F463596

General Info

Members Datasets Scaffolds Average Seq Length
559 298 1118 265

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0002833|Ga0495668_0002833_11275_12087
Length 270
Sequence MQQYLDLLQHIIDKGVTKTDRTGTGTTSCFGYQMRFDLQQGFPLVTTKKLHLKSIVYELLWFLQGDTNTRYLKEHNVSIWDEWADENGNLGPVYGKQWRSWQGANGKTIDQISDALNQIKNNPDSRRIIVSAWNVAELPEMALMPCHALFQFYVAPGVNGGKGKLSCQLYQRSADVFLGVPFNIASYALLTMMMAQVCDLEPGDFVHTFGDVHLYSNHIEQARLQLTRTPNALPTMKLNPAVKDLFSFTFEDFTLENYQPHPAIKAPVAV

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
85 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
171 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
221 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
258 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
259 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
260 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
261 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
262 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
263 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
264 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
265 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
266 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
267 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
268 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
269 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
270 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
274 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
288 2643221556 Massilia sp. Root1485 Isolate Unclassified
289 2643221684 Massilia sp. Root133 Isolate Unclassified
290 2818991444 Filimonas endophytica 3197 Isolate Unclassified
291 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
292 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
293 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
294 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
295 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
296 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
297 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
298 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0.72
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 0.54
Rhizoplane 2.5
Rhizosphere 87.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0002833 3300046616 Bacteria 13784
2 SwRhRL2b_contig_3160980 2162886007 Bacteria 4069
3 JGI24740J21852_10019370 3300001979 Bacteria 2397
4 JGI25156J39149_1001190 3300002705 Bacteria 11580
5 JGI25162J39368_1004954 3300002737 Bacteria 2824
6 JGI25154J39366_1000986 3300002738 Bacteria 11547
7 JGI25157J39369_1001849 3300002741 Bacteria 6593
8 JGI25406J46586_10012099 3300003203 Bacteria 3757
9 rootH2_10013019 3300003320 Bacteria 26132
10 rootL2_10241602 3300003322 Bacteria 2435
11 JGI25160J50197_1000425 3300003354 Bacteria 26592
12 Ga0055532_1000077 3300003758 Bacteria 122193
13 Ga0055525_1000008 3300003759 Bacteria 604287
14 Ga0055542_1012403 3300003762 Bacteria 1475
15 Ga0065704_10072654 3300005289 Bacteria 8196
16 Ga0070658_10025472 3300005327 Bacteria 4741
17 Ga0070658_10028978 3300005327 Bacteria 4446
18 Ga0070658_10196661 3300005327 Bacteria 1700
19 Ga0070676_10120820 3300005328 Bacteria 1644
20 Ga0070683_100007781 3300005329 Bacteria 9072
21 Ga0070683_100522899 3300005329 Bacteria 1134
22 Ga0070670_100050548 3300005331 Bacteria 3572
23 Ga0070670_100210256 3300005331 Bacteria 1691
24 Ga0068869_100010056 3300005334 Bacteria 6154
25 Ga0068869_100017750 3300005334 Bacteria 4833
26 Ga0070666_10000736 3300005335 Bacteria 19845
27 Ga0070666_10089513 3300005335 Bacteria 2112
28 Ga0070680_100000088 3300005336 Bacteria 51479
29 Ga0070680_100038613 3300005336 Bacteria 3861
30 Ga0068868_100025378 3300005338 Bacteria 4508
31 Ga0068868_100045260 3300005338 Bacteria 3443
32 Ga0068868_100224499 3300005338 Bacteria 1574
33 Ga0070660_100042601 3300005339 Bacteria 3465
34 Ga0070660_100058718 3300005339 Bacteria 2982
35 Ga0070660_100080999 3300005339 Bacteria 2548
36 Ga0070660_100105690 3300005339 Bacteria 2235
37 Ga0070660_100132997 3300005339 Bacteria 1992
38 Ga0070660_100260270 3300005339 Bacteria 1416
39 Ga0070689_100026131 3300005340 Bacteria 4393
40 Ga0070661_100017437 3300005344 Bacteria 5095
41 Ga0070668_100036467 3300005347 Bacteria 3753
42 Ga0070668_100189194 3300005347 Bacteria 1685
43 Ga0070669_100147955 3300005353 Bacteria 1816
44 Ga0070675_100038520 3300005354 Bacteria 3897
45 Ga0070671_100014761 3300005355 Bacteria 6312
46 Ga0070671_100110999 3300005355 Bacteria 2304
47 Ga0070674_100121079 3300005356 Bacteria 1937
48 Ga0070673_100023997 3300005364 Bacteria 4463
49 Ga0070673_100536616 3300005364 Bacteria 1061
50 Ga0070688_100008462 3300005365 Bacteria 5584
51 Ga0070659_100010190 3300005366 Bacteria 6915
52 Ga0070659_100043243 3300005366 Bacteria 3523
53 Ga0070659_100078813 3300005366 Bacteria 2629
54 Ga0070659_100082890 3300005366 Bacteria 2562
55 Ga0070663_100375911 3300005455 Bacteria 1156
56 Ga0070678_100013458 3300005456 Bacteria 5131
57 Ga0070678_100131890 3300005456 Bacteria 1986
58 Ga0070662_100151157 3300005457 Bacteria 1808
59 Ga0068867_100008426 3300005459 Bacteria 7272
60 Ga0070679_100000003 3300005530 Bacteria 307836
61 Ga0070679_100075145 3300005530 Bacteria 3369
62 Ga0070679_100347760 3300005530 Bacteria 1430
63 Ga0070672_100027937 3300005543 Bacteria 4214
64 Ga0070665_100043589 3300005548 Bacteria 4508
65 Ga0068855_100045035 3300005563 Bacteria 5219
