | 2263 |
| 116 | Ga0105237_10011912 | 3300009545 | Bacteria | 9193 |
| 117 | Ga0105237_10019373 | 3300009545 | Bacteria | 7028 |
| 118 | Ga0105238_10054006 | 3300009551 | Bacteria | 4036 |
| 119 | Ga0105239_10050855 | 3300010375 | Bacteria | 4544 |
| 120 | Ga0105246_10059113 | 3300011119 | Bacteria | 2658 |
| 121 | Ga0157373_10049310 | 3300013100 | Bacteria | 3001 |
| 122 | Ga0157371_10003328 | 3300013102 | Bacteria | 14681 |
| 123 | Ga0157370_10058627 | 3300013104 | Bacteria | 3659 |
| 124 | Ga0157370_10163019 | 3300013104 | Bacteria | 2074 |
| 125 | Ga0157370_10486663 | 3300013104 | Bacteria | 1134 |
| 126 | Ga0157369_10040311 | 3300013105 | Bacteria | 5098 |
| 127 | Ga0157369_10109403 | 3300013105 | Bacteria | 2939 |
| 128 | Ga0157374_10000500 | 3300013296 | Bacteria | 35513 |
| 129 | Ga0157374_10065573 | 3300013296 | Bacteria | 3410 |
| 130 | Ga0157374_10148425 | 3300013296 | Bacteria | 2279 |
| 131 | Ga0157374_10583976 | 3300013296 | Bacteria | 1127 |
| 132 | Ga0157378_10036726 | 3300013297 | Bacteria | 4336 |
| 133 | Ga0157378_10057003 | 3300013297 | Bacteria | 3482 |
| 134 | Ga0157378_10057524 | 3300013297 | Bacteria | 3465 |
| 135 | Ga0157378_10059615 | 3300013297 | Bacteria | 3405 |
| 136 | Ga0157378_10123678 | 3300013297 | Bacteria | 2387 |
| 137 | Ga0157378_10140088 | 3300013297 | Bacteria | 2245 |
| 138 | Ga0163162_10004768 | 3300013306 | Bacteria | 13086 |
| 139 | Ga0163162_10319034 | 3300013306 | Bacteria | 1686 |
| 140 | Ga0157372_10089689 | 3300013307 | Bacteria | 3494 |
| 141 | Ga0157372_10201163 | 3300013307 | Bacteria | 2307 |
| 142 | Ga0157372_10352456 | 3300013307 | Bacteria | 1715 |
| 143 | Ga0157372_10390004 | 3300013307 | Bacteria | 1623 |
| 144 | Ga0157372_10432922 | 3300013307 | Bacteria | 1533 |
| 145 | Ga0157375_10091600 | 3300013308 | Bacteria | 3102 |
| 146 | Ga0157375_10149311 | 3300013308 | Bacteria | 2471 |
| 147 | Ga0157375_10455800 | 3300013308 | Bacteria | 1444 |
| 148 | Ga0163163_10001732 | 3300014325 | Bacteria | 18387 |
| 149 | Ga0163163_10018090 | 3300014325 | Bacteria | 6586 |
| 150 | Ga0157380_10022365 | 3300014326 | Bacteria | 4758 |
| 151 | Ga0182008_10071418 | 3300014497 | Bacteria | 1708 |
| 152 | Ga0157377_10013348 | 3300014745 | Bacteria | 4157 |
| 153 | Ga0157379_10058571 | 3300014968 | Bacteria | 3445 |
| 154 | Ga0157376_10032889 | 3300014969 | Bacteria | 4169 |
| 155 | Ga0209435_100082 | 3300025206 | Bacteria | 45642 |
| 156 | Ga0209147_100122 | 3300025229 | Bacteria | 138553 |
| 157 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 158 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 159 | Ga0209258_100739 | 3300025242 | Bacteria | 21164 |
| 160 | Ga0209646_1000152 | 3300025246 | Bacteria | 97484 |
| 161 | Ga0209026_1000126 | 3300025250 | Bacteria | 122422 |
| 162 | Ga0209677_102681 | 3300025253 | Bacteria | 6422 |
| 163 | Ga0209148_1000576 | 3300025254 | Bacteria | 34082 |
| 164 | Ga0209759_1000193 | 3300025256 | Bacteria | 97484 |
| 165 | Ga0207426_1000032 | 3300025302 | Bacteria | 457997 |
| 166 | Ga0207656_10007990 | 3300025321 | Bacteria | 3879 |
| 167 | Ga0207656_10139487 | 3300025321 | Bacteria | 1142 |
| 168 | Ga0207682_10029991 | 3300025893 | Bacteria | 2177 |
| 169 | Ga0207682_10039977 | 3300025893 | Bacteria | 1909 |
| 170 | Ga0207642_10012030 | 3300025899 | Bacteria | 3110 |
| 171 | Ga0207710_10166457 | 3300025900 | Bacteria | 1076 |
| 172 | Ga0207688_10050439 | 3300025901 | Bacteria | 2329 |
| 173 | Ga0207680_10002758 | 3300025903 | Bacteria | 8216 |
| 174 | Ga0207680_10024859 | 3300025903 | Bacteria | 3295 |
| 175 | Ga0207645_10008175 | 3300025907 | Bacteria | 7325 |
| 176 | Ga0207645_10113229 | 3300025907 | Bacteria | 1757 |
| 177 | Ga0207643_10061389 | 3300025908 | Bacteria | 2147 |
| 178 | Ga0207705_10094360 | 3300025909 | Bacteria | 2194 |
| 179 | Ga0207654_10001781 | 3300025911 | Bacteria | 11188 |
| 180 | Ga0207654_10009833 | 3300025911 | Bacteria | 4864 |
| 181 | Ga0207654_10364325 | 3300025911 | Bacteria | 998 |
| 182 | Ga0207671_10001737 | 3300025914 | Bacteria | 24547 |
| 183 | Ga0207660_10000231 | 3300025917 | Bacteria | 35986 |
| 184 | Ga0207660_10144387 | 3300025917 | Bacteria | 1822 |
| 185 | Ga0207660_10388337 | 3300025917 | Bacteria | 1123 |
| 186 | Ga0207657_10005484 | 3300025919 | Bacteria | 13247 |
| 187 | Ga0207657_10071592 | 3300025919 | Bacteria | 2936 |
| 188 | Ga0207657_10085037 | 3300025919 | Bacteria | 2651 |
| 189 | Ga0207657_10115329 | 3300025919 | Bacteria | 2214 |
| 190 | Ga0207657_10539017 | 3300025919 | Bacteria | 913 |
| 191 | Ga0207649_10010790 | 3300025920 | Bacteria | 5022 |
| 192 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 193 | Ga0207652_10000101 | 3300025921 | Bacteria | 93033 |
| 194 | Ga0207652_10160509 | 3300025921 | Bacteria | 2015 |
| 195 | Ga0207694_10126826 | 3300025924 | Bacteria | 2042 |
| 196 | Ga0207659_10029066 | 3300025926 | Bacteria | 3763 |
| 197 | Ga0207659_10077383 | 3300025926 | Bacteria | 2448 |
| 198 | Ga0207687_10047815 | 3300025927 | Bacteria | 2967 |
| 199 | Ga0207644_10123410 | 3300025931 | Bacteria | 1974 |
| 200 | Ga0207690_10008026 | 3300025932 | Bacteria | 6267 |
| 201 | Ga0207690_10025312 | 3300025932 | Bacteria | 3724 |
| 202 | Ga0207690_10085253 | 3300025932 | Bacteria | 2217 |
| 203 | Ga0207690_10385863 | 3300025932 | Bacteria | 1114 |
| 204 | Ga0207686_10083724 | 3300025934 | Bacteria | 2088 |
| 205 | Ga0207670_10045864 | 3300025936 | Bacteria | 2900 |
| 206 | Ga0207669_10056730 | 3300025937 | Bacteria | 2380 |
| 207 | Ga0207704_10062769 | 3300025938 | Bacteria | 2312 |
| 208 | Ga0207691_10033299 | 3300025940 | Bacteria | 4797 |
| 209 | Ga0207691_10050300 | 3300025940 | Bacteria | 3815 |
| 210 | Ga0207691_10075103 | 3300025940 | Bacteria | 3048 |
| 211 | Ga0207691_10092613 | 3300025940 | Bacteria | 2707 |
| 212 | Ga0207689_10002113 | 3300025942 | Bacteria | 18676 |
| 213 | Ga0207689_10004902 | 3300025942 | Bacteria | 12069 |
| 214 | Ga0207689_10016695 | 3300025942 | Bacteria | 6212 |
| 215 | Ga0207689_10146936 | 3300025942 | Bacteria | 1942 |
| 216 | Ga0207661_10210677 | 3300025944 | Bacteria | 1713 |
| 217 | Ga0207679_10012499 | 3300025945 | Bacteria | 5537 |
| 218 | Ga0207667_10050356 | 3300025949 | Bacteria | 4395 |
| 219 | Ga0207651_10030376 | 3300025960 | Bacteria | 3440 |
| 220 | Ga0207651_10112157 | 3300025960 | Bacteria | 2049 |
| 221 | Ga0207712_10040602 | 3300025961 | Bacteria | 3195 |
| 222 | Ga0207668_10130196 | 3300025972 | Bacteria | 1920 |
| 223 | Ga0207677_10038689 | 3300026023 | Bacteria | 3130 |
| 224 | Ga0207677_10048022 | 3300026023 | Bacteria | 2871 |
| 225 | Ga0207677_10053515 | 3300026023 | Bacteria | 2748 |
| 226 | Ga0207677_10233828 | 3300026023 | Bacteria | 1482 |
| 227 | Ga0207703_10000878 | 3300026035 | Bacteria | 29522 |
| 228 | Ga0207678_10319081 | 3300026067 | Bacteria | 1337 |
| 229 | Ga0207641_10000121 | 3300026088 | Bacteria | 114943 |
| 230 | Ga0207648_10007071 | 3300026089 | Bacteria | 11073 |
| 231 | Ga0207648_10008275 | 3300026089 | Bacteria | 10099 |
| 232 | Ga0207676_10027669 | 3300026095 | Bacteria | 4225 |
| 233 | Ga0207676_10179411 | 3300026095 | Bacteria | 1853 |
| 234 | Ga0207674_10010770 | 3300026116 | Bacteria | 10317 |
| 235 | Ga0207674_10061307 | 3300026116 | Bacteria | 3801 |
| 236 | Ga0207675_100072985 | 3300026118 | Bacteria | 3210 |
| 237 | Ga0207675_100134258 | 3300026118 | Bacteria | 2347 |
| 238 | Ga0207675_100182952 | 3300026118 | Bacteria | 2007 |
| 239 | Ga0207675_100632143 | 3300026118 | Bacteria | 1075 |
| 240 | Ga0207683_10003508 | 3300026121 | Bacteria | 13678 |
| 241 | Ga0207683_10010782 | 3300026121 | Bacteria | 7793 |
| 242 | Ga0207683_10024062 | 3300026121 | Bacteria | 5241 |
| 243 | Ga0207683_10325089 | 3300026121 | Bacteria | 1409 |
| 244 | Ga0207698_10006261 | 3300026142 | Bacteria | 7406 |
| 245 | Ga0209281_1000056 | 3300027111 | Bacteria | 307619 |
| 246 | Ga0268265_10361576 | 3300028380 | Bacteria | 1329 |
| 247 | Ga0268264_10002971 | 3300028381 | Bacteria | 14730 |
| 248 | Ga0268264_10020319 | 3300028381 | Bacteria | 5427 |
| 249 | Ga0316180_1157605 | 3300030736 | Bacteria | 2566 |
| 250 | Ga0316182_1221789 | 3300030745 | Bacteria | 3419 |
| 251 | Ga0265327_10000432 | 3300031251 | Bacteria | 75935 |
| 252 | Ga0307508_10001325 | 3300031616 | Bacteria | 28026 |
| 253 | Ga0307413_10428649 | 3300031824 | Bacteria | 1044 |
| 254 | Ga0307406_10309760 | 3300031901 | Bacteria | 1217 |
| 255 | Ga0316574_0083314 | 3300035398 | Bacteria | 2033 |
| 256 | Ga0316574_0130205 | 3300035398 | Bacteria | 1619 |
| 257 | Ga0395899_0002720 | 3300037312 | Bacteria | 14258 |
| 258 | Ga0395899_0023907 | 3300037312 | Bacteria | 4623 |
| 259 | Ga0395900_0000028 | 3300037418 | Bacteria | 285042 |
| 260 | Ga0395900_0002348 | 3300037418 | Bacteria | 20948 |
| 261 | Ga0395900_0004043 | 3300037418 | Bacteria | 15651 |
| 262 | Ga0395900_0128905 | 3300037418 | Bacteria | 2593 |
| 263 | Ga0395900_0205762 | 3300037418 | Bacteria | 1989 |
| 264 | Ga0395900_0741019 | 3300037418 | Bacteria | 913 |
| 265 | Ga0395898_0002043 | 3300037466 | Bacteria | 25263 |
| 266 | Ga0395898_0259732 | 3300037466 | Bacteria | 1656 |
| 267 | Ga0395901_0000025 | 3300038443 | Bacteria | 263463 |
| 268 | Ga0395901_0019500 | 3300038443 | Bacteria | 6933 |
| 269 | Ga0395901_0054633 | 3300038443 | Bacteria | 4151 |
| 270 | Ga0395901_0477792 | 3300038443 | Bacteria | 1271 |
| 271 | Ga0395901_0687442 | 3300038443 | Bacteria | 1022 |
| 272 | Ga0439445_0051958 | 3300042004 | Bacteria | 1108 |
| 273 | Ga0439448_0006129 | 3300042005 | Bacteria | 3451 |
| 274 | Ga0439449_0015862 | 3300042007 | Bacteria | 2832 |
| 275 | Ga0439446_0035090 | 3300042156 | Bacteria | 1462 |
| 276 | Ga0466969_0008401 | 3300044656 | Bacteria | 5475 |
| 277 | Ga0466972_0000003 | 3300044658 | Bacteria | 391452 |
| 278 | Ga0466972_0000801 | 3300044658 | Bacteria | 14959 |
| 279 | Ga0466972_0119060 | 3300044658 | Bacteria | 1246 |
| 280 | Ga0466965_0006443 | 3300044683 | Bacteria | 5332 |
| 281 | Ga0466965_0025139 | 3300044683 | Bacteria | 2882 |
| 282 | Ga0466965_0108388 | 3300044683 | Bacteria | 1425 |
| 283 | Ga0466966_0087316 | 3300044684 | Bacteria | 1938 |
| 284 | Ga0466966_0125173 | 3300044684 | Bacteria | 1576 |
| 285 | Ga0466966_0143467 | 3300044684 | Bacteria | 1458 |
| 286 | Ga0466961_0156681 | 3300044693 | Bacteria | 1420 |
| 287 | Ga0466964_0000574 | 3300044706 | Bacteria | 11581 |
| 288 | Ga0466964_0048969 | 3300044706 | Bacteria | 1729 |
| 289 | Ga0453684_0078879 | 3300044712 | Bacteria | 4119 |
| 290 | Ga0466971_0079794 | 3300044719 | Bacteria | 1491 |
| 291 | Ga0466968_0064983 | 3300044735 | Bacteria | 1579 |
| 292 | Ga0466968_0090999 | 3300044735 | Bacteria | 1352 |
| 293 | Ga0466970_0000607 | 3300044765 | Bacteria | 17574 |
| 294 | Ga0466970_0143170 | 3300044765 | Bacteria | 1318 |
| 295 | Ga0466957_0007434 | 3300044842 | Bacteria | 6188 |
| 296 | Ga0466957_0033924 | 3300044842 | Bacteria | 3062 |
| 297 | Ga0466959_0051074 | 3300045049 | Bacteria | 3034 |
| 298 | Ga0466967_0093427 | 3300045976 | Bacteria | 2737 |
| 299 | Ga0495627_001465 | 3300046453 | Bacteria | 13766 |
| 300 | Ga0495603_0117361 | 3300046455 | Bacteria | 1551 |
| 301 | Ga0495590_0001273 | 3300046457 | Bacteria | 10960 |
| 302 | Ga0495591_000236 | 3300046458 | Bacteria | 53618 |
| 303 | Ga0495638_0082435 | 3300046460 | Bacteria | 1951 |
| 304 | Ga0495653_0170872 | 3300046463 | Bacteria | 1500 |
| 305 | Ga0495580_0070292 | 3300046472 | Bacteria | 2445 |
| 306 | Ga0495582_0013683 | 3300046473 | Bacteria | 4466 |
| 307 | Ga0495605_0000177 | 3300046474 | Bacteria | 80399 |
| 308 | Ga0495605_0001739 | 3300046474 | Bacteria | 13947 |