66 Ga0068855_100079309 3300005563 Bacteria 3808
67 Ga0068855_100737942 3300005563 Bacteria 1051
68 Ga0070664_100024674 3300005564 Bacteria 4977
69 Ga0070664_100048325 3300005564 Bacteria 3595
70 Ga0070664_100094830 3300005564 Bacteria 2588
71 Ga0070664_100273688 3300005564 Bacteria 1521
72 Ga0068857_100046969 3300005577 Bacteria 3832
73 Ga0068857_100075562 3300005577 Bacteria 3004
74 Ga0068854_100094454 3300005578 Bacteria 2231
75 Ga0068859_100000037 3300005617 Bacteria 165480
76 Ga0068859_100005033 3300005617 Bacteria 13412
77 Ga0068859_100154534 3300005617 Bacteria 2371
78 Ga0068859_100167475 3300005617 Bacteria 2277
79 Ga0068859_100338016 3300005617 Bacteria 1600
80 Ga0068864_100009579 3300005618 Bacteria 7987
81 Ga0068864_100053693 3300005618 Bacteria 3477
82 Ga0068864_100055678 3300005618 Bacteria 3415
83 Ga0068864_100303277 3300005618 Bacteria 1496
84 Ga0068866_10024844 3300005718 Bacteria 2810
85 Ga0068861_100044059 3300005719 Bacteria 3353
86 Ga0068851_10008075 3300005834 Bacteria 4857
87 Ga0068851_10010366 3300005834 Bacteria 4350
88 Ga0068851_10117872 3300005834 Bacteria 1424
89 Ga0068870_10012327 3300005840 Bacteria 3992
90 Ga0068863_100032377 3300005841 Bacteria 4984
91 Ga0068858_100002312 3300005842 Bacteria 19265
92 Ga0068858_100841454 3300005842 Bacteria 896
93 Ga0068860_100003825 3300005843 Bacteria 15482
94 Ga0068860_100026415 3300005843 Bacteria 5597
95 Ga0068860_100030783 3300005843 Bacteria 5160
96 Ga0081539_10000531 3300005985 Bacteria 79191
97 Ga0075366_10107926 3300006195 Bacteria 1674
98 Ga0097621_100032447 3300006237 Bacteria 4151
99 Ga0097621_100068063 3300006237 Bacteria 2936
100 Ga0068871_100083751 3300006358 Bacteria 2646
101 Ga0097620_100000037 3300006931 Bacteria 165480
102 Ga0097620_100005033 3300006931 Bacteria 13412
103 Ga0097620_100154525 3300006931 Bacteria 2371
104 Ga0097620_100167474 3300006931 Bacteria 2277
105 Ga0097620_100338022 3300006931 Bacteria 1600
106 Ga0105240_10051294 3300009093 Bacteria 5193
107 Ga0105245_10057483 3300009098 Bacteria 3498
108 Ga0105245_10181275 3300009098 Bacteria 2012
109 Ga0105245_10386836 3300009098 Bacteria 1394
110 Ga0105247_10045640 3300009101 Bacteria 2689
111 Ga0105241_10001242 3300009174 Bacteria 19468
112 Ga0105241_10063295 3300009174 Bacteria 2854
113 Ga0105241_10119939 3300009174 Bacteria 2116
114 Ga0105242_10031141 3300009176 Bacteria 4258
115 Ga0105242_10119104 3300009176 Bacteria 2263
116 Ga0105237_10011912 3300009545 Bacteria 9193
117 Ga0105237_10019373 3300009545 Bacteria 7028
118 Ga0105238_10054006 3300009551 Bacteria 4036
119 Ga0105239_10050855 3300010375 Bacteria 4544
120 Ga0105246_10059113 3300011119 Bacteria 2658
121 Ga0157373_10049310 3300013100 Bacteria 3001
122 Ga0157371_10003328 3300013102 Bacteria 14681
123 Ga0157370_10058627 3300013104 Bacteria 3659
124 Ga0157370_10163019 3300013104 Bacteria 2074
125 Ga0157370_10486663 3300013104 Bacteria 1134
126 Ga0157369_10040311 3300013105 Bacteria 5098
127 Ga0157369_10109403 3300013105 Bacteria 2939
128 Ga0157374_10000500 3300013296 Bacteria 35513
129 Ga0157374_10065573 3300013296 Bacteria 3410
130 Ga0157374_10148425 3300013296 Bacteria 2279
131 Ga0157374_10583976 3300013296 Bacteria 1127
132 Ga0157378_10036726 3300013297 Bacteria 4336
133 Ga0157378_10057003 3300013297 Bacteria 3482
134 Ga0157378_10057524 3300013297 Bacteria 3465
135 Ga0157378_10059615 3300013297 Bacteria 3405
136 Ga0157378_10123678 3300013297 Bacteria 2387
137 Ga0157378_10140088 3300013297 Bacteria 2245
138 Ga0163162_10004768 3300013306 Bacteria 13086
139 Ga0163162_10319034 3300013306 Bacteria 1686
140 Ga0157372_10089689 3300013307 Bacteria 3494
141 Ga0157372_10201163 3300013307 Bacteria 2307
142 Ga0157372_10352456 3300013307 Bacteria 1715
143 Ga0157372_10390004 3300013307 Bacteria 1623
144 Ga0157372_10432922 3300013307 Bacteria 1533
145 Ga0157375_10091600 3300013308 Bacteria 3102
146 Ga0157375_10149311 3300013308 Bacteria 2471
147 Ga0157375_10455800 3300013308 Bacteria 1444
148 Ga0163163_10001732 3300014325 Bacteria 18387
149 Ga0163163_10018090 3300014325 Bacteria 6586
150 Ga0157380_10022365 3300014326 Bacteria 4758
151 Ga0182008_10071418 3300014497 Bacteria 1708
152 Ga0157377_10013348 3300014745 Bacteria 4157
153 Ga0157379_10058571 3300014968 Bacteria 3445
154 Ga0157376_10032889 3300014969 Bacteria 4169
155 Ga0209435_100082 3300025206 Bacteria 45642
156 Ga0209147_100122 3300025229 Bacteria 138553
157 Ga0209563_100003 3300025230 Bacteria 1932942
158 Ga0209437_100081 3300025233 Bacteria 271072
159 Ga0209258_100739 3300025242 Bacteria 21164
160 Ga0209646_1000152 3300025246 Bacteria 97484
161 Ga0209026_1000126 3300025250 Bacteria 122422
162 Ga0209677_102681 3300025253 Bacteria 6422
163 Ga0209148_1000576 3300025254 Bacteria 34082
164 Ga0209759_1000193 3300025256 Bacteria 97484
165 Ga0207426_1000032 3300025302 Bacteria 457997
166 Ga0207656_10007990 3300025321 Bacteria 3879
167 Ga0207656_10139487 3300025321 Bacteria 1142
168 Ga0207682_10029991 3300025893 Bacteria 2177
169 Ga0207682_10039977 3300025893 Bacteria 1909
170 Ga0207642_10012030 3300025899 Bacteria 3110
171 Ga0207710_10166457 3300025900 Bacteria 1076
172 Ga0207688_10050439 3300025901 Bacteria 2329
173 Ga0207680_10002758 3300025903 Bacteria 8216
174 Ga0207680_10024859 3300025903 Bacteria 3295
175 Ga0207645_10008175 3300025907 Bacteria 7325
176 Ga0207645_10113229 3300025907 Bacteria 1757
177 Ga0207643_10061389 3300025908 Bacteria 2147