| 309 | Ga0495605_0006538 | 3300046474 | Bacteria | 6690 |
| 310 | Ga0495605_0013984 | 3300046474 | Bacteria | 4405 |
| 311 | Ga0495639_0227324 | 3300046475 | Bacteria | 919 |
| 312 | Ga0495584_0000001 | 3300046491 | Bacteria | 649329 |
| 313 | Ga0495584_0000366 | 3300046491 | Bacteria | 31199 |
| 314 | Ga0495584_0000452 | 3300046491 | Bacteria | 28285 |
| 315 | Ga0495584_0001551 | 3300046491 | Bacteria | 13650 |
| 316 | Ga0495584_0004007 | 3300046491 | Bacteria | 7947 |
| 317 | Ga0495584_0008288 | 3300046491 | Bacteria | 5383 |
| 318 | Ga0495584_0011200 | 3300046491 | Bacteria | 4594 |
| 319 | Ga0495584_0011673 | 3300046491 | Bacteria | 4496 |
| 320 | Ga0495585_0000600 | 3300046492 | Bacteria | 33658 |
| 321 | Ga0495585_0000697 | 3300046492 | Bacteria | 30508 |
| 322 | Ga0495585_0001480 | 3300046492 | Bacteria | 18341 |
| 323 | Ga0495585_0006526 | 3300046492 | Bacteria | 7222 |
| 324 | Ga0495585_0006714 | 3300046492 | Bacteria | 7100 |
| 325 | Ga0495585_0017738 | 3300046492 | Bacteria | 4110 |
| 326 | Ga0495585_0028730 | 3300046492 | Bacteria | 3169 |
| 327 | Ga0495585_0042463 | 3300046492 | Bacteria | 2546 |
| 328 | Ga0495585_0053236 | 3300046492 | Bacteria | 2240 |
| 329 | Ga0495594_0023866 | 3300046499 | Bacteria | 3280 |
| 330 | Ga0495594_0245791 | 3300046499 | Bacteria | 1019 |
| 331 | Ga0495596_0000615 | 3300046500 | Bacteria | 22390 |
| 332 | Ga0495596_0000821 | 3300046500 | Bacteria | 18784 |
| 333 | Ga0495596_0006977 | 3300046500 | Bacteria | 5136 |
| 334 | Ga0495596_0008987 | 3300046500 | Bacteria | 4416 |
| 335 | Ga0495596_0010760 | 3300046500 | Bacteria | 3971 |
| 336 | Ga0495596_0018122 | 3300046500 | Bacteria | 2905 |
| 337 | Ga0495596_0029061 | 3300046500 | Bacteria | 2218 |
| 338 | Ga0495607_0001696 | 3300046501 | Bacteria | 18957 |
| 339 | Ga0495607_0002247 | 3300046501 | Bacteria | 15945 |
| 340 | Ga0495607_0011028 | 3300046501 | Bacteria | 6036 |
| 341 | Ga0495607_0029059 | 3300046501 | Bacteria | 3405 |
| 342 | Ga0495607_0102545 | 3300046501 | Bacteria | 1530 |
| 343 | Ga0495583_0000506 | 3300046506 | Bacteria | 56069 |
| 344 | Ga0495606_0004705 | 3300046507 | Bacteria | 13467 |
| 345 | Ga0495606_0015233 | 3300046507 | Bacteria | 5937 |
| 346 | Ga0495606_0089815 | 3300046507 | Bacteria | 1892 |
| 347 | Ga0495606_0135404 | 3300046507 | Bacteria | 1460 |
| 348 | Ga0495610_0010358 | 3300046512 | Bacteria | 5802 |
| 349 | Ga0495616_0000386 | 3300046513 | Bacteria | 34362 |
| 350 | Ga0495616_0001634 | 3300046513 | Bacteria | 15368 |
| 351 | Ga0495616_0003927 | 3300046513 | Bacteria | 9467 |
| 352 | Ga0495616_0008600 | 3300046513 | Bacteria | 6028 |
| 353 | Ga0495616_0106653 | 3300046513 | Bacteria | 1306 |
| 354 | Ga0495631_0006918 | 3300046518 | Bacteria | 5813 |
| 355 | Ga0495631_0033138 | 3300046518 | Bacteria | 2322 |
| 356 | Ga0495632_0000156 | 3300046519 | Bacteria | 70702 |
| 357 | Ga0495632_0000537 | 3300046519 | Bacteria | 35765 |
| 358 | Ga0495632_0011507 | 3300046519 | Bacteria | 5158 |
| 359 | Ga0495632_0035337 | 3300046519 | Bacteria | 2550 |
| 360 | Ga0495643_0002305 | 3300046522 | Bacteria | 15401 |
| 361 | Ga0495643_0003688 | 3300046522 | Bacteria | 11102 |
| 362 | Ga0495643_0008036 | 3300046522 | Bacteria | 6727 |
| 363 | Ga0495643_0028675 | 3300046522 | Bacteria | 3118 |
| 364 | Ga0495643_0031913 | 3300046522 | Bacteria | 2928 |
| 365 | Ga0495644_0010708 | 3300046523 | Bacteria | 3533 |
| 366 | Ga0495644_0019643 | 3300046523 | Bacteria | 2580 |
| 367 | Ga0495644_0053416 | 3300046523 | Bacteria | 1517 |
| 368 | Ga0495644_0064157 | 3300046523 | Bacteria | 1380 |
| 369 | Ga0495648_0023546 | 3300046524 | Bacteria | 4215 |
| 370 | Ga0495666_0002495 | 3300046526 | Bacteria | 9133 |
| 371 | Ga0495666_0063882 | 3300046526 | Bacteria | 1757 |
| 372 | Ga0495642_0000053 | 3300046528 | Bacteria | 70172 |
| 373 | Ga0495642_0000433 | 3300046528 | Bacteria | 22082 |
| 374 | Ga0495642_0002723 | 3300046528 | Bacteria | 7097 |
| 375 | Ga0495665_0001008 | 3300046531 | Bacteria | 14939 |
| 376 | Ga0495586_0069245 | 3300046535 | Bacteria | 1925 |
| 377 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 378 | Ga0495609_0008646 | 3300046538 | Bacteria | 4969 |
| 379 | Ga0495609_0020636 | 3300046538 | Bacteria | 3042 |
| 380 | Ga0495609_0026206 | 3300046538 | Bacteria | 2669 |
| 381 | Ga0495597_0000488 | 3300046542 | Bacteria | 33250 |
| 382 | Ga0495597_0002178 | 3300046542 | Bacteria | 12864 |
| 383 | Ga0495597_0002942 | 3300046542 | Bacteria | 10335 |
| 384 | Ga0495622_0113871 | 3300046557 | Bacteria | 1237 |
| 385 | Ga0495633_0002380 | 3300046558 | Bacteria | 13321 |
| 386 | Ga0495633_0027256 | 3300046558 | Bacteria | 2793 |
| 387 | Ga0495633_0051966 | 3300046558 | Bacteria | 1930 |
| 388 | Ga0495656_0017719 | 3300046615 | Bacteria | 2722 |
| 389 | Ga0495656_0030285 | 3300046615 | Bacteria | 2186 |
| 390 | Ga0495656_0105218 | 3300046615 | Bacteria | 1311 |
| 391 | Ga0495668_0006442 | 3300046616 | Bacteria | 7684 |
| 392 | Ga0495668_0006681 | 3300046616 | Bacteria | 7509 |
| 393 | Ga0495668_0024499 | 3300046616 | Bacteria | 3432 |
| 394 | Ga0495668_0050068 | 3300046616 | Bacteria | 2315 |
| 395 | Ga0495668_0089260 | 3300046616 | Bacteria | 1689 |
| 396 | Ga0495668_0218136 | 3300046616 | Bacteria | 1044 |
| 397 | Ga0495611_0000960 | 3300046648 | Bacteria | 15368 |
| 398 | Ga0495611_0005964 | 3300046648 | Bacteria | 5196 |
| 399 | Ga0495611_0061906 | 3300046648 | Bacteria | 1701 |
| 400 | Ga0495611_0213440 | 3300046648 | Bacteria | 898 |
| 401 | Ga0495625_0005815 | 3300046660 | Bacteria | 11129 |
| 402 | Ga0495625_0041053 | 3300046660 | Bacteria | 3369 |
| 403 | Ga0495661_0000069 | 3300046665 | Bacteria | 125790 |
| 404 | Ga0495661_0000082 | 3300046665 | Bacteria | 116600 |
| 405 | Ga0495661_0005217 | 3300046665 | Bacteria | 9246 |
| 406 | Ga0495661_0009005 | 3300046665 | Bacteria | 6868 |
| 407 | Ga0495661_0021506 | 3300046665 | Bacteria | 4205 |
| 408 | Ga0495661_0050020 | 3300046665 | Bacteria | 2532 |
| 409 | Ga0495661_0060506 | 3300046665 | Bacteria | 2249 |
| 410 | Ga0495661_0135992 | 3300046665 | Bacteria | 1341 |
| 411 | Ga0495588_0000041 | 3300046674 | Bacteria | 377896 |
| 412 | Ga0495588_0111712 | 3300046674 | Bacteria | 1439 |
| 413 | Ga0495669_0013262 | 3300046684 | Bacteria | 3510 |
| 414 | Ga0495669_0025414 | 3300046684 | Bacteria | 2583 |
| 415 | Ga0495669_0090576 | 3300046684 | Bacteria | 1411 |
| 416 | Ga0495670_0002666 | 3300046691 | Bacteria | 8807 |
| 417 | Ga0495670_0060581 | 3300046691 | Bacteria | 1902 |
| 418 | Ga0495671_0008192 | 3300046692 | Bacteria | 5895 |
| 419 | Ga0495649_0000537 | 3300046694 | Bacteria | 32173 |
| 420 | Ga0495649_0001788 | 3300046694 | Bacteria | 15827 |
| 421 | Ga0495649_0020176 | 3300046694 | Bacteria | 3739 |
| 422 | Ga0495589_0000061 | 3300046794 | Bacteria | 104649 |
| 423 | Ga0495589_0000072 | 3300046794 | Bacteria | 95649 |
| 424 | Ga0495589_0014127 | 3300046794 | Bacteria | 4116 |
| 425 | Ga0495589_0030024 | 3300046794 | Bacteria | 2739 |
| 426 | Ga0495589_0046286 | 3300046794 | Bacteria | 2159 |
| 427 | Ga0495660_0000243 | 3300046810 | Bacteria | 53378 |
| 428 | Ga0495660_0008501 | 3300046810 | Bacteria | 6010 |
| 429 | Ga0495660_0018048 | 3300046810 | Bacteria | 4057 |
| 430 | Ga0495660_0074213 | 3300046810 | Bacteria | 1797 |
| 431 | Ga0495604_0031391 | 3300047317 | Bacteria | 4213 |
| 432 | Ga0495604_0154424 | 3300047317 | Bacteria | 1627 |
| 433 | Ga0495636_0000011 | 3300047318 | Bacteria | 87862 |
| 434 | Ga0495636_0003018 | 3300047318 | Bacteria | 6522 |
| 435 | Ga0495672_0000258 | 3300047320 | Bacteria | 73971 |
| 436 | Ga0495672_0010604 | 3300047320 | Bacteria | 6549 |
| 437 | Ga0495672_0020962 | 3300047320 | Bacteria | 4270 |
| 438 | Ga0495676_0039316 | 3300047321 | Bacteria | 3919 |
| 439 | Ga0495680_0003891 | 3300047322 | Bacteria | 14448 |
| 440 | Ga0495683_0000009 | 3300047323 | Bacteria | 241385 |
| 441 | Ga0495683_0000446 | 3300047323 | Bacteria | 32629 |
| 442 | Ga0495683_0015742 | 3300047323 | Bacteria | 3927 |
| 443 | Ga0495687_000027 | 3300047443 | Bacteria | 299689 |
| 444 | Ga0495687_000630 | 3300047443 | Bacteria | 40345 |
| 445 | Ga0495687_001824 | 3300047443 | Bacteria | 18729 |
| 446 | Ga0495687_002017 | 3300047443 | Bacteria | 17187 |
| 447 | Ga0495675_0030627 | 3300047444 | Bacteria | 3432 |
| 448 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 449 | Ga0495677_0000195 | 3300047445 | Bacteria | 27965 |
| 450 | Ga0495677_0001118 | 3300047445 | Bacteria | 10729 |
| 451 | Ga0495677_0001701 | 3300047445 | Bacteria | 8838 |
| 452 | Ga0495677_0006543 | 3300047445 | Bacteria | 4401 |
| 453 | Ga0495679_001482 | 3300047446 | Bacteria | 13271 |
| 454 | Ga0495679_016971 | 3300047446 | Bacteria | 2617 |
| 455 | Ga0495685_036381 | 3300047447 | Bacteria | 1690 |
| 456 | Ga0495681_0000428 | 3300047470 | Bacteria | 32244 |
| 457 | Ga0495681_0015193 | 3300047470 | Bacteria | 4366 |
| 458 | Ga0495681_0024964 | 3300047470 | Bacteria | 3134 |
| 459 | Ga0495686_0000146 | 3300047472 | Bacteria | 141435 |
| 460 | Ga0495686_0000373 | 3300047472 | Bacteria | 71977 |
| 461 | Ga0495686_0001101 | 3300047472 | Bacteria | 32108 |
| 462 | Ga0495686_0006503 | 3300047472 | Bacteria | 8925 |
| 463 | Ga0495686_0047236 | 3300047472 | Bacteria | 2719 |
| 464 | Ga0495593_0213731 | 3300047673 | Bacteria | 968 |
| 465 | Ga0495614_0010053 | 3300048089 | Bacteria | 4177 |
| 466 | Ga0495626_0000027 | 3300048091 | Bacteria | 206022 |
| 467 | Ga0495626_0000135 | 3300048091 | Bacteria | 93280 |
| 468 | Ga0495626_0000193 | 3300048091 | Bacteria | 73924 |
| 469 | Ga0495626_0039499 | 3300048091 | Bacteria | 2233 |
| 470 | Ga0495626_0067380 | 3300048091 | Bacteria | 1616 |
| 471 | Ga0496101_0066030 | 3300048904 | Bacteria | 2638 |
| 472 | Ga0496102_0000058 | 3300048905 | Bacteria | 168714 |
| 473 | Ga0496104_0443251 | 3300048907 | Bacteria | 1210 |
| 474 | Ga0496106_0297027 | 3300048909 | Bacteria | 1295 |
| 475 | Ga0496107_0170968 | 3300048910 | Bacteria | 1613 |
| 476 | Ga0496108_0955706 | 3300048911 | Bacteria | 733 |
| 477 | Ga0496109_0347154 | 3300048912 | Bacteria | 1402 |
| 478 | Ga0496110_0000251 | 3300048913 | Bacteria | 34859 |
| 479 | Ga0496110_0009047 | 3300048913 | Bacteria | 8037 |
| 480 | Ga0496110_0021952 | 3300048913 | Bacteria | 5414 |
| 481 | Ga0496112_0240363 | 3300048915 | Bacteria | 1764 |
| 482 | Ga0496113_0002669 | 3300048916 | Bacteria | 10454 |
| 483 | Ga0496113_0405827 | 3300048916 | Bacteria | 1094 |
| 484 | Ga0496115_0112393 | 3300048918 | Bacteria | 2238 |
| 485 | Ga0496116_0003966 | 3300048919 | Bacteria | 14370 |
| 486 | Ga0496121_0161506 | 3300048924 | Bacteria | 1638 |
| 487 | Ga0496122_0000255 | 3300048925 | Bacteria | 120384 |
| 488 | Ga0496122_0002056 | 3300048925 | Bacteria | 29860 |
| 489 | Ga0496122_0007048 | 3300048925 | Bacteria | 12637 |
| 490 | Ga0496122_0022678 | 3300048925 | Bacteria | 5572 |
| 491 | Ga0496123_0000138 | 3300048926 | Bacteria | 151844 |
| 492 | Ga0496123_0001705 | 3300048926 | Bacteria | 29367 |
| 493 | Ga0496123_0004467 | 3300048926 | Bacteria | 14671 |
| 494 | Ga0496124_0013112 | 3300048927 | Bacteria | 8115 |
| 495 | Ga0496124_0180220 | 3300048927 | Bacteria | 1626 |
| 496 | Ga0496125_0002290 | 3300048928 | Bacteria | 25316 |
| 497 | Ga0496125_0002620 | 3300048928 | Bacteria | 23073 |
| 498 | Ga0501308_001455 | 3300049128 | Bacteria | 1897 |
| 499 | Ga0495678_000110 | 3300049459 | Bacteria | 97228 |
| 500 | Ga0495678_022198 | 3300049459 | Bacteria | 2779 |
| 501 | Ga0495682_0007385 | 3300049460 | Bacteria | 4379 |
| 502 | Ga0495682_0020557 | 3300049460 | Bacteria | 2477 |
| 503 | Ga0501298_004446 | 3300049521 | Bacteria | 2210 |