178 Ga0207705_10094360 3300025909 Bacteria 2194
179 Ga0207654_10001781 3300025911 Bacteria 11188
180 Ga0207654_10009833 3300025911 Bacteria 4864
181 Ga0207654_10364325 3300025911 Bacteria 998
182 Ga0207671_10001737 3300025914 Bacteria 24547
183 Ga0207660_10000231 3300025917 Bacteria 35986
184 Ga0207660_10144387 3300025917 Bacteria 1822
185 Ga0207660_10388337 3300025917 Bacteria 1123
186 Ga0207657_10005484 3300025919 Bacteria 13247
187 Ga0207657_10071592 3300025919 Bacteria 2936
188 Ga0207657_10085037 3300025919 Bacteria 2651
189 Ga0207657_10115329 3300025919 Bacteria 2214
190 Ga0207657_10539017 3300025919 Bacteria 913
191 Ga0207649_10010790 3300025920 Bacteria 5022
192 Ga0207652_10000004 3300025921 Bacteria 436303
193 Ga0207652_10000101 3300025921 Bacteria 93033
194 Ga0207652_10160509 3300025921 Bacteria 2015
195 Ga0207694_10126826 3300025924 Bacteria 2042
196 Ga0207659_10029066 3300025926 Bacteria 3763
197 Ga0207659_10077383 3300025926 Bacteria 2448
198 Ga0207687_10047815 3300025927 Bacteria 2967
199 Ga0207644_10123410 3300025931 Bacteria 1974
200 Ga0207690_10008026 3300025932 Bacteria 6267
201 Ga0207690_10025312 3300025932 Bacteria 3724
202 Ga0207690_10085253 3300025932 Bacteria 2217
203 Ga0207690_10385863 3300025932 Bacteria 1114
204 Ga0207686_10083724 3300025934 Bacteria 2088
205 Ga0207670_10045864 3300025936 Bacteria 2900
206 Ga0207669_10056730 3300025937 Bacteria 2380
207 Ga0207704_10062769 3300025938 Bacteria 2312
208 Ga0207691_10033299 3300025940 Bacteria 4797
209 Ga0207691_10050300 3300025940 Bacteria 3815
210 Ga0207691_10075103 3300025940 Bacteria 3048
211 Ga0207691_10092613 3300025940 Bacteria 2707
212 Ga0207689_10002113 3300025942 Bacteria 18676
213 Ga0207689_10004902 3300025942 Bacteria 12069
214 Ga0207689_10016695 3300025942 Bacteria 6212
215 Ga0207689_10146936 3300025942 Bacteria 1942
216 Ga0207661_10210677 3300025944 Bacteria 1713
217 Ga0207679_10012499 3300025945 Bacteria 5537
218 Ga0207667_10050356 3300025949 Bacteria 4395
219 Ga0207651_10030376 3300025960 Bacteria 3440
220 Ga0207651_10112157 3300025960 Bacteria 2049
221 Ga0207712_10040602 3300025961 Bacteria 3195
222 Ga0207668_10130196 3300025972 Bacteria 1920
223 Ga0207677_10038689 3300026023 Bacteria 3130
224 Ga0207677_10048022 3300026023 Bacteria 2871
225 Ga0207677_10053515 3300026023 Bacteria 2748
226 Ga0207677_10233828 3300026023 Bacteria 1482
227 Ga0207703_10000878 3300026035 Bacteria 29522
228 Ga0207678_10319081 3300026067 Bacteria 1337
229 Ga0207641_10000121 3300026088 Bacteria 114943
230 Ga0207648_10007071 3300026089 Bacteria 11073
231 Ga0207648_10008275 3300026089 Bacteria 10099
232 Ga0207676_10027669 3300026095 Bacteria 4225
233 Ga0207676_10179411 3300026095 Bacteria 1853
234 Ga0207674_10010770 3300026116 Bacteria 10317
235 Ga0207674_10061307 3300026116 Bacteria 3801
236 Ga0207675_100072985 3300026118 Bacteria 3210
237 Ga0207675_100134258 3300026118 Bacteria 2347
238 Ga0207675_100182952 3300026118 Bacteria 2007
239 Ga0207675_100632143 3300026118 Bacteria 1075
240 Ga0207683_10003508 3300026121 Bacteria 13678
241 Ga0207683_10010782 3300026121 Bacteria 7793
242 Ga0207683_10024062 3300026121 Bacteria 5241
243 Ga0207683_10325089 3300026121 Bacteria 1409
244 Ga0207698_10006261 3300026142 Bacteria 7406
245 Ga0209281_1000056 3300027111 Bacteria 307619
246 Ga0268265_10361576 3300028380 Bacteria 1329
247 Ga0268264_10002971 3300028381 Bacteria 14730
248 Ga0268264_10020319 3300028381 Bacteria 5427
249 Ga0316180_1157605 3300030736 Bacteria 2566
250 Ga0316182_1221789 3300030745 Bacteria 3419
251 Ga0265327_10000432 3300031251 Bacteria 75935
252 Ga0307508_10001325 3300031616 Bacteria 28026
253 Ga0307413_10428649 3300031824 Bacteria 1044
254 Ga0307406_10309760 3300031901 Bacteria 1217
255 Ga0316574_0083314 3300035398 Bacteria 2033
256 Ga0316574_0130205 3300035398 Bacteria 1619
257 Ga0395899_0002720 3300037312 Bacteria 14258
258 Ga0395899_0023907 3300037312 Bacteria 4623
259 Ga0395900_0000028 3300037418 Bacteria 285042
260 Ga0395900_0002348 3300037418 Bacteria 20948
261 Ga0395900_0004043 3300037418 Bacteria 15651
262 Ga0395900_0128905 3300037418 Bacteria 2593
263 Ga0395900_0205762 3300037418 Bacteria 1989
264 Ga0395900_0741019 3300037418 Bacteria 913
265 Ga0395898_0002043 3300037466 Bacteria 25263
266 Ga0395898_0259732 3300037466 Bacteria 1656
267 Ga0395901_0000025 3300038443 Bacteria 263463
268 Ga0395901_0019500 3300038443 Bacteria 6933
269 Ga0395901_0054633 3300038443 Bacteria 4151
270 Ga0395901_0477792 3300038443 Bacteria 1271
271 Ga0395901_0687442 3300038443 Bacteria 1022
272 Ga0439445_0051958 3300042004 Bacteria 1108
273 Ga0439448_0006129 3300042005 Bacteria 3451
274 Ga0439449_0015862 3300042007 Bacteria 2832
275 Ga0439446_0035090 3300042156 Bacteria 1462
276 Ga0466969_0008401 3300044656 Bacteria 5475
277 Ga0466972_0000003 3300044658 Bacteria 391452
278 Ga0466972_0000801 3300044658 Bacteria 14959
279 Ga0466972_0119060 3300044658 Bacteria 1246
280 Ga0466965_0006443 3300044683 Bacteria 5332
281 Ga0466965_0025139 3300044683 Bacteria 2882
282 Ga0466965_0108388 3300044683 Bacteria 1425
283 Ga0466966_0087316 3300044684 Bacteria 1938
284 Ga0466966_0125173 3300044684 Bacteria 1576
285 Ga0466966_0143467 3300044684 Bacteria 1458
286 Ga0466961_0156681 3300044693 Bacteria 1420
287 Ga0466964_0000574 3300044706 Bacteria 11581
288 Ga0466964_0048969 3300044706 Bacteria 1729
289 Ga0453684_0078879 3300044712 Bacteria 4119
290 Ga0466971_0079794 3300044719 Bacteria 1491
291 Ga0466968_0064983 3300044735 Bacteria 1579
292 Ga0466968_0090999 3300044735 Bacteria 1352
293 Ga0466970_0000607 3300044765 Bacteria 17574
294 Ga0466970_0143170 3300044765 Bacteria 1318
295 Ga0466957_0007434 3300044842 Bacteria 6188
296 Ga0466957_0033924 3300044842 Bacteria 3062
297 Ga0466959_0051074 3300045049 Bacteria 3034
298 Ga0466967_0093427 3300045976 Bacteria 2737
299 Ga0495627_001465 3300046453 Bacteria 13766
300 Ga0495603_0117361 3300046455 Bacteria 1551
301 Ga0495590_0001273 3300046457 Bacteria 10960
302 Ga0495591_000236 3300046458 Bacteria 53618
303 Ga0495638_0082435 3300046460 Bacteria 1951
304 Ga0495653_0170872 3300046463 Bacteria 1500
305 Ga0495580_0070292 3300046472 Bacteria 2445
306 Ga0495582_0013683 3300046473 Bacteria 4466
307 Ga0495605_0000177 3300046474 Bacteria 80399
308 Ga0495605_0001739 3300046474 Bacteria 13947
309 Ga0495605_0006538 3300046474 Bacteria 6690
310 Ga0495605_0013984 3300046474 Bacteria 4405
311 Ga0495639_0227324 3300046475 Bacteria 919
312 Ga0495584_0000001 3300046491 Bacteria 649329
313 Ga0495584_0000366 3300046491 Bacteria 31199
314 Ga0495584_0000452 3300046491 Bacteria 28285
315 Ga0495584_0001551 3300046491 Bacteria 13650
316 Ga0495584_0004007 3300046491 Bacteria 7947
317 Ga0495584_0008288 3300046491 Bacteria 5383
318 Ga0495584_0011200 3300046491 Bacteria 4594
319 Ga0495584_0011673 3300046491 Bacteria 4496
320 Ga0495585_0000600 3300046492 Bacteria 33658
321 Ga0495585_0000697 3300046492 Bacteria 30508
322 Ga0495585_0001480 3300046492 Bacteria 18341
323 Ga0495585_0006526 3300046492 Bacteria 7222
324 Ga0495585_0006714 3300046492 Bacteria 7100
325 Ga0495585_0017738 3300046492 Bacteria 4110
326 Ga0495585_0028730 3300046492 Bacteria 3169
327 Ga0495585_0042463 3300046492 Bacteria 2546
328 Ga0495585_0053236 3300046492 Bacteria 2240
329 Ga0495594_0023866 3300046499 Bacteria 3280
330 Ga0495594_0245791 3300046499 Bacteria 1019
331 Ga0495596_0000615 3300046500 Bacteria 22390
332 Ga0495596_0000821 3300046500 Bacteria 18784
333 Ga0495596_0006977 3300046500 Bacteria 5136
334 Ga0495596_0008987 3300046500 Bacteria 4416
335 Ga0495596_0010760 3300046500 Bacteria 3971
336 Ga0495596_0018122 3300046500 Bacteria 2905
337 Ga0495596_0029061 3300046500 Bacteria 2218
338 Ga0495607_0001696 3300046501 Bacteria 18957
339 Ga0495607_0002247 3300046501 Bacteria 15945
340 Ga0495607_0011028 3300046501 Bacteria 6036
341 Ga0495607_0029059 3300046501 Bacteria 3405
342 Ga0495607_0102545 3300046501 Bacteria 1530
343 Ga0495583_0000506 3300046506 Bacteria 56069
344 Ga0495606_0004705 3300046507 Bacteria 13467
345 Ga0495606_0015233 3300046507 Bacteria 5937
346 Ga0495606_0089815 3300046507 Bacteria 1892
347 Ga0495606_0135404 3300046507 Bacteria 1460
348 Ga0495610_0010358 3300046512 Bacteria 5802
349 Ga0495616_0000386 3300046513 Bacteria 34362
350 Ga0495616_0001634 3300046513 Bacteria 15368
351 Ga0495616_0003927 3300046513 Bacteria 9467
352 Ga0495616_0008600 3300046513 Bacteria 6028
353 Ga0495616_0106653 3300046513 Bacteria 1306
354 Ga0495631_0006918 3300046518 Bacteria 5813
355 Ga0495631_0033138 3300046518 Bacteria 2322
356 Ga0495632_0000156 3300046519 Bacteria 70702
357 Ga0495632_0000537 3300046519 Bacteria 35765
358 Ga0495632_0011507 3300046519 Bacteria 5158
359 Ga0495632_0035337 3300046519 Bacteria 2550
360 Ga0495643_0002305 3300046522 Bacteria 15401
361 Ga0495643_0003688 3300046522 Bacteria 11102
362 Ga0495643_0008036 3300046522 Bacteria 6727
363 Ga0495643_0028675 3300046522 Bacteria 3118
364 Ga0495643_0031913 3300046522 Bacteria 2928
365 Ga0495644_0010708 3300046523 Bacteria 3533
366 Ga0495644_0019643 3300046523 Bacteria 2580
367 Ga0495644_0053416 3300046523 Bacteria 1517
368 Ga0495644_0064157 3300046523 Bacteria 1380
369 Ga0495648_0023546 3300046524 Bacteria 4215
370 Ga0495666_0002495 3300046526 Bacteria 9133
371 Ga0495666_0063882 3300046526 Bacteria 1757
372 Ga0495642_0000053 3300046528 Bacteria 70172
373 Ga0495642_0000433 3300046528 Bacteria 22082
374 Ga0495642_0002723 3300046528 Bacteria 7097
375 Ga0495665_0001008 3300046531 Bacteria 14939
376 Ga0495586_0069245 3300046535 Bacteria 1925
377 Ga0495609_0000001 3300046538 Bacteria 1060094
378 Ga0495609_0008646 3300046538 Bacteria 4969
379 Ga0495609_0020636 3300046538 Bacteria 3042
380 Ga0495609_0026206 3300046538 Bacteria 2669
381 Ga0495597_0000488 3300046542 Bacteria 33250
382 Ga0495597_0002178 3300046542 Bacteria 12864
383 Ga0495597_0002942 3300046542 Bacteria 10335
384 Ga0495622_0113871 3300046557 Bacteria 1237
385 Ga0495633_0002380 3300046558 Bacteria 13321
386 Ga0495633_0027256 3300046558 Bacteria 2793
387 Ga0495633_0051966 3300046558 Bacteria 1930
388 Ga0495656_0017719 3300046615 Bacteria 2722
389 Ga0495656_0030285 3300046615 Bacteria 2186
390 Ga0495656_0105218 3300046615 Bacteria 1311
391 Ga0495668_0006442 3300046616 Bacteria 7684
392 Ga0495668_0006681 3300046616 Bacteria 7509
393 Ga0495668_0024499 3300046616 Bacteria 3432
394 Ga0495668_0050068 3300046616 Bacteria 2315
395 Ga0495668_0089260 3300046616 Bacteria 1689
396 Ga0495668_0218136 3300046616 Bacteria 1044
397 Ga0495611_0000960 3300046648 Bacteria 15368
398 Ga0495611_0005964 3300046648 Bacteria 5196
399 Ga0495611_0061906 3300046648 Bacteria 1701
400 Ga0495611_0213440 3300046648 Bacteria 898
401 Ga0495625_0005815 3300046660 Bacteria 11129
402 Ga0495625_0041053 3300046660 Bacteria 3369
403 Ga0495661_0000069 3300046665 Bacteria 125790