| 504 | Ga0501034_0023415 | 3300049571 | Bacteria | 6293 |
| 505 | Ga0501034_0170353 | 3300049571 | Bacteria | 2145 |
| 506 | Ga0501034_0212020 | 3300049571 | Bacteria | 1892 |
| 507 | Ga0501038_0149218 | 3300049574 | Bacteria | 1907 |
| 508 | Ga0501039_0456830 | 3300049575 | Bacteria | 1003 |
| 509 | Ga0501043_0113283 | 3300049579 | Bacteria | 2130 |
| 510 | Ga0501067_0026472 | 3300049583 | Bacteria | 3212 |
| 511 | Ga0501069_0048089 | 3300049585 | Bacteria | 2368 |
| 512 | Ga0501070_0376927 | 3300049586 | Bacteria | 1149 |
| 513 | Ga0501072_0181283 | 3300049588 | Bacteria | 1680 |
| 514 | Ga0501073_0162407 | 3300049589 | Bacteria | 1547 |
| 515 | Ga0501201_000140 | 3300049651 | Bacteria | 6066 |
| 516 | Ga0501207_011209 | 3300049654 | Bacteria | 1332 |
| 517 | Ga0501217_017854 | 3300049661 | Bacteria | 1640 |
| 518 | Ga0501222_004316 | 3300049662 | Bacteria | 1930 |
| 519 | Ga0501223_001744 | 3300049663 | Bacteria | 4945 |
| 520 | Ga0501233_014174 | 3300049668 | Bacteria | 1626 |
| 521 | Ga0501235_001675 | 3300049669 | Bacteria | 4752 |
| 522 | Ga0501242_002559 | 3300049674 | Bacteria | 1918 |
| 523 | Ga0501243_001273 | 3300049675 | Bacteria | 3595 |
| 524 | Ga0501251_017977 | 3300049681 | Bacteria | 913 |
| 525 | Ga0501257_003118 | 3300049686 | Bacteria | 3530 |
| 526 | Ga0501257_004374 | 3300049686 | Bacteria | 3083 |
| 527 | Ga0501259_004374 | 3300049688 | Bacteria | 2250 |
| 528 | Ga0501234_011897 | 3300049707 | Bacteria | 1362 |
| 529 | Ga0501245_004933 | 3300049708 | Bacteria | 1842 |
| 530 | Ga0501080_0223463 | 3300049742 | Bacteria | 1722 |
| 531 | Ga0501083_0015230 | 3300049744 | Bacteria | 5383 |
| 532 | Ga0501232_001451 | 3300049757 | Bacteria | 1895 |
| 533 | Ga0501266_001738 | 3300049763 | Bacteria | 2759 |
| 534 | Ga0501035_0003078 | 3300049822 | Bacteria | 16010 |
| 535 | Ga0501035_0159292 | 3300049822 | Bacteria | 1955 |
| 536 | Ga0501035_0521741 | 3300049822 | Bacteria | 976 |
| 537 | nmdc:mga0k408_92153_c1 | 3300050493 | Bacteria | 1781 |
| 538 | Ga0500644_0063132 | 3300053088 | Bacteria | 1311 |
| 539 | Ga0500641_0025562 | 3300053096 | Bacteria | 2285 |
| 540 | Ga0500562_000077 | 3300053108 | Bacteria | 45189 |
| 541 | Ga0500568_0006155 | 3300053139 | Bacteria | 6069 |
| 542 | Ga0500622_0003322 | 3300053156 | Bacteria | 10864 |
| 543 | Ga0500645_022740 | 3300053730 | Bacteria | 1925 |
| 544 | Ga0501084_0029727 | 3300054114 | Bacteria | 4571 |
| 545 | Ga0587077_025297 | 3300059493 | Bacteria | 1088 |
| 546 | Ga0587083_0020468 | 3300059505 | Bacteria | 1219 |
| 547 | Ga0587068_008424 | 3300059641 | Bacteria | 1494 |
| 548 | 2550693359 | 2548876994 | Bacteria | 4904866 |
| 549 | 2643798997 | 2643221556 | Bacteria | 7251154 |
| 550 | 2644473672 | 2643221684 | Bacteria | 7145183 |
| 551 | 2819590723 | 2818991444 | Bacteria | 6968812 |
| 552 | 2819594937 | 2818991445 | Bacteria | 4955017 |
| 553 | 2884812324 | 2884811622 | Bacteria | 5552861 |
| 554 | 2884836688 | 2884836552 | Bacteria | 5219991 |
| 555 | 2884852980 | 2884852848 | Bacteria | 5221161 |
| 556 | 2896155903 | 2896154374 | Bacteria | 5221518 |
| 557 | 2929157742 | 2929154850 | Bacteria | 6753285 |
| 558 | 3006975565 | 3006973921 | Bacteria | 4423788 |
| 559 | 8047679403 | 8047673197 | Bacteria | 7395230 |
| 560 | Ga0495668_0002833 | |||
| 561 | SwRhRL2b_contig_3160980 | |||
| 562 | JGI24740J21852_10019370 | |||
| 563 | JGI25156J39149_1001190 | |||
| 564 | JGI25162J39368_1004954 | |||
| 565 | JGI25154J39366_1000986 | |||
| 566 | JGI25157J39369_1001849 | |||
| 567 | JGI25406J46586_10012099 | |||
| 568 | rootH2_10013019 | |||
| 569 | rootL2_10241602 | |||
| 570 | JGI25160J50197_1000425 | |||
| 571 | Ga0055532_1000077 | |||
| 572 | Ga0055525_1000008 | |||
| 573 | Ga0055542_1012403 | |||
| 574 | Ga0065704_10072654 | |||
| 575 | Ga0070658_10025472 | |||
| 576 | Ga0070658_10028978 | |||
| 577 | Ga0070658_10196661 | |||
| 578 | Ga0070676_10120820 | |||
| 579 | Ga0070683_100007781 | |||
| 580 | Ga0070683_100522899 | |||
| 581 | Ga0070670_100050548 | |||
| 582 | Ga0070670_100210256 | |||
| 583 | Ga0068869_100010056 | |||
| 584 | Ga0068869_100017750 | |||
| 585 | Ga0070666_10000736 | |||
| 586 | Ga0070666_10089513 | |||
| 587 | Ga0070680_100000088 | |||
| 588 | Ga0070680_100038613 | |||
| 589 | Ga0068868_100025378 | |||
| 590 | Ga0068868_100045260 | |||
| 591 | Ga0068868_100224499 | |||
| 592 | Ga0070660_100042601 | |||
| 593 | Ga0070660_100058718 | |||
| 594 | Ga0070660_100080999 | |||
| 595 | Ga0070660_100105690 | |||
| 596 | Ga0070660_100132997 | |||
| 597 | Ga0070660_100260270 | |||
| 598 | Ga0070689_100026131 | |||
| 599 | Ga0070661_100017437 | |||
| 600 | Ga0070668_100036467 | |||
| 601 | Ga0070668_100189194 | |||
| 602 | Ga0070669_100147955 | |||
| 603 | Ga0070675_100038520 | |||
| 604 | Ga0070671_100014761 | |||
| 605 | Ga0070671_100110999 | |||
| 606 | Ga0070674_100121079 | |||
| 607 | Ga0070673_100023997 | |||
| 608 | Ga0070673_100536616 | |||
| 609 | Ga0070688_100008462 | |||
| 610 | Ga0070659_100010190 | |||
| 611 | Ga0070659_100043243 | |||
| 612 | Ga0070659_100078813 | |||
| 613 | Ga0070659_100082890 | |||
| 614 | Ga0070663_100375911 | |||
| 615 | Ga0070678_100013458 | |||
| 616 | Ga0070678_100131890 | |||
| 617 | Ga0070662_100151157 | |||
| 618 | Ga0068867_100008426 | |||
| 619 | Ga0070679_100000003 | |||
| 620 | Ga0070679_100075145 | |||
| 621 | Ga0070679_100347760 | |||
| 622 | Ga0070672_100027937 | |||
| 623 | Ga0070665_100043589 | |||
| 624 | Ga0068855_100045035 | |||
| 625 | Ga0068855_100079309 | |||
| 626 | Ga0068855_100737942 | |||
| 627 | Ga0070664_100024674 | |||
| 628 | Ga0070664_100048325 | |||
| 629 | Ga0070664_100094830 | |||
| 630 | Ga0070664_100273688 | |||
| 631 | Ga0068857_100046969 | |||
| 632 | Ga0068857_100075562 | |||
| 633 | Ga0068854_100094454 | |||