404 Ga0495661_0000082 3300046665 Bacteria 116600
405 Ga0495661_0005217 3300046665 Bacteria 9246
406 Ga0495661_0009005 3300046665 Bacteria 6868
407 Ga0495661_0021506 3300046665 Bacteria 4205
408 Ga0495661_0050020 3300046665 Bacteria 2532
409 Ga0495661_0060506 3300046665 Bacteria 2249
410 Ga0495661_0135992 3300046665 Bacteria 1341
411 Ga0495588_0000041 3300046674 Bacteria 377896
412 Ga0495588_0111712 3300046674 Bacteria 1439
413 Ga0495669_0013262 3300046684 Bacteria 3510
414 Ga0495669_0025414 3300046684 Bacteria 2583
415 Ga0495669_0090576 3300046684 Bacteria 1411
416 Ga0495670_0002666 3300046691 Bacteria 8807
417 Ga0495670_0060581 3300046691 Bacteria 1902
418 Ga0495671_0008192 3300046692 Bacteria 5895
419 Ga0495649_0000537 3300046694 Bacteria 32173
420 Ga0495649_0001788 3300046694 Bacteria 15827
421 Ga0495649_0020176 3300046694 Bacteria 3739
422 Ga0495589_0000061 3300046794 Bacteria 104649
423 Ga0495589_0000072 3300046794 Bacteria 95649
424 Ga0495589_0014127 3300046794 Bacteria 4116
425 Ga0495589_0030024 3300046794 Bacteria 2739
426 Ga0495589_0046286 3300046794 Bacteria 2159
427 Ga0495660_0000243 3300046810 Bacteria 53378
428 Ga0495660_0008501 3300046810 Bacteria 6010
429 Ga0495660_0018048 3300046810 Bacteria 4057
430 Ga0495660_0074213 3300046810 Bacteria 1797
431 Ga0495604_0031391 3300047317 Bacteria 4213
432 Ga0495604_0154424 3300047317 Bacteria 1627
433 Ga0495636_0000011 3300047318 Bacteria 87862
434 Ga0495636_0003018 3300047318 Bacteria 6522
435 Ga0495672_0000258 3300047320 Bacteria 73971
436 Ga0495672_0010604 3300047320 Bacteria 6549
437 Ga0495672_0020962 3300047320 Bacteria 4270
438 Ga0495676_0039316 3300047321 Bacteria 3919
439 Ga0495680_0003891 3300047322 Bacteria 14448
440 Ga0495683_0000009 3300047323 Bacteria 241385
441 Ga0495683_0000446 3300047323 Bacteria 32629
442 Ga0495683_0015742 3300047323 Bacteria 3927
443 Ga0495687_000027 3300047443 Bacteria 299689
444 Ga0495687_000630 3300047443 Bacteria 40345
445 Ga0495687_001824 3300047443 Bacteria 18729
446 Ga0495687_002017 3300047443 Bacteria 17187
447 Ga0495675_0030627 3300047444 Bacteria 3432
448 Ga0495677_0000001 3300047445 Bacteria 715000
449 Ga0495677_0000195 3300047445 Bacteria 27965
450 Ga0495677_0001118 3300047445 Bacteria 10729
451 Ga0495677_0001701 3300047445 Bacteria 8838
452 Ga0495677_0006543 3300047445 Bacteria 4401
453 Ga0495679_001482 3300047446 Bacteria 13271
454 Ga0495679_016971 3300047446 Bacteria 2617
455 Ga0495685_036381 3300047447 Bacteria 1690
456 Ga0495681_0000428 3300047470 Bacteria 32244
457 Ga0495681_0015193 3300047470 Bacteria 4366
458 Ga0495681_0024964 3300047470 Bacteria 3134
459 Ga0495686_0000146 3300047472 Bacteria 141435
460 Ga0495686_0000373 3300047472 Bacteria 71977
461 Ga0495686_0001101 3300047472 Bacteria 32108
462 Ga0495686_0006503 3300047472 Bacteria 8925
463 Ga0495686_0047236 3300047472 Bacteria 2719
464 Ga0495593_0213731 3300047673 Bacteria 968
465 Ga0495614_0010053 3300048089 Bacteria 4177
466 Ga0495626_0000027 3300048091 Bacteria 206022
467 Ga0495626_0000135 3300048091 Bacteria 93280
468 Ga0495626_0000193 3300048091 Bacteria 73924
469 Ga0495626_0039499 3300048091 Bacteria 2233
470 Ga0495626_0067380 3300048091 Bacteria 1616
471 Ga0496101_0066030 3300048904 Bacteria 2638
472 Ga0496102_0000058 3300048905 Bacteria 168714
473 Ga0496104_0443251 3300048907 Bacteria 1210
474 Ga0496106_0297027 3300048909 Bacteria 1295
475 Ga0496107_0170968 3300048910 Bacteria 1613
476 Ga0496108_0955706 3300048911 Bacteria 733
477 Ga0496109_0347154 3300048912 Bacteria 1402
478 Ga0496110_0000251 3300048913 Bacteria 34859
479 Ga0496110_0009047 3300048913 Bacteria 8037
480 Ga0496110_0021952 3300048913 Bacteria 5414
481 Ga0496112_0240363 3300048915 Bacteria 1764
482 Ga0496113_0002669 3300048916 Bacteria 10454
483 Ga0496113_0405827 3300048916 Bacteria 1094
484 Ga0496115_0112393 3300048918 Bacteria 2238
485 Ga0496116_0003966 3300048919 Bacteria 14370
486 Ga0496121_0161506 3300048924 Bacteria 1638
487 Ga0496122_0000255 3300048925 Bacteria 120384
488 Ga0496122_0002056 3300048925 Bacteria 29860
489 Ga0496122_0007048 3300048925 Bacteria 12637
490 Ga0496122_0022678 3300048925 Bacteria 5572
491 Ga0496123_0000138 3300048926 Bacteria 151844
492 Ga0496123_0001705 3300048926 Bacteria 29367
493 Ga0496123_0004467 3300048926 Bacteria 14671
494 Ga0496124_0013112 3300048927 Bacteria 8115
495 Ga0496124_0180220 3300048927 Bacteria 1626
496 Ga0496125_0002290 3300048928 Bacteria 25316
497 Ga0496125_0002620 3300048928 Bacteria 23073
498 Ga0501308_001455 3300049128 Bacteria 1897
499 Ga0495678_000110 3300049459 Bacteria 97228
500 Ga0495678_022198 3300049459 Bacteria 2779
501 Ga0495682_0007385 3300049460 Bacteria 4379
502 Ga0495682_0020557 3300049460 Bacteria 2477
503 Ga0501298_004446 3300049521 Bacteria 2210
504 Ga0501034_0023415 3300049571 Bacteria 6293
505 Ga0501034_0170353 3300049571 Bacteria 2145
506 Ga0501034_0212020 3300049571 Bacteria 1892
507 Ga0501038_0149218 3300049574 Bacteria 1907
508 Ga0501039_0456830 3300049575 Bacteria 1003
509 Ga0501043_0113283 3300049579 Bacteria 2130
510 Ga0501067_0026472 3300049583 Bacteria 3212
511 Ga0501069_0048089 3300049585 Bacteria 2368
512 Ga0501070_0376927 3300049586 Bacteria 1149
513 Ga0501072_0181283 3300049588 Bacteria 1680
514 Ga0501073_0162407 3300049589 Bacteria 1547
515 Ga0501201_000140 3300049651 Bacteria 6066
516 Ga0501207_011209 3300049654 Bacteria 1332
517 Ga0501217_017854 3300049661 Bacteria 1640