| 634 | Ga0068859_100000037 | |||
| 635 | Ga0068859_100005033 | |||
| 636 | Ga0068859_100154534 | |||
| 637 | Ga0068859_100167475 | |||
| 638 | Ga0068859_100338016 | |||
| 639 | Ga0068864_100009579 | |||
| 640 | Ga0068864_100053693 | |||
| 641 | Ga0068864_100055678 | |||
| 642 | Ga0068864_100303277 | |||
| 643 | Ga0068866_10024844 | |||
| 644 | Ga0068861_100044059 | |||
| 645 | Ga0068851_10008075 | |||
| 646 | Ga0068851_10010366 | |||
| 647 | Ga0068851_10117872 | |||
| 648 | Ga0068870_10012327 | |||
| 649 | Ga0068863_100032377 | |||
| 650 | Ga0068858_100002312 | |||
| 651 | Ga0068858_100841454 | |||
| 652 | Ga0068860_100003825 | |||
| 653 | Ga0068860_100026415 | |||
| 654 | Ga0068860_100030783 | |||
| 655 | Ga0081539_10000531 | |||
| 656 | Ga0075366_10107926 | |||
| 657 | Ga0097621_100032447 | |||
| 658 | Ga0097621_100068063 | |||
| 659 | Ga0068871_100083751 | |||
| 660 | Ga0097620_100000037 | |||
| 661 | Ga0097620_100005033 | |||
| 662 | Ga0097620_100154525 | |||
| 663 | Ga0097620_100167474 | |||
| 664 | Ga0097620_100338022 | |||
| 665 | Ga0105240_10051294 | |||
| 666 | Ga0105245_10057483 | |||
| 667 | Ga0105245_10181275 | |||
| 668 | Ga0105245_10386836 | |||
| 669 | Ga0105247_10045640 | |||
| 670 | Ga0105241_10001242 | |||
| 671 | Ga0105241_10063295 | |||
| 672 | Ga0105241_10119939 | |||
| 673 | Ga0105242_10031141 | |||
| 674 | Ga0105242_10119104 | |||
| 675 | Ga0105237_10011912 | |||
| 676 | Ga0105237_10019373 | |||
| 677 | Ga0105238_10054006 | |||
| 678 | Ga0105239_10050855 | |||
| 679 | Ga0105246_10059113 | |||
| 680 | Ga0157373_10049310 | |||
| 681 | Ga0157371_10003328 | |||
| 682 | Ga0157370_10058627 | |||
| 683 | Ga0157370_10163019 | |||
| 684 | Ga0157370_10486663 | |||
| 685 | Ga0157369_10040311 | |||
| 686 | Ga0157369_10109403 | |||
| 687 | Ga0157374_10000500 | |||
| 688 | Ga0157374_10065573 | |||
| 689 | Ga0157374_10148425 | |||
| 690 | Ga0157374_10583976 | |||
| 691 | Ga0157378_10036726 | |||
| 692 | Ga0157378_10057003 | |||
| 693 | Ga0157378_10057524 | |||
| 694 | Ga0157378_10059615 | |||
| 695 | Ga0157378_10123678 | |||
| 696 | Ga0157378_10140088 | |||
| 697 | Ga0163162_10004768 | |||
| 698 | Ga0163162_10319034 | |||
| 699 | Ga0157372_10089689 | |||
| 700 | Ga0157372_10201163 | |||
| 701 | Ga0157372_10352456 | |||
| 702 | Ga0157372_10390004 | |||
| 703 | Ga0157372_10432922 | |||
| 704 | Ga0157375_10091600 | |||
| 705 | Ga0157375_10149311 | |||
| 706 | Ga0157375_10455800 | |||
| 707 | Ga0163163_10001732 | |||
| 708 | Ga0163163_10018090 | |||
| 709 | Ga0157380_10022365 | |||
| 710 | Ga0182008_10071418 | |||
| 711 | Ga0157377_10013348 | |||
| 712 | Ga0157379_10058571 | |||
| 713 | Ga0157376_10032889 | |||
| 714 | Ga0209435_100082 | |||
| 715 | Ga0209147_100122 | |||
| 716 | Ga0209563_100003 | |||
| 717 | Ga0209437_100081 | |||
| 718 | Ga0209258_100739 | |||
| 719 | Ga0209646_1000152 | |||
| 720 | Ga0209026_1000126 | |||
| 721 | Ga0209677_102681 | |||
| 722 | Ga0209148_1000576 | |||
| 723 | Ga0209759_1000193 | |||
| 724 | Ga0207426_1000032 | |||
| 725 | Ga0207656_10007990 | |||
| 726 | Ga0207656_10139487 | |||
| 727 | Ga0207682_10029991 | |||
| 728 | Ga0207682_10039977 | |||
| 729 | Ga0207642_10012030 | |||
| 730 | Ga0207710_10166457 | |||
| 731 | Ga0207688_10050439 | |||
| 732 | Ga0207680_10002758 | |||
| 733 | Ga0207680_10024859 | |||
| 734 | Ga0207645_10008175 | |||
| 735 | Ga0207645_10113229 | |||
| 736 | Ga0207643_10061389 | |||
| 737 | Ga0207705_10094360 | |||
| 738 | Ga0207654_10001781 | |||
| 739 | Ga0207654_10009833 | |||
| 740 | Ga0207654_10364325 | |||
| 741 | Ga0207671_10001737 | |||
| 742 | Ga0207660_10000231 | |||
| 743 | Ga0207660_10144387 | |||
| 744 | Ga0207660_10388337 | |||
| 745 | Ga0207657_10005484 | |||
| 746 | Ga0207657_10071592 | |||
| 747 | Ga0207657_10085037 | |||
| 748 | Ga0207657_10115329 | |||
| 749 | Ga0207657_10539017 | |||
| 750 | Ga0207649_10010790 | |||
| 751 | Ga0207652_10000004 | |||
| 752 | Ga0207652_10000101 | |||
| 753 | Ga0207652_10160509 | |||
| 754 | Ga0207694_10126826 | |||
| 755 | Ga0207659_10029066 | |||
| 756 | Ga0207659_10077383 | |||
| 757 | Ga0207687_10047815 | |||
| 758 | Ga0207644_10123410 | |||
| 759 | Ga0207690_10008026 | |||
| 760 | Ga0207690_10025312 | |||
| 761 | Ga0207690_10085253 | |||
| 762 | Ga0207690_10385863 | |||
| 763 | Ga0207686_10083724 | |||
| 764 | Ga0207670_10045864 | |||
| 765 | Ga0207669_10056730 | |||
| 766 | Ga0207704_10062769 | |||
| 767 | Ga0207691_10033299 | |||
| 768 | Ga0207691_10050300 | |||
| 769 | Ga0207691_10075103 | |||
| 770 | Ga0207691_10092613 | |||
| 771 | Ga0207689_10002113 | |||
| 772 | Ga0207689_10004902 | |||
| 773 | Ga0207689_10016695 | |||
| 774 | Ga0207689_10146936 | |||
| 775 | Ga0207661_10210677 | |||
| 776 | Ga0207679_10012499 | |||
| 777 | Ga0207667_10050356 | |||
| 778 | Ga0207651_10030376 | |||
| 779 | Ga0207651_10112157 | |||
| 780 | Ga0207712_10040602 | |||
| 781 | Ga0207668_10130196 | |||
| 782 | Ga0207677_10038689 | |||
| 783 | Ga0207677_10048022 | |||
| 784 | Ga0207677_10053515 | |||
| 785 | Ga0207677_10233828 | |||
| 786 | Ga0207703_10000878 | |||
| 787 | Ga0207678_10319081 | |||
| 788 | Ga0207641_10000121 | |||
| 789 | Ga0207648_10007071 | |||
| 790 | Ga0207648_10008275 | |||
| 791 | Ga0207676_10027669 | |||
| 792 | Ga0207676_10179411 | |||
| 793 | Ga0207674_10010770 | |||
| 794 | Ga0207674_10061307 | |||
| 795 | Ga0207675_100072985 | |||
| 796 | Ga0207675_100134258 | |||
| 797 | Ga0207675_100182952 | |||
| 798 | Ga0207675_100632143 | |||
| 799 | Ga0207683_10003508 | |||
| 800 | Ga0207683_10010782 | |||
| 801 | Ga0207683_10024062 | |||
| 802 | Ga0207683_10325089 | |||
| 803 | Ga0207698_10006261 | |||
| 804 | Ga0209281_1000056 | |||
| 805 | Ga0268265_10361576 | |||
| 806 | Ga0268264_10002971 | |||
| 807 | Ga0268264_10020319 | |||
| 808 | Ga0316180_1157605 | |||
| 809 | Ga0316182_1221789 | |||
| 810 | Ga0265327_10000432 | |||
| 811 | Ga0307508_10001325 | |||
| 812 | Ga0307413_10428649 | |||
| 813 | Ga0307406_10309760 | |||
| 814 | Ga0316574_0083314 | |||
| 815 | Ga0316574_0130205 | |||
| 816 | Ga0395899_0002720 | |||
| 817 | Ga0395899_0023907 | |||
| 818 | Ga0395900_0000028 | |||
| 819 | Ga0395900_0002348 | |||
| 820 | Ga0395900_0004043 | |||
| 821 | Ga0395900_0128905 | |||
| 822 | Ga0395900_0205762 | |||
| 823 | Ga0395900_0741019 | |||
| 824 | Ga0395898_0002043 | |||
| 825 | Ga0395898_0259732 | |||
| 826 | Ga0395901_0000025 | |||
| 827 | Ga0395901_0019500 | |||
| 828 | Ga0395901_0054633 | |||
| 829 | Ga0395901_0477792 | |||
| 830 | Ga0395901_0687442 | |||
| 831 | Ga0439445_0051958 | |||
| 832 | Ga0439448_0006129 | |||
| 833 | Ga0439449_0015862 | |||
| 834 | Ga0439446_0035090 | |||
| 835 | Ga0466969_0008401 | |||
| 836 | Ga0466972_0000003 | |||
| 837 | Ga0466972_0000801 | |||
| 838 | Ga0466972_0119060 | |||
| 839 | Ga0466965_0006443 | |||
| 840 | Ga0466965_0025139 | |||
| 841 | Ga0466965_0108388 | |||
| 842 | Ga0466966_0087316 | |||
| 843 | Ga0466966_0125173 | |||
| 844 | Ga0466966_0143467 | |||
| 845 | Ga0466961_0156681 | |||
| 846 | Ga0466964_0000574 | |||
| 847 | Ga0466964_0048969 | |||
| 848 | Ga0453684_0078879 | |||
| 849 | Ga0466971_0079794 | |||
| 850 | Ga0466968_0064983 | |||
| 851 | Ga0466968_0090999 | |||
| 852 | Ga0466970_0000607 | |||
| 853 | Ga0466970_0143170 | |||
| 854 | Ga0466957_0007434 | |||
| 855 | Ga0466957_0033924 | |||
| 856 | Ga0466959_0051074 | |||
| 857 | Ga0466967_0093427 | |||
| 858 | Ga0495627_001465 | |||
| 859 | Ga0495603_0117361 | |||
| 860 | Ga0495590_0001273 | |||
| 861 | Ga0495591_000236 | |||
| 862 | Ga0495638_0082435 | |||
| 863 | Ga0495653_0170872 | |||
| 864 | Ga0495580_0070292 | |||
| 865 | Ga0495582_0013683 | |||
| 866 | Ga0495605_0000177 | |||
| 867 | Ga0495605_0001739 | |||
| 868 | Ga0495605_0006538 | |||
| 869 | Ga0495605_0013984 | |||
| 870 | Ga0495639_0227324 | |||
| 871 | Ga0495584_0000001 | |||
| 872 | Ga0495584_0000366 | |||
| 873 | Ga0495584_0000452 | |||
| 874 | Ga0495584_0001551 | |||
| 875 | Ga0495584_0004007 | |||
| 876 | Ga0495584_0008288 | |||
| 877 | Ga0495584_0011200 | |||
| 878 | Ga0495584_0011673 | |||
| 879 | Ga0495585_0000600 | |||
| 880 | Ga0495585_0000697 | |||
| 881 | Ga0495585_0001480 | |||
| 882 | Ga0495585_0006526 | |||
| 883 | Ga0495585_0006714 | |||
| 884 | Ga0495585_0017738 | |||
| 885 | Ga0495585_0028730 | |||
| 886 | Ga0495585_0042463 | |||
| 887 | Ga0495585_0053236 | |||
| 888 | Ga0495594_0023866 | |||
| 889 | Ga0495594_0245791 | |||
| 890 | Ga0495596_0000615 | |||
| 891 | Ga0495596_0000821 | |||
| 892 | Ga0495596_0006977 | |||
| 893 | Ga0495596_0008987 | |||
| 894 | Ga0495596_0010760 | |||
| 895 | Ga0495596_0018122 | |||
| 896 | Ga0495596_0029061 | |||
| 897 | Ga0495607_0001696 | |||
| 898 | Ga0495607_0002247 | |||
| 899 | Ga0495607_0011028 | |||
| 900 | Ga0495607_0029059 | |||
| 901 | Ga0495607_0102545 | |||
| 902 | Ga0495583_0000506 | |||
| 903 | Ga0495606_0004705 | |||
| 904 | Ga0495606_0015233 | |||
| 905 | Ga0495606_0089815 | |||
| 906 | Ga0495606_0135404 | |||
| 907 | Ga0495610_0010358 | |||
| 908 | Ga0495616_0000386 | |||
| 909 | Ga0495616_0001634 | |||
| 910 | Ga0495616_0003927 | |||
| 911 | Ga0495616_0008600 | |||
| 912 | Ga0495616_0106653 | |||
| 913 | Ga0495631_0006918 | |||
| 914 | Ga0495631_0033138 | |||
| 915 | Ga0495632_0000156 | |||
| 916 | Ga0495632_0000537 | |||
| 917 | Ga0495632_0011507 | |||
| 918 | Ga0495632_0035337 | |||
| 919 | Ga0495643_0002305 | |||
| 920 | Ga0495643_0003688 | |||
| 921 | Ga0495643_0008036 | |||
| 922 | Ga0495643_0028675 | |||
| 923 | Ga0495643_0031913 | |||
| 924 | Ga0495644_0010708 | |||
| 925 | Ga0495644_0019643 | |||
| 926 | Ga0495644_0053416 | |||
| 927 | Ga0495644_0064157 | |||
| 928 | Ga0495648_0023546 | |||
| 929 | Ga0495666_0002495 | |||
| 930 | Ga0495666_0063882 | |||
| 931 | Ga0495642_0000053 | |||
| 932 | Ga0495642_0000433 | |||
| 933 | Ga0495642_0002723 | |||
| 934 | Ga0495665_0001008 | |||
| 935 | Ga0495586_0069245 | |||
| 936 | Ga0495609_0000001 | |||
| 937 | Ga0495609_0008646 | |||
| 938 | Ga0495609_0020636 | |||
| 939 | Ga0495609_0026206 | |||
| 940 | Ga0495597_0000488 | |||
| 941 | Ga0495597_0002178 | |||
| 942 | Ga0495597_0002942 | |||
| 943 | Ga0495622_0113871 | |||
| 944 | Ga0495633_0002380 | |||
| 945 | Ga0495633_0027256 | |||
| 946 | Ga0495633_0051966 | |||
| 947 | Ga0495656_0017719 | |||
| 948 | Ga0495656_0030285 | |||
| 949 | Ga0495656_0105218 | |||
| 950 | Ga0495668_0006442 | |||
| 951 | Ga0495668_0006681 | |||
| 952 | Ga0495668_0024499 | |||
| 953 | Ga0495668_0050068 | |||
| 954 | Ga0495668_0089260 | |||
| 955 | Ga0495668_0218136 | |||
| 956 | Ga0495611_0000960 | |||
| 957 | Ga0495611_0005964 | |||
| 958 | Ga0495611_0061906 | |||
| 959 | Ga0495611_0213440 | |||
| 960 | Ga0495625_0005815 | |||
| 961 | Ga0495625_0041053 | |||
| 962 | Ga0495661_0000069 | |||
| 963 | Ga0495661_0000082 | |||
| 964 | Ga0495661_0005217 | |||
| 965 | Ga0495661_0009005 | |||
| 966 | Ga0495661_0021506 | |||
| 967 | Ga0495661_0050020 | |||
| 968 | Ga0495661_0060506 | |||
| 969 | Ga0495661_0135992 | |||
| 970 | Ga0495588_0000041 | |||
| 971 | Ga0495588_0111712 | |||
| 972 | Ga0495669_0013262 | |||
| 973 | Ga0495669_0025414 | |||
| 974 | Ga0495669_0090576 | |||
| 975 | Ga0495670_0002666 | |||
| 976 | Ga0495670_0060581 | |||
| 977 | Ga0495671_0008192 | |||
| 978 | Ga0495649_0000537 | |||
| 979 | Ga0495649_0001788 | |||
| 980 | Ga0495649_0020176 | |||
| 981 | Ga0495589_0000061 | |||
| 982 | Ga0495589_0000072 | |||
| 983 | Ga0495589_0014127 | |||
| 984 | Ga0495589_0030024 | |||
| 985 | Ga0495589_0046286 | |||
| 986 | Ga0495660_0000243 | |||
| 987 | Ga0495660_0008501 | |||
| 988 | Ga0495660_0018048 | |||