518 Ga0501222_004316 3300049662 Bacteria 1930
519 Ga0501223_001744 3300049663 Bacteria 4945
520 Ga0501233_014174 3300049668 Bacteria 1626
521 Ga0501235_001675 3300049669 Bacteria 4752
522 Ga0501242_002559 3300049674 Bacteria 1918
523 Ga0501243_001273 3300049675 Bacteria 3595
524 Ga0501251_017977 3300049681 Bacteria 913
525 Ga0501257_003118 3300049686 Bacteria 3530
526 Ga0501257_004374 3300049686 Bacteria 3083
527 Ga0501259_004374 3300049688 Bacteria 2250
528 Ga0501234_011897 3300049707 Bacteria 1362
529 Ga0501245_004933 3300049708 Bacteria 1842
530 Ga0501080_0223463 3300049742 Bacteria 1722
531 Ga0501083_0015230 3300049744 Bacteria 5383
532 Ga0501232_001451 3300049757 Bacteria 1895
533 Ga0501266_001738 3300049763 Bacteria 2759
534 Ga0501035_0003078 3300049822 Bacteria 16010
535 Ga0501035_0159292 3300049822 Bacteria 1955
536 Ga0501035_0521741 3300049822 Bacteria 976
537 nmdc:mga0k408_92153_c1 3300050493 Bacteria 1781
538 Ga0500644_0063132 3300053088 Bacteria 1311
539 Ga0500641_0025562 3300053096 Bacteria 2285
540 Ga0500562_000077 3300053108 Bacteria 45189
541 Ga0500568_0006155 3300053139 Bacteria 6069
542 Ga0500622_0003322 3300053156 Bacteria 10864
543 Ga0500645_022740 3300053730 Bacteria 1925
544 Ga0501084_0029727 3300054114 Bacteria 4571
545 Ga0587077_025297 3300059493 Bacteria 1088
546 Ga0587083_0020468 3300059505 Bacteria 1219
547 Ga0587068_008424 3300059641 Bacteria 1494
548 2550693359 2548876994 Bacteria 4904866
549 2643798997 2643221556 Bacteria 7251154
550 2644473672 2643221684 Bacteria 7145183
551 2819590723 2818991444 Bacteria 6968812
552 2819594937 2818991445 Bacteria 4955017
553 2884812324 2884811622 Bacteria 5552861
554 2884836688 2884836552 Bacteria 5219991
555 2884852980 2884852848 Bacteria 5221161
556 2896155903 2896154374 Bacteria 5221518
557 2929157742 2929154850 Bacteria 6753285
558 3006975565 3006973921 Bacteria 4423788
559 8047679403 8047673197 Bacteria 7395230
560 Ga0495668_0002833
561 SwRhRL2b_contig_3160980
562 JGI24740J21852_10019370
563 JGI25156J39149_1001190
564 JGI25162J39368_1004954
565 JGI25154J39366_1000986
566 JGI25157J39369_1001849
567 JGI25406J46586_10012099
568 rootH2_10013019
569 rootL2_10241602
570 JGI25160J50197_1000425
571 Ga0055532_1000077
572 Ga0055525_1000008
573 Ga0055542_1012403
574 Ga0065704_10072654
575 Ga0070658_10025472
576 Ga0070658_10028978
577 Ga0070658_10196661
578 Ga0070676_10120820
579 Ga0070683_100007781
580 Ga0070683_100522899
581 Ga0070670_100050548
582 Ga0070670_100210256
583 Ga0068869_100010056
584 Ga0068869_100017750
585 Ga0070666_10000736
586 Ga0070666_10089513
587 Ga0070680_100000088
588 Ga0070680_100038613
589 Ga0068868_100025378
590 Ga0068868_100045260
591 Ga0068868_100224499
592 Ga0070660_100042601
593 Ga0070660_100058718
594 Ga0070660_100080999
595 Ga0070660_100105690
596 Ga0070660_100132997
597 Ga0070660_100260270
598 Ga0070689_100026131
599 Ga0070661_100017437
600 Ga0070668_100036467
601 Ga0070668_100189194
602 Ga0070669_100147955
603 Ga0070675_100038520
604 Ga0070671_100014761
605 Ga0070671_100110999
606 Ga0070674_100121079
607 Ga0070673_100023997
608 Ga0070673_100536616
609 Ga0070688_100008462
610 Ga0070659_100010190
611 Ga0070659_100043243
612 Ga0070659_100078813
613 Ga0070659_100082890
614 Ga0070663_100375911
615 Ga0070678_100013458
616 Ga0070678_100131890
617 Ga0070662_100151157
618 Ga0068867_100008426
619 Ga0070679_100000003
620 Ga0070679_100075145
621 Ga0070679_100347760
622 Ga0070672_100027937
623 Ga0070665_100043589
624 Ga0068855_100045035
625 Ga0068855_100079309
626 Ga0068855_100737942
627 Ga0070664_100024674
628 Ga0070664_100048325
629 Ga0070664_100094830
630 Ga0070664_100273688
631 Ga0068857_100046969
632 Ga0068857_100075562
633 Ga0068854_100094454
634 Ga0068859_100000037
635 Ga0068859_100005033
636 Ga0068859_100154534
637 Ga0068859_100167475
638 Ga0068859_100338016
639 Ga0068864_100009579
640 Ga0068864_100053693
641 Ga0068864_100055678
642 Ga0068864_100303277
643 Ga0068866_10024844
644 Ga0068861_100044059
645 Ga0068851_10008075
646 Ga0068851_10010366
647 Ga0068851_10117872
648 Ga0068870_10012327
649 Ga0068863_100032377
650 Ga0068858_100002312
651 Ga0068858_100841454
652 Ga0068860_100003825
653 Ga0068860_100026415
654 Ga0068860_100030783
655 Ga0081539_10000531
656 Ga0075366_10107926
657 Ga0097621_100032447
658 Ga0097621_100068063
659 Ga0068871_100083751
660 Ga0097620_100000037
661 Ga0097620_100005033
662 Ga0097620_100154525
663 Ga0097620_100167474
664 Ga0097620_100338022
665 Ga0105240_10051294
666 Ga0105245_10057483
667 Ga0105245_10181275
668 Ga0105245_10386836
669 Ga0105247_10045640
670 Ga0105241_10001242
671 Ga0105241_10063295
672 Ga0105241_10119939
673 Ga0105242_10031141
674 Ga0105242_10119104
675 Ga0105237_10011912
676 Ga0105237_10019373
677 Ga0105238_10054006
678 Ga0105239_10050855
679 Ga0105246_10059113
680 Ga0157373_10049310
681 Ga0157371_10003328
682 Ga0157370_10058627
683 Ga0157370_10163019
684 Ga0157370_10486663
685 Ga0157369_10040311
686 Ga0157369_10109403
687 Ga0157374_10000500
688 Ga0157374_10065573
689 Ga0157374_10148425
690 Ga0157374_10583976
691 Ga0157378_10036726
692 Ga0157378_10057003
693 Ga0157378_10057524
694 Ga0157378_10059615
695 Ga0157378_10123678
696 Ga0157378_10140088
697 Ga0163162_10004768
698 Ga0163162_10319034
699 Ga0157372_10089689
700 Ga0157372_10201163
701 Ga0157372_10352456
702 Ga0157372_10390004
703 Ga0157372_10432922
704 Ga0157375_10091600
705 Ga0157375_10149311
706 Ga0157375_10455800
707 Ga0163163_10001732
708 Ga0163163_10018090
709 Ga0157380_10022365
710 Ga0182008_10071418
711 Ga0157377_10013348
712 Ga0157379_10058571
713 Ga0157376_10032889
714 Ga0209435_100082
715 Ga0209147_100122
716 Ga0209563_100003
717 Ga0209437_100081
718 Ga0209258_100739
719 Ga0209646_1000152
720 Ga0209026_1000126
721 Ga0209677_102681
722 Ga0209148_1000576
723 Ga0209759_1000193
724 Ga0207426_1000032
725 Ga0207656_10007990
726 Ga0207656_10139487
727 Ga0207682_10029991
728 Ga0207682_10039977
729 Ga0207642_10012030
730 Ga0207710_10166457
731 Ga0207688_10050439
732 Ga0207680_10002758
733 Ga0207680_10024859
734 Ga0207645_10008175
735 Ga0207645_10113229
736 Ga0207643_10061389
737 Ga0207705_10094360
738 Ga0207654_10001781
739 Ga0207654_10009833
740 Ga0207654_10364325
741 Ga0207671_10001737
742 Ga0207660_10000231
743 Ga0207660_10144387
744 Ga0207660_10388337
745 Ga0207657_10005484
746 Ga0207657_10071592
747 Ga0207657_10085037
748 Ga0207657_10115329
749 Ga0207657_10539017
750 Ga0207649_10010790
751 Ga0207652_10000004
752 Ga0207652_10000101
753 Ga0207652_10160509
754 Ga0207694_10126826
755 Ga0207659_10029066
756 Ga0207659_10077383
757 Ga0207687_10047815
758 Ga0207644_10123410
759 Ga0207690_10008026
760 Ga0207690_10025312
761 Ga0207690_10085253
762 Ga0207690_10385863
763 Ga0207686_10083724
764 Ga0207670_10045864
765 Ga0207669_10056730
766 Ga0207704_10062769
767 Ga0207691_10033299
768 Ga0207691_10050300
769 Ga0207691_10075103
770 Ga0207691_10092613
771 Ga0207689_10002113
772 Ga0207689_10004902
773 Ga0207689_10016695
774 Ga0207689_10146936
775 Ga0207661_10210677
776 Ga0207679_10012499
777 Ga0207667_10050356
778 Ga0207651_10030376
779 Ga0207651_10112157
780 Ga0207712_10040602
781 Ga0207668_10130196
782 Ga0207677_10038689
783 Ga0207677_10048022
784 Ga0207677_10053515
785 Ga0207677_10233828
786 Ga0207703_10000878
787 Ga0207678_10319081
788 Ga0207641_10000121
789 Ga0207648_10007071
790 Ga0207648_10008275
791 Ga0207676_10027669
792 Ga0207676_10179411
793 Ga0207674_10010770
794 Ga0207674_10061307
795 Ga0207675_100072985
796 Ga0207675_100134258
797 Ga0207675_100182952
798 Ga0207675_100632143
799 Ga0207683_10003508
800 Ga0207683_10010782
801 Ga0207683_10024062
802 Ga0207683_10325089
803 Ga0207698_10006261
804 Ga0209281_1000056
805 Ga0268265_10361576
806 Ga0268264_10002971
807 Ga0268264_10020319
808 Ga0316180_1157605
809 Ga0316182_1221789
810 Ga0265327_10000432
811 Ga0307508_10001325
812 Ga0307413_10428649
813 Ga0307406_10309760
814 Ga0316574_0083314
815 Ga0316574_0130205
816 Ga0395899_0002720
817 Ga0395899_0023907
818 Ga0395900_0000028
819 Ga0395900_0002348
820 Ga0395900_0004043
821 Ga0395900_0128905
822 Ga0395900_0205762
823 Ga0395900_0741019
824 Ga0395898_0002043
825 Ga0395898_0259732
826 Ga0395901_0000025
827 Ga0395901_0019500
828 Ga0395901_0054633
829 Ga0395901_0477792
830 Ga0395901_0687442
831 Ga0439445_0051958
832 Ga0439448_0006129
833 Ga0439449_0015862
834 Ga0439446_0035090
835 Ga0466969_0008401
836 Ga0466972_0000003
837 Ga0466972_0000801
838 Ga0466972_0119060
839 Ga0466965_0006443
840 Ga0466965_0025139
841 Ga0466965_0108388
842 Ga0466966_0087316
843 Ga0466966_0125173
844 Ga0466966_0143467
845 Ga0466961_0156681
846 Ga0466964_0000574
847 Ga0466964_0048969
848 Ga0453684_0078879
849 Ga0466971_0079794
850 Ga0466968_0064983
851 Ga0466968_0090999
852 Ga0466970_0000607
853 Ga0466970_0143170
854 Ga0466957_0007434
855 Ga0466957_0033924
856 Ga0466959_0051074
857 Ga0466967_0093427
858 Ga0495627_001465
859 Ga0495603_0117361
860 Ga0495590_0001273
861 Ga0495591_000236
862 Ga0495638_0082435
863 Ga0495653_0170872
864 Ga0495580_0070292
865 Ga0495582_0013683
866 Ga0495605_0000177
867 Ga0495605_0001739
868 Ga0495605_0006538
869 Ga0495605_0013984
870 Ga0495639_0227324
871 Ga0495584_0000001
872 Ga0495584_0000366
873 Ga0495584_0000452
874 Ga0495584_0001551
875 Ga0495584_0004007
876 Ga0495584_0008288
877 Ga0495584_0011200
878 Ga0495584_0011673
879 Ga0495585_0000600
880 Ga0495585_0000697
881 Ga0495585_0001480
882 Ga0495585_0006526
883 Ga0495585_0006714
884 Ga0495585_0017738
885 Ga0495585_0028730
886 Ga0495585_0042463
887 Ga0495585_0053236
888 Ga0495594_0023866
889 Ga0495594_0245791
890 Ga0495596_0000615
891 Ga0495596_0000821
892 Ga0495596_0006977
893 Ga0495596_0008987
894 Ga0495596_0010760
895 Ga0495596_0018122
896 Ga0495596_0029061
897 Ga0495607_0001696
898 Ga0495607_0002247
899 Ga0495607_0011028
900 Ga0495607_0029059
901 Ga0495607_0102545
902 Ga0495583_0000506
903 Ga0495606_0004705
904 Ga0495606_0015233
905 Ga0495606_0089815
906 Ga0495606_0135404
907 Ga0495610_0010358
908 Ga0495616_0000386
909 Ga0495616_0001634
910 Ga0495616_0003927
911 Ga0495616_0008600
912 Ga0495616_0106653
913 Ga0495631_0006918
914 Ga0495631_0033138
915 Ga0495632_0000156
916 Ga0495632_0000537
917 Ga0495632_0011507
918 Ga0495632_0035337
919 Ga0495643_0002305
920 Ga0495643_0003688
921 Ga0495643_0008036
922 Ga0495643_0028675
923 Ga0495643_0031913
924 Ga0495644_0010708
925 Ga0495644_0019643
926 Ga0495644_0053416
927 Ga0495644_0064157
928 Ga0495648_0023546
929 Ga0495666_0002495
930 Ga0495666_0063882
931 Ga0495642_0000053
932 Ga0495642_0000433
933 Ga0495642_0002723
934 Ga0495665_0001008
935 Ga0495586_0069245
936 Ga0495609_0000001
937 Ga0495609_0008646
938 Ga0495609_0020636
939 Ga0495609_0026206
940 Ga0495597_0000488
941 Ga0495597_0002178
942 Ga0495597_0002942
943 Ga0495622_0113871
944 Ga0495633_0002380
945 Ga0495633_0027256
946 Ga0495633_0051966
947 Ga0495656_0017719
948 Ga0495656_0030285
949 Ga0495656_0105218
950 Ga0495668_0006442
951 Ga0495668_0006681
952 Ga0495668_0024499
953 Ga0495668_0050068
954 Ga0495668_0089260
955 Ga0495668_0218136
956 Ga0495611_0000960
957 Ga0495611_0005964
958 Ga0495611_0061906
959 Ga0495611_0213440
960 Ga0495625_0005815
961 Ga0495625_0041053
962 Ga0495661_0000069
963 Ga0495661_0000082
964 Ga0495661_0005217
965 Ga0495661_0009005
966 Ga0495661_0021506
967 Ga0495661_0050020
968 Ga0495661_0060506
969 Ga0495661_0135992
970 Ga0495588_0000041
971 Ga0495588_0111712
972 Ga0495669_0013262
973 Ga0495669_0025414
974 Ga0495669_0090576
975 Ga0495670_0002666
976 Ga0495670_0060581
977 Ga0495671_0008192
978 Ga0495649_0000537
979 Ga0495649_0001788
980 Ga0495649_0020176
981 Ga0495589_0000061
982 Ga0495589_0000072
983 Ga0495589_0014127
984 Ga0495589_0030024
985 Ga0495589_0046286
986 Ga0495660_0000243
987 Ga0495660_0008501
988 Ga0495660_0018048
989 Ga0495660_0074213
990 Ga0495604_0031391
991 Ga0495604_0154424
992 Ga0495636_0000011
993 Ga0495636_0003018
994 Ga0495672_0000258
995 Ga0495672_0010604
996 Ga0495672_0020962
997 Ga0495676_0039316
998 Ga0495680_0003891
999 Ga0495683_0000009
1000 Ga0495683_0000446
1001 Ga0495683_0015742
1002 Ga0495687_000027
1003 Ga0495687_000630
1004 Ga0495687_001824
1005 Ga0495687_002017
1006 Ga0495675_0030627
1007 Ga0495677_0000001
1008 Ga0495677_0000195
1009 Ga0495677_0001118
1010 Ga0495677_0001701
1011 Ga0495677_0006543
1012 Ga0495679_001482
1013 Ga0495679_016971
1014 Ga0495685_036381
1015 Ga0495681_0000428
1016 Ga0495681_0015193
1017 Ga0495681_0024964
1018 Ga0495686_0000146
1019 Ga0495686_0000373
1020 Ga0495686_0001101
1021 Ga0495686_0006503
1022 Ga0495686_0047236
1023 Ga0495593_0213731
1024 Ga0495614_0010053
1025 Ga0495626_0000027
1026 Ga0495626_0000135
1027 Ga0495626_0000193
1028 Ga0495626_0039499
1029 Ga0495626_0067380
1030 Ga0496101_0066030
1031 Ga0496102_0000058
1032 Ga0496104_0443251
1033 Ga0496106_0297027
1034 Ga0496107_0170968
1035 Ga0496108_0955706
1036 Ga0496109_0347154
1037 Ga0496110_0000251
1038 Ga0496110_0009047
1039 Ga0496110_0021952
1040 Ga0496112_0240363
1041 Ga0496113_0002669
1042 Ga0496113_0405827
1043 Ga0496115_0112393
1044 Ga0496116_0003966
1045 Ga0496121_0161506
1046 Ga0496122_0000255
1047 Ga0496122_0002056
1048 Ga0496122_0007048
1049 Ga0496122_0022678
1050 Ga0496123_0000138
1051 Ga0496123_0001705
1052 Ga0496123_0004467
1053 Ga0496124_0013112
1054 Ga0496124_0180220
1055 Ga0496125_0002290
1056 Ga0496125_0002620
1057 Ga0501308_001455
1058 Ga0495678_000110
1059 Ga0495678_022198
1060 Ga0495682_0007385
1061 Ga0495682_0020557
1062 Ga0501298_004446
1063 Ga0501034_0023415
1064 Ga0501034_0170353
1065 Ga0501034_0212020
1066 Ga0501038_0149218
1067 Ga0501039_0456830
1068 Ga0501043_0113283
1069 Ga0501067_0026472
1070 Ga0501069_0048089
1071 Ga0501070_0376927
1072 Ga0501072_0181283
1073 Ga0501073_0162407
1074 Ga0501201_000140
1075 Ga0501207_011209
1076 Ga0501217_017854
1077 Ga0501222_004316
1078 Ga0501223_001744
1079 Ga0501233_014174
1080 Ga0501235_001675
1081 Ga0501242_002559
1082 Ga0501243_001273
1083 Ga0501251_017977
1084 Ga0501257_003118
1085 Ga0501257_004374
1086 Ga0501259_004374
1087 Ga0501234_011897
1088 Ga0501245_004933
1089 Ga0501080_0223463
1090 Ga0501083_0015230
1091 Ga0501232_001451
1092 Ga0501266_001738
1093 Ga0501035_0003078
1094 Ga0501035_0159292
1095 Ga0501035_0521741
1096 nmdc:mga0k408_92153_c1
1097 Ga0500644_0063132
1098 Ga0500641_0025562
1099 Ga0500562_000077
1100 Ga0500568_0006155
1101 Ga0500622_0003322
1102 Ga0500645_022740
1103 Ga0501084_0029727
1104 Ga0587077_025297
1105 Ga0587083_0020468
1106 Ga0587068_008424
1107 2550693359
1108 2643798997
1109 2644473672
1110 2819590723
1111 2819594937
1112 2884812324
1113 2884836688
1114 2884852980
1115 2896155903
1116 2929157742
1117 3006975565
1118 8047679403

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

2

270

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h0r-assembly1.cif.gz_A crystal structure of thymidylate synthase from corynebacterium glutamicum 0.9746 3 258
6auj-assembly2.cif.gz_C crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 0.9743 1 251
2g8x-assembly1.cif.gz_B escherichia coli y209w apoprotein 0.9726 3 262
4h0r-assembly1.cif.gz_B crystal structure of thymidylate synthase from corynebacterium glutamicum 0.9718 3 258
4fog-assembly2.cif.gz_B crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid 0.9716 1 261
ID Description Score Start End Superfamily
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9593 2 251 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9466 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9443 2 262 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9397 2 264 3.30.572.10
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.933 2 251 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A377CVI5-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9826 99 228 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A4Z0P2P4-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9778 51 259 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A3Q3X194-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9759 107 243 GO:0004799
GO:0005739
GO:0005829
GO:0006231
GO:0006235
GO:0032259
AF-A0A3B8HDY4-F1-model_v4 deleted 0.9743 119 250
AF-A0A355C418-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9742 1 222 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Map