| 989 | Ga0495660_0074213 | |||
| 990 | Ga0495604_0031391 | |||
| 991 | Ga0495604_0154424 | |||
| 992 | Ga0495636_0000011 | |||
| 993 | Ga0495636_0003018 | |||
| 994 | Ga0495672_0000258 | |||
| 995 | Ga0495672_0010604 | |||
| 996 | Ga0495672_0020962 | |||
| 997 | Ga0495676_0039316 | |||
| 998 | Ga0495680_0003891 | |||
| 999 | Ga0495683_0000009 | |||
| 1000 | Ga0495683_0000446 | |||
| 1001 | Ga0495683_0015742 | |||
| 1002 | Ga0495687_000027 | |||
| 1003 | Ga0495687_000630 | |||
| 1004 | Ga0495687_001824 | |||
| 1005 | Ga0495687_002017 | |||
| 1006 | Ga0495675_0030627 | |||
| 1007 | Ga0495677_0000001 | |||
| 1008 | Ga0495677_0000195 | |||
| 1009 | Ga0495677_0001118 | |||
| 1010 | Ga0495677_0001701 | |||
| 1011 | Ga0495677_0006543 | |||
| 1012 | Ga0495679_001482 | |||
| 1013 | Ga0495679_016971 | |||
| 1014 | Ga0495685_036381 | |||
| 1015 | Ga0495681_0000428 | |||
| 1016 | Ga0495681_0015193 | |||
| 1017 | Ga0495681_0024964 | |||
| 1018 | Ga0495686_0000146 | |||
| 1019 | Ga0495686_0000373 | |||
| 1020 | Ga0495686_0001101 | |||
| 1021 | Ga0495686_0006503 | |||
| 1022 | Ga0495686_0047236 | |||
| 1023 | Ga0495593_0213731 | |||
| 1024 | Ga0495614_0010053 | |||
| 1025 | Ga0495626_0000027 | |||
| 1026 | Ga0495626_0000135 | |||
| 1027 | Ga0495626_0000193 | |||
| 1028 | Ga0495626_0039499 | |||
| 1029 | Ga0495626_0067380 | |||
| 1030 | Ga0496101_0066030 | |||
| 1031 | Ga0496102_0000058 | |||
| 1032 | Ga0496104_0443251 | |||
| 1033 | Ga0496106_0297027 | |||
| 1034 | Ga0496107_0170968 | |||
| 1035 | Ga0496108_0955706 | |||
| 1036 | Ga0496109_0347154 | |||
| 1037 | Ga0496110_0000251 | |||
| 1038 | Ga0496110_0009047 | |||
| 1039 | Ga0496110_0021952 | |||
| 1040 | Ga0496112_0240363 | |||
| 1041 | Ga0496113_0002669 | |||
| 1042 | Ga0496113_0405827 | |||
| 1043 | Ga0496115_0112393 | |||
| 1044 | Ga0496116_0003966 | |||
| 1045 | Ga0496121_0161506 | |||
| 1046 | Ga0496122_0000255 | |||
| 1047 | Ga0496122_0002056 | |||
| 1048 | Ga0496122_0007048 | |||
| 1049 | Ga0496122_0022678 | |||
| 1050 | Ga0496123_0000138 | |||
| 1051 | Ga0496123_0001705 | |||
| 1052 | Ga0496123_0004467 | |||
| 1053 | Ga0496124_0013112 | |||
| 1054 | Ga0496124_0180220 | |||
| 1055 | Ga0496125_0002290 | |||
| 1056 | Ga0496125_0002620 | |||
| 1057 | Ga0501308_001455 | |||
| 1058 | Ga0495678_000110 | |||
| 1059 | Ga0495678_022198 | |||
| 1060 | Ga0495682_0007385 | |||
| 1061 | Ga0495682_0020557 | |||
| 1062 | Ga0501298_004446 | |||
| 1063 | Ga0501034_0023415 | |||
| 1064 | Ga0501034_0170353 | |||
| 1065 | Ga0501034_0212020 | |||
| 1066 | Ga0501038_0149218 | |||
| 1067 | Ga0501039_0456830 | |||
| 1068 | Ga0501043_0113283 | |||
| 1069 | Ga0501067_0026472 | |||
| 1070 | Ga0501069_0048089 | |||
| 1071 | Ga0501070_0376927 | |||
| 1072 | Ga0501072_0181283 | |||
| 1073 | Ga0501073_0162407 | |||
| 1074 | Ga0501201_000140 | |||
| 1075 | Ga0501207_011209 | |||
| 1076 | Ga0501217_017854 | |||
| 1077 | Ga0501222_004316 | |||
| 1078 | Ga0501223_001744 | |||
| 1079 | Ga0501233_014174 | |||
| 1080 | Ga0501235_001675 | |||
| 1081 | Ga0501242_002559 | |||
| 1082 | Ga0501243_001273 | |||
| 1083 | Ga0501251_017977 | |||
| 1084 | Ga0501257_003118 | |||
| 1085 | Ga0501257_004374 | |||
| 1086 | Ga0501259_004374 | |||
| 1087 | Ga0501234_011897 | |||
| 1088 | Ga0501245_004933 | |||
| 1089 | Ga0501080_0223463 | |||
| 1090 | Ga0501083_0015230 | |||
| 1091 | Ga0501232_001451 | |||
| 1092 | Ga0501266_001738 | |||
| 1093 | Ga0501035_0003078 | |||
| 1094 | Ga0501035_0159292 | |||
| 1095 | Ga0501035_0521741 | |||
| 1096 | nmdc:mga0k408_92153_c1 | |||
| 1097 | Ga0500644_0063132 | |||
| 1098 | Ga0500641_0025562 | |||
| 1099 | Ga0500562_000077 | |||
| 1100 | Ga0500568_0006155 | |||
| 1101 | Ga0500622_0003322 | |||
| 1102 | Ga0500645_022740 | |||
| 1103 | Ga0501084_0029727 | |||
| 1104 | Ga0587077_025297 | |||
| 1105 | Ga0587083_0020468 | |||
| 1106 | Ga0587068_008424 | |||
| 1107 | 2550693359 | |||
| 1108 | 2643798997 | |||
| 1109 | 2644473672 | |||
| 1110 | 2819590723 | |||
| 1111 | 2819594937 | |||
| 1112 | 2884812324 | |||
| 1113 | 2884836688 | |||
| 1114 | 2884852980 | |||
| 1115 | 2896155903 | |||
| 1116 | 2929157742 | |||
| 1117 | 3006975565 | |||
| 1118 | 8047679403 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4h0r-assembly1.cif.gz_A | crystal structure of thymidylate synthase from corynebacterium glutamicum | 0.9746 | 3 | 258 |
| 6auj-assembly2.cif.gz_C | crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 | 0.9743 | 1 | 251 |
| 2g8x-assembly1.cif.gz_B | escherichia coli y209w apoprotein | 0.9726 | 3 | 262 |
| 4h0r-assembly1.cif.gz_B | crystal structure of thymidylate synthase from corynebacterium glutamicum | 0.9718 | 3 | 258 |
| 4fog-assembly2.cif.gz_B | crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid | 0.9716 | 1 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9593 | 2 | 251 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9466 | 2 | 264 | 3.30.572.10 |
| 6qyaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9443 | 2 | 262 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9397 | 2 | 264 | 3.30.572.10 |
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.933 | 2 | 251 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377CVI5-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9826 | 99 | 228 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A4Z0P2P4-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9778 | 51 | 259 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A3Q3X194-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9759 | 107 | 243 |
GO:0004799
GO:0005739 GO:0005829 GO:0006231 GO:0006235 GO:0032259 |
| AF-A0A3B8HDY4-F1-model_v4 | deleted | 0.9743 | 119 | 250 |
|
| AF-A0A355C418-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9742 | 1 | 222 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |