F463597

General Info

Members Datasets Scaffolds Average Seq Length
559 338 1116 359

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0043583|Ga0495649_0043583_193_1350
Length 376
Sequence MKQARRNILAGSLQLIAALALAAPTVIRVGVASPAQGSPPGISGSSIAIAHATGAIEQEFKPDNIRIEWYFFKGAGPAVNEALSNRQLDFAFQGDLPSIIGKSAGLKTRLILATGVRMNLYLAVPAGSPVRKVEDLRGKRVAIFKGTNSQLPINRLLAAHGLTEKDLKVVNLDTATAQAALTTKDIDAVFGSYDLLKLRDKGVARIVYTSKGDSPVFTRQSHMLVTDEFAARYPEQTRRFVKAVVKTARWSSEDANRDEVFRLWARPGVAKVEVWKEDYEGQPLRTRLSPLFDPFLTERYRDAVEHAYQFKLIRRKFDVDTWIDRSFLNATLKELKLETYWPANPVGAYAAGAAPVPTPVSSYVPQKPVPGGSNRS

Samples

Sample ID Description Type Environment
1 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
135 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
136 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
137 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
138 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
139 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
148 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
252 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
253 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
254 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
255 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
256 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
257 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
258 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
267 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
268 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
269 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
270 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
271 2511231008 Pseudomonas sp. GM21 Isolate Nodule
272 2511231021 Pseudomonas sp. GM78 Isolate Nodule
273 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
274 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
275 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
276 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
277 2547132374 Acidovorax radicis N35 Isolate Unclassified
278 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
279 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
280 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
281 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
282 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
283 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
284 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
285 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
286 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
287 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
288 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
289 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
290 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
291 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
292 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
293 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
294 2643221717 Acidovorax sp. Root267 Isolate Unclassified
295 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
296 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
297 2773857670 Pseudomonas sp. 478 Isolate Unclassified
298 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
299 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
300 2784132072 Pseudomonas sp. 460 Isolate Unclassified
301 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
302 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
303 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
304 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
305 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
306 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
307 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
308 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
309 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
310 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
311 2858950400 Achromobacter sp. K91 Isolate Unclassified
312 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
313 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
314 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
315 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
316 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
317 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
318 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
319 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
320 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
321 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
322 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
323 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
324 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
325 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
326 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
327 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
328 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
329 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
330 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
331 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
332 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
333 2941479691
334 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
335 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
336 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
337 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
338 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.12
Metatranscriptomes 0
Isolates 12.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.17
Nodule 2.86
Rhizoplane 5.9
Rhizosphere 54.92
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495649_0043583 3300046694 Bacteria 2449
2 JGI24740J21852_10000424 3300001979 Bacteria 18050
3 JGI25155J39150_1000432 3300002704 Bacteria 11216
4 JGI25155J39150_1000469 3300002704 Bacteria 10099
5 JGI25156J39149_1001147 3300002705 Bacteria 11872
6 JGI25156J39149_1001292 3300002705 Bacteria 10864
7 JGI25162J39368_1000356 3300002737 Bacteria 39132
8 JGI25154J39366_1000961 3300002738 Bacteria 11872
9 JGI25154J39366_1001064 3300002738 Bacteria 10864
10 JGI25157J39369_1000990 3300002741 Bacteria 13286
11 JGI25152J39213_1003697 3300002773 Bacteria 5132
12 JGI25152J39213_1008691 3300002773 Bacteria 2493
13 JGI25159J45721_1002018 3300002987 Bacteria 8049
14 JGI25151J46595_10000625 3300003187 Bacteria 30742
15 JGI25165J46597_1000450 3300003214 Bacteria 41394
16 JGI25160J50197_1000018 3300003354 Bacteria 239933
17 JGI25161J50226_1000020 3300003374 Bacteria 164844
18 Ga0055538_1000002 3300003751 Bacteria 999437
19 Ga0055539_1000002 3300003752 Bacteria 999437
20 Ga0055533_1000004 3300003756 Bacteria 999437
21 Ga0055532_1000102 3300003758 Bacteria 91562
22 Ga0055525_1000002 3300003759 Bacteria 999437
23 Ga0055535_1003187 3300003761 Bacteria 4865
24 Ga0055526_1025242 3300003771 Bacteria 1912
25 Ga0055526_1029305 3300003771 Bacteria 1638
26 Ga0055528_1000273 3300003790 Bacteria 43784
27 Ga0055528_1013773 3300003790 Bacteria 3042
28 Ga0055540_1026204 3300003792 Bacteria 1414
29 Ga0055541_1000002 3300003841 Bacteria 896405
30 Ga0058692_1000144 3300003856 Bacteria 45086
31 Ga0055543_1000004 3300004625 Bacteria 239971
32 Ga0065165_1000429 3300005262 Bacteria 66016
33 Ga0065165_1004320 3300005262 Bacteria 8934
34 Ga0065714_10000082 3300005288 Bacteria 17755
35 Ga0065714_10087023 3300005288 Bacteria 2077
36 Ga0065714_10098195 3300005288 Bacteria 1715
37 Ga0065712_10020728 3300005290 Bacteria 1744
38 Ga0070668_100337278 3300005347 Bacteria 1273
39 Ga0070671_100062170 3300005355 Bacteria 3110
40 Ga0070671_100212534 3300005355 Bacteria 1641
41 Ga0070659_100025112 3300005366 Bacteria 4574
42 Ga0070667_100012256 3300005367 Bacteria 7093
43 Ga0070663_100068038 3300005455 Bacteria 2585
44 Ga0070678_100018058 3300005456 Bacteria 4562
45 Ga0068867_100116053 3300005459 Bacteria 2063
46 Ga0070706_100012987 3300005467 Bacteria 7708
47 Ga0070707_100217118 3300005468 Bacteria 1863
48 Ga0068853_100050351 3300005539 Bacteria 3583
49 Ga0070665_100092444 3300005548 Bacteria 3030
50 Ga0068855_100109586 3300005563 Bacteria 3170
51 Ga0068854_100026272 3300005578 Bacteria 4000
52 Ga0068852_100061870 3300005616 Bacteria 3254
53 Ga0068859_100063973 3300005617 Bacteria 3711
54 Ga0068861_100210297 3300005719 Bacteria 1638
55 Ga0068863_100060151 3300005841 Bacteria 3593
56 Ga0068860_100208581 3300005843 Bacteria 1895
57 Ga0075365_10006192 3300006038 Bacteria 6558
58 Ga0075365_10037936 3300006038 Bacteria 3129
59 Ga0075368_10020547 3300006042 Bacteria 2502
60 Ga0075363_100007382 3300006048 Bacteria 5047
61 Ga0075362_10033262 3300006177 Bacteria 2242
62 Ga0075362_10038201 3300006177 Bacteria 2109
63 Ga0075367_10000621 3300006178 Bacteria 13574
64 Ga0075369_10000377 3300006186 Bacteria 13354
65 Ga0075369_10019565 3300006186 Bacteria 2765
66 Ga0075366_10064282 3300006195 Bacteria 2182
67 Ga0075370_10012137 3300006353 Bacteria 4546
68 Ga0097620_100063974 3300006931 Bacteria 3711
69 Ga0105251_10000101 3300009011 Bacteria 84159
70 Ga0105251_10000114 3300009011 Bacteria 80239
71 Ga0105251_10000659 3300009011 Bacteria 31764
72 Ga0105251_10000900 3300009011 Bacteria 26643
73 Ga0105251_10002850 3300009011 Bacteria 13057
74 Ga0105251_10039735 3300009011 Bacteria 2296
75 Ga0105244_10064484 3300009036 Bacteria 1837
76 Ga0105250_10000268 3300009092 Bacteria 42300
77 Ga0105240_10006815 3300009093 Bacteria 16707
78 Ga0105240_10040183 3300009093 Bacteria 5987
79 Ga0105240_10063805 3300009093 Bacteria 4580
80 Ga0105240_10185576 3300009093 Bacteria 2450
81 Ga0105243_10108888 3300009148 Bacteria 2314
82 Ga0105242_10120114 3300009176 Bacteria 2254
83 Ga0105242_10336382 3300009176 Bacteria 1390
84 Ga0105248_10511151 3300009177 Bacteria 1355
85 Ga0105237_10000564 3300009545 Bacteria 51816
86 Ga0105238_10019161 3300009551 Bacteria 6972
87 Ga0105249_10242913 3300009553 Bacteria 1781
88 Ga0123342_1020141 3300009766 Bacteria 4933
89 Ga0105239_10005868 3300010375 Bacteria 14316
90 Ga0105239_10018822 3300010375 Bacteria 7629
91 Ga0157370_10009041 3300013104 Bacteria 10693
92 Ga0157374_10112930 3300013296 Bacteria 2615
93 Ga0163162_10000665 3300013306 Bacteria 31845
94 Ga0163162_10042896 3300013306 Bacteria 4528
95 Ga0163162_10075638 3300013306 Bacteria 3428
96 Ga0163162_10382762 3300013306 Bacteria 1540
97 Ga0157375_10210765 3300013308 Bacteria 2100
98 Ga0157375_10223087 3300013308 Bacteria 2043
99 Ga0163163_10368378 3300014325 Bacteria 1493
100 Ga0157379_10016569 3300014968 Bacteria 6481
101 Ga0182006_1002816 3300015261 Bacteria 9276
102 Ga0182006_1007399 3300015261 Bacteria 5026
103 Ga0182007_10007393 3300015262 Bacteria 4610
104 Ga0163161_10015863 3300017792 Bacteria 5255
105 Ga0163161_10044079 3300017792 Bacteria 3212
106 Ga0163161_10092736 3300017792 Bacteria 2236
107 Ga0213872_10031309 3300021361 Bacteria 2438
108 Ga0209435_100030 3300025206 Bacteria 170822
109 Ga0209435_100134 3300025206 Bacteria 25335
110 Ga0209784_100002 3300025224 Bacteria 1753105
111 Ga0209566_100003 3300025225 Bacteria 1753105
112 Ga0209674_100004 3300025226 Bacteria 1753105
113 Ga0209147_100159 3300025229 Bacteria 91615
114 Ga0209563_100006 3300025230 Bacteria 1753105
115 Ga0209437_100286 3300025233 Bacteria 74228
116 Ga0209437_100317 3300025233 Bacteria 63136
117 Ga0209258_100259 3300025242 Bacteria 92050
118 Ga0209646_1000057 3300025246 Bacteria 266384
119 Ga0209646_1000100 3300025246 Bacteria 170822
120 Ga0209026_1000091 3300025250 Bacteria 171170
121 Ga0209677_100003 3300025253 Bacteria 1753105
122 Ga0209148_1005591 3300025254 Bacteria 2859
123 Ga0209759_1000084 3300025256 Bacteria 169233
124 Ga0209759_1000141 3300025256 Bacteria 124528
125 Ga0209129_1000182 3300025258 Bacteria 87739
126 Ga0209129_1003600 3300025258 Bacteria 6628
127 Ga0209233_1000249 3300025261 Bacteria 86702
128 Ga0209455_1008345 3300025272 Bacteria 2821
129 Ga0209673_1000691 3300025273 Bacteria 48251
130 Ga0209673_1010739 3300025273 Bacteria 3836
131 Ga0209130_1000035 3300025284 Bacteria 296161
132 Ga0209025_1000461 3300025294 Bacteria 79418
133 Ga0209564_1002222 3300025295 Bacteria 16072
134 Ga0209564_1015018 3300025295 Bacteria 3179
135 Ga0209758_1029740 3300025297 Bacteria 2276
136 Ga0209256_1000648 3300025299 Bacteria 47343
137 Ga0207426_1000017 3300025302 Bacteria 577913
138 Ga0207426_1000851 3300025302 Bacteria 32072
139 Ga0207426_1001839 3300025302 Bacteria 15628
140 Ga0209051_1000932 3300025303 Bacteria 28929
141 Ga0209051_1005930 3300025303 Bacteria 7012
142 Ga0209051_1006880 3300025303 Bacteria 6318
143 Ga0207696_1000020 3300025711 Bacteria 434998
144 Ga0207655_1021552 3300025728 Bacteria 3266
145 Ga0207655_1030571 3300025728 Bacteria 2502
146 Ga0207713_1000032 3300025735 Bacteria 276465
147 Ga0207713_1000200 3300025735 Bacteria 82983
148 Ga0207713_1003128 3300025735 Bacteria 11474
149 Ga0207713_1021002 3300025735 Bacteria 3141
150 Ga0207647_10143723 3300025904 Bacteria 1397
151 Ga0207684_10015012 3300025910 Bacteria 6667
152 Ga0207695_10005698 3300025913 Bacteria 16426
153 Ga0207695_10060576 3300025913 Bacteria 3916
154 Ga0207695_10080303 3300025913 Bacteria 3303
155 Ga0207671_10006250 3300025914 Bacteria 10674
156 Ga0207694_10026948 3300025924 Bacteria 4376
157 Ga0207706_10036995 3300025933 Bacteria 4335
158 Ga0207706_10215203 3300025933 Bacteria 1683
159 Ga0207709_10045430 3300025935 Bacteria 2660
160 Ga0207665_10154329 3300025939 Unclassified 1647
161 Ga0207658_10008255 3300025986 Bacteria 7094
162 Ga0207678_10072977 3300026067 Bacteria 2941
163 Ga0207648_10020423 3300026089 Bacteria 5964
164 Ga0207674_10078966 3300026116 Bacteria 3296
165 Ga0207683_10031236 3300026121 Bacteria 4622
166 Ga0207698_10044170 3300026142 Bacteria 3346
167 Ga0207698_10119392 3300026142 Bacteria 2228
168 Ga0209371_1000001 3300027312 Bacteria 2771503
169 Ga0209371_1018037 3300027312 Bacteria 1808
170 Ga0268264_10163972 3300028381 Bacteria 2005
171 Ga0307517_10151891 3300028786 Bacteria 1585
172 Ga0307515_10000492 3300028794 Bacteria 94501
173 Ga0307515_10000571 3300028794 Bacteria 86938
174 Ga0307515_10105341 3300028794 Bacteria 3359
175 Ga0307515_10132008 3300028794 Bacteria 2743
176 Ga0268256_1000001 3300030500 Bacteria 2771065
177 Ga0268256_1020125 3300030500 Bacteria 1808
178 Ga0307513_10013229 3300031456 Bacteria 10129
179 Ga0307513_10123405 3300031456 Bacteria 2552
180 Ga0307513_10132353 3300031456 Bacteria 2437
181 Ga0307513_10232792 3300031456 Bacteria 1654
182 Ga0307509_10000654 3300031507 Bacteria 58837
183 Ga0307509_10008448 3300031507 Bacteria 13131
184 Ga0307514_10000708 3300031649 Bacteria 57806
185 Ga0307516_10006124 3300031730 Bacteria 14179
186 Ga0307516_10053150 3300031730 Bacteria 3962
187 Ga0307405_10268844 3300031731 Bacteria 1277
188 Ga0307412_10010053 3300031911 Bacteria 5442
189 Ga0307412_10046935 3300031911 Bacteria 2833
190 Ga0307510_10001775 3300033180 Bacteria 24067
191 Ga0307510_10040139 3300033180 Bacteria 5143
192 Ga0395905_0027725 3300037471 Bacteria 5341
193 Ga0436361_0163520 3300039447 Bacteria 2105
194 Ga0436361_0456842 3300039447 Bacteria 43282
195 Ga0439465_0004220 3300041413 Bacteria 4676
196 Ga0451795_1074212 3300041456 Bacteria 1444
197 Ga0439451_020130 3300042009 Bacteria 1345
198 Ga0450911_000247 3300042115 Bacteria 20510
199 Ga0450902_000035 3300042137 Bacteria 11749
200 Ga0450902_000345 3300042137 Bacteria 5675
201 Ga0450903_001670 3300042138 Bacteria 4106
202 Ga0450905_000968 3300042142 Bacteria 3592
203 Ga0451577_0029453 3300042876 Bacteria 4963
204 Ga0451577_0292037 3300042876 Bacteria 1477
205 Ga0453683_0237437 3300044673 Bacteria 1161
206 Ga0466965_0064287 3300044683 Bacteria 1836
207 Ga0466960_0038620 3300044901 Bacteria 2246
208 Ga0466967_0109771 3300045976 Bacteria 2533
209 Ga0495617_004568 3300046452 Bacteria 5016
210 Ga0495617_026767 3300046452 Bacteria 1942
211 Ga0495603_0000130 3300046455 Bacteria 36862
212 Ga0495603_0000827 3300046455 Bacteria 17785
213 Ga0495603_0011081 3300046455 Bacteria 5465
214 Ga0495603_0030596 3300046455 Bacteria 3241
215 Ga0495590_0002504 3300046457 Bacteria 7599
216 Ga0495590_0013638 3300046457 Bacteria 2983
217 Ga0495591_000453 3300046458 Bacteria 33315
218 Ga0495591_006075 3300046458 Bacteria 5429
219 Ga0495591_007180 3300046458 Bacteria 4774
220 Ga0495591_049239 3300046458 Bacteria 1159
221 Ga0495629_0000131 3300046459 Bacteria 65274
222 Ga0495638_0000129 3300046460 Bacteria 123549
223 Ga0495638_0000163 3300046460 Bacteria 103363
224 Ga0495638_0046061 3300046460 Bacteria 2741
225 Ga0495653_0000110 3300046463 Bacteria 68799
226 Ga0495653_0009746 3300046463 Bacteria 7855
227 Ga0495650_0001340 3300046471 Bacteria 24528
228 Ga0495650_0001356 3300046471 Bacteria 24315
229 Ga0495650_0025673 3300046471 Bacteria 2755
230 Ga0495580_0003084 3300046472 Bacteria 14276
231 Ga0495582_0019489 3300046473 Bacteria 3709
232 Ga0495605_0000790 3300046474 Bacteria 22729
233 Ga0495605_0001903 3300046474 Bacteria 13308
234 Ga0495605_0052114 3300046474 Bacteria 1989
235 Ga0495584_0000517 3300046491 Bacteria 26319
236 Ga0495584_0003139 3300046491 Bacteria 9179
237 Ga0495584_0018419 3300046491 Bacteria 3549
238 Ga0495585_0000283 3300046492 Bacteria 50893
239 Ga0495585_0001302 3300046492 Bacteria 19904
240 Ga0495585_0020176 3300046492 Bacteria 3835
241 Ga0495585_0021200 3300046492 Bacteria 3733
242 Ga0495585_0050057 3300046492 Bacteria 2318
243 Ga0495596_0000876 3300046500 Bacteria 18144
244 Ga0495596_0020539 3300046500 Bacteria 2703
245 Ga0495596_0040202 3300046500 Bacteria 1846
246 Ga0495607_0000021 3300046501 Bacteria 164571
247 Ga0495607_0005001 3300046501 Bacteria 9618
248 Ga0495607_0016893 3300046501 Bacteria 4698
249 Ga0495607_0018192 3300046501 Bacteria 4486
250 Ga0495583_0001424 3300046506 Bacteria 24362
251 Ga0495583_0009518 3300046506 Bacteria 5794
252 Ga0495583_0025577 3300046506 Bacteria 2946
253 Ga0495583_0062018 3300046506 Bacteria 1666
254 Ga0495606_0000421 3300046507 Bacteria 70842
255 Ga0495606_0191932 3300046507 Bacteria 1170
256 Ga0495610_0013173 3300046512 Bacteria 4926
257 Ga0495610_0048013 3300046512 Bacteria 2097
258 Ga0495616_0006786 3300046513 Bacteria 6900
259 Ga0495616_0006880 3300046513 Bacteria 6847
260 Ga0495620_0014489 3300046515 Bacteria 4006
261 Ga0495620_0059236 3300046515 Bacteria 1601
262 Ga0495628_0002410 3300046516 Bacteria 16862
263 Ga0495630_0032332 3300046517 Bacteria 3898
264 Ga0495631_0086726 3300046518 Bacteria 1348
265 Ga0495632_0000229 3300046519 Bacteria 56776
266 Ga0495632_0003134 3300046519 Bacteria 11957
267 Ga0495632_0005181 3300046519 Bacteria 8696
268 Ga0495632_0015557 3300046519 Bacteria 4259
269 Ga0495632_0021728 3300046519 Bacteria 3453
270 Ga0495637_0001388 3300046520 Bacteria 14467
271 Ga0495637_0002621 3300046520 Bacteria 9865
272 Ga0495643_0004168 3300046522 Bacteria 10267
273 Ga0495643_0010338 3300046522 Bacteria 5745
274 Ga0495644_0000248 3300046523 Bacteria 25155
275 Ga0495644_0031417 3300046523 Bacteria 2006
276 Ga0495644_0036155 3300046523 Bacteria 1863
277 Ga0495648_0002059 3300046524 Bacteria 19033
278 Ga0495648_0080664 3300046524 Bacteria 1853
279 Ga0495648_0146777 3300046524 Bacteria 1235
280 Ga0495642_0000024 3300046528 Bacteria 92899
281 Ga0495642_0001197 3300046528 Bacteria 11940
282 Ga0495654_0004143 3300046530 Bacteria 8696
283 Ga0495654_0005836 3300046530 Bacteria 7087
284 Ga0495654_0010039 3300046530 Bacteria 5169
285 Ga0495654_0052383 3300046530 Bacteria 1987
286 Ga0495654_0106488 3300046530 Bacteria 1284
287 Ga0495587_0011494 3300046536 Bacteria 5607
288 Ga0495609_0012039 3300046538 Bacteria 4107
289 Ga0495597_0000087 3300046542 Bacteria 81275
290 Ga0495597_0011499 3300046542 Bacteria 4290
291 Ga0495597_0013662 3300046542 Bacteria 3884
292 Ga0495645_0039747 3300046543 Bacteria 3430
293 Ga0495645_0063533 3300046543 Bacteria 2672
294 Ga0495622_0002201 3300046557 Bacteria 9507
295 Ga0495656_0003448 3300046615 Bacteria 5346
296 Ga0495668_0004657 3300046616 Bacteria 9630
297 Ga0495634_0091774 3300046642 Bacteria 1971
298 Ga0495611_0000967 3300046648 Bacteria 15310
299 Ga0495611_0065802 3300046648 Bacteria 1652
300 Ga0495625_0001843 3300046660 Bacteria 24209
301 Ga0495625_0004068 3300046660 Bacteria 13972
302 Ga0495625_0013786 3300046660 Bacteria 6479
303 Ga0495635_0084994 3300046663 Bacteria 2165
304 Ga0495659_0004103 3300046664 Bacteria 4599
305 Ga0495661_0000013 3300046665 Bacteria 259387
306 Ga0495588_0107541 3300046674 Bacteria 1468
307 Ga0495623_0007956 3300046679 Bacteria 6891
308 Ga0495623_0071871 3300046679 Bacteria 2152
309 Ga0495646_0035256 3300046680 Bacteria 3104
310 Ga0495658_0059223 3300046683 Bacteria 2192
311 Ga0495658_0065593 3300046683 Bacteria 2095
312 Ga0495669_0000568 3300046684 Bacteria 16328
313 Ga0495669_0012052 3300046684 Bacteria 3675
314 Ga0495669_0037723 3300046684 Bacteria 2139
315 Ga0495613_0228101 3300046689 Bacteria 1306
316 Ga0495624_0004662 3300046690 Bacteria 9981
317 Ga0495670_0004932 3300046691 Bacteria 6554
318 Ga0495670_0009461 3300046691 Bacteria 4790
319 Ga0495670_0013015 3300046691 Bacteria 4091
320 Ga0495670_0078157 3300046691 Bacteria 1683
321 Ga0495671_0000995 3300046692 Bacteria 19753
322 Ga0495671_0002467 3300046692 Bacteria 11674
323 Ga0495671_0044243 3300046692 Bacteria 2233
324 Ga0495671_0092893 3300046692 Bacteria 1476
325 Ga0495649_0000412 3300046694 Bacteria 37157
326 Ga0495649_0000637 3300046694 Bacteria 28551
327 Ga0495649_0001602 3300046694 Bacteria 16874
328 Ga0495649_0016231 3300046694 Bacteria 4223
329 Ga0495649_0213375 3300046694 Bacteria 1000
330 Ga0495589_0000774 3300046794 Bacteria 20341
331 Ga0495589_0014859 3300046794 Bacteria 4005
332 Ga0495589_0016529 3300046794 Bacteria 3792
333 Ga0495589_0016861 3300046794 Bacteria 3750
334 Ga0495600_0003625 3300046809 Bacteria 9104
335 Ga0495660_0004264 3300046810 Bacteria 8674
336 Ga0495660_0004950 3300046810 Bacteria 8022
337 Ga0495660_0016432 3300046810 Bacteria 4267
338 Ga0495660_0023656 3300046810 Bacteria 3504
339 Ga0495660_0073243 3300046810 Bacteria 1812
340 Ga0495581_0000960 3300047315 Bacteria 15486
341 Ga0495672_0007650 3300047320 Bacteria 8104
342 Ga0495672_0014016 3300047320 Bacteria 5509
343 Ga0495672_0054614 3300047320 Bacteria 2333
344 Ga0495676_0027229 3300047321 Bacteria 4905
345 Ga0495680_0001202 3300047322 Bacteria 28406
346 Ga0495680_0003258 3300047322 Bacteria 16118
347 Ga0495680_0010186 3300047322 Bacteria 8398
348 Ga0495680_0110575 3300047322 Bacteria 2036
349 Ga0495683_0003792 3300047323 Bacteria 8723
350 Ga0495683_0006472 3300047323 Bacteria 6401
351 Ga0495683_0023169 3300047323 Bacteria 3192
352 Ga0495683_0043265 3300047323 Bacteria 2268
353 Ga0495683_0045977 3300047323 Bacteria 2191
354 Ga0495687_031474 3300047443 Bacteria 2433
355 Ga0495675_0001160 3300047444 Bacteria 15989
356 Ga0495675_0063139 3300047444 Bacteria 2344
357 Ga0495677_0002281 3300047445 Bacteria 7564
358 Ga0495679_032664 3300047446 Bacteria 1667
359 Ga0495679_037916 3300047446 Bacteria 1513
360 Ga0495685_006742 3300047447 Bacteria 3773
361 Ga0495673_0015526 3300047469 Bacteria 3922
362 Ga0495673_0020707 3300047469 Bacteria 3268
363 Ga0495673_0044004 3300047469 Bacteria 1993
364 Ga0495681_0007412 3300047470 Bacteria 7013
365 Ga0495681_0055665 3300047470 Bacteria 1843
366 Ga0495681_0070021 3300047470 Bacteria 1592
367 Ga0495686_0000045 3300047472 Bacteria 284761
368 Ga0495686_0075378 3300047472 Bacteria 2069
369 Ga0495593_0002097 3300047673 Bacteria 11937
370 Ga0495593_0002305 3300047673 Bacteria 11449
371 Ga0495593_0017702 3300047673 Bacteria 4011
372 Ga0495614_0089265 3300048089 Bacteria 1340
373 Ga0495626_0060515 3300048091 Bacteria 1725
374 Ga0496100_0004410 3300048903 Bacteria 7456
375 Ga0496100_0006158 3300048903 Bacteria 6526
376 Ga0496101_0004224 3300048904 Bacteria 9005
377 Ga0496101_0025760 3300048904 Bacteria 4083
378 Ga0496101_0093954 3300048904 Bacteria 2234
379 Ga0496102_0014822 3300048905 Bacteria 6779
380 Ga0496102_0025839 3300048905 Bacteria 5230
381 Ga0496102_0078191 3300048905 Bacteria 3045
382 Ga0496102_0100425 3300048905 Bacteria 2687
383 Ga0496103_0010732 3300048906 Bacteria 5420
384 Ga0496104_0002548 3300048907 Bacteria 15702
385 Ga0496104_0032031 3300048907 Bacteria 4893
386 Ga0496104_0112044 3300048907 Bacteria 2616
387 Ga0496105_0007903 3300048908 Bacteria 8261
388 Ga0496105_0025926 3300048908 Bacteria 4776
389 Ga0496105_0054299 3300048908 Bacteria 3308
390 Ga0496105_0234822 3300048908 Bacteria 1489
391 Ga0496106_0006261 3300048909 Bacteria 8810
392 Ga0496106_0166502 3300048909 Bacteria 1745
393 Ga0496107_0005634 3300048910 Bacteria 8577
394 Ga0496110_0029915 3300048913 Bacteria 4693
395 Ga0496110_0050478 3300048913 Bacteria 3652
396 Ga0496110_0202129 3300048913 Bacteria 1805
397 Ga0496111_0007158 3300048914 Bacteria 7290
398 Ga0496111_0063328 3300048914 Bacteria 2682
399 Ga0496111_0113421 3300048914 Bacteria 1997
400 Ga0496112_0032470 3300048915 Bacteria 5069
401 Ga0496112_0343842 3300048915 Bacteria 1435
402 Ga0496113_0008848 3300048916 Bacteria 6581
403 Ga0496113_0010853 3300048916 Bacteria 6046
404 Ga0496114_0004014 3300048917 Bacteria 11374
405 Ga0496116_0007831 3300048919 Bacteria 9384
406 Ga0496116_0007962 3300048919 Bacteria 9283
407 Ga0496116_0020976 3300048919 Bacteria 4941
408 Ga0496116_0041603 3300048919 Bacteria 3151
409 Ga0496116_0117759 3300048919 Bacteria 1545
410 Ga0496117_0011794 3300048920 Bacteria 7784
411 Ga0496117_0023641 3300048920 Bacteria 4889
412 Ga0496118_0019324 3300048921 Bacteria 6094
413 Ga0496118_0056854 3300048921 Bacteria 2937
414 Ga0496119_0009017 3300048922 Bacteria 8653
415 Ga0496120_0011277 3300048923 Bacteria 6157
416 Ga0496121_0000478 3300048924 Bacteria 77761
417 Ga0496121_0002169 3300048924 Bacteria 30728
418 Ga0496121_0003781 3300048924 Bacteria 21129
419 Ga0496121_0009279 3300048924 Bacteria 11348
420 Ga0496121_0015635 3300048924 Bacteria 7921
421 Ga0496121_0031960 3300048924 Bacteria 4797
422 Ga0496121_0039492 3300048924 Bacteria 4157
423 Ga0496121_0154606 3300048924 Bacteria 1684
424 Ga0496122_0000748 3300048925 Bacteria 63291
425 Ga0496122_0001544 3300048925 Bacteria 36564
426 Ga0496122_0016770 3300048925 Bacteria 6901
427 Ga0496122_0032085 3300048925 Bacteria 4351
428 Ga0496123_0000432 3300048926 Bacteria 75431
429 Ga0496123_0001196 3300048926 Bacteria 38152
430 Ga0496123_0016224 3300048926 Bacteria 6061
431 Ga0496123_0016506 3300048926 Bacteria 5993
432 Ga0496123_0037366 3300048926 Bacteria 3429
433 Ga0496123_0074480 3300048926 Bacteria 2101
434 Ga0496124_0000004 3300048927 Bacteria 976131
435 Ga0496124_0013134 3300048927 Bacteria 8107
436 Ga0496124_0014294 3300048927 Bacteria 7682
437 Ga0496124_0081505 3300048927 Bacteria 2659
438 Ga0496124_0276013 3300048927 Bacteria 1228
439 Ga0496125_0000146 3300048928 Bacteria 154919
440 Ga0496125_0006650 3300048928 Bacteria 12443
441 Ga0496125_0007191 3300048928 Bacteria 11869
442 Ga0496125_0024108 3300048928 Bacteria 5602
443 Ga0496125_0034410 3300048928 Bacteria 4466
444 Ga0496125_0053276 3300048928 Bacteria 3318
445 Ga0496125_0056608 3300048928 Bacteria 3183
446 Ga0496126_0018095 3300048929 Bacteria 6997
447 Ga0496126_0057911 3300048929 Bacteria 3495
448 Ga0496126_0079915 3300048929 Bacteria 2894
449 Ga0496126_0113381 3300048929 Bacteria 2360
450 Ga0495678_004938 3300049459 Bacteria 7526
451 Ga0495678_006919 3300049459 Bacteria 5952
452 Ga0501034_0000353 3300049571 Bacteria 79342
453 nmdc:mga03683_16844_c1 3300050489 Bacteria 2755
454 nmdc:mga03683_20885_c1 3300050489 Bacteria 2517
455 nmdc:mga00v17_91962_c1 3300050491 Bacteria 1906
456 nmdc:mga0yw44_4186_c1 3300050492 Bacteria 6247
457 nmdc:mga0k408_41768_c1 3300050493 Bacteria 2641
458 nmdc:mga06z11_4960_c1 3300050494 Bacteria 2409
459 nmdc:mga07m45_80102_c1 3300050496 Bacteria 1865
460 nmdc:mga07m45_8294_c1 3300050496 Bacteria 5334
461 Ga0500610_0000927 3300053079 Bacteria 9478
462 Ga0500578_0000086 3300053086 Bacteria 103107
463 Ga0500643_004909 3300053087 Bacteria 5889
464 Ga0500651_0000338 3300053093 Bacteria 26429
465 Ga0500566_0089066 3300053094 Bacteria 1707
466 Ga0500557_000312 3300053105 Bacteria 6465
467 Ga0500569_000738 3300053109 Bacteria 5700
468 Ga0500571_000087 3300053110 Bacteria 29151
469 Ga0500593_000084 3300053117 Bacteria 34222
470 Ga0500593_000441 3300053117 Bacteria 16355
471 Ga0500593_001716 3300053117 Bacteria 7914
472 Ga0500597_086192 3300053120 Bacteria 1363
473 Ga0500607_003436 3300053121 Bacteria 11607
474 Ga0500618_000790 3300053125 Bacteria 17674
475 Ga0500618_005721 3300053125 Bacteria 3745
476 Ga0500655_001139 3300053133 Bacteria 5062
477 Ga0500658_0001092 3300053134 Bacteria 11096
478 Ga0500658_0001599 3300053134 Bacteria 9053
479 Ga0500659_0002710 3300053135 Bacteria 10595
480 Ga0500568_0000587 3300053139 Bacteria 26463
481 Ga0500616_0000308 3300053153 Bacteria 70261
482 Ga0500616_0001233 3300053153 Bacteria 25673
483 Ga0500616_0006911 3300053153 Bacteria 7319
484 Ga0500634_0009930 3300053161 Bacteria 4842
485 Ga0500634_0027305 3300053161 Bacteria 3110
486 Ga0500636_0034147 3300053177 Bacteria 3011
487 2511132226 2510917022 Bacteria 6504556
488 2511169760 2510917026 Bacteria 7046020
489 2511183908 2510917028 Bacteria 6185411
490 2511249039 2511231003 Bacteria 5606035
491 2511280457 2511231008 Bacteria 6624100
492 2511353906 2511231021 Bacteria 7302637
493 2511390974 2511231027 Bacteria 5013807
494 2513589772 2513237087 Bacteria 5817514
495 2513867214 2513237138 Bacteria 7368160
496 2513924051 2513237146 Bacteria 7166346
497 2548498690 2547132374 Bacteria 5530232
498 2550696000 2548876994 Bacteria 4904866
499 2585204694 2582581294 Bacteria 6626667
500 2585334464 2582581316 Bacteria 7774528
501 2585402603 2582581867 Bacteria 7184437
502 2585560958 2585427531 Bacteria 6992870
503 2585820472 2585427590 Bacteria 6824633
504 2585899833 2585427608 Bacteria 6544331
505 2585908455 2585427609 Bacteria 6667127
506 2587729422 2585428057 Bacteria 6737412
507 2587754930 2585428062 Bacteria 6842168
508 2587983509 2585428125 Bacteria 6662905
509 2588293052 2588253510 Bacteria 6901809
510 2599416095 2599185170 Bacteria 7295545
511 2616557503 2615840698 Bacteria 7319877
512 2617385280 2617270742 Bacteria 6808054
513 2644237777 2643221643 Bacteria 5749658
514 2644649422 2643221717 Bacteria 5676132
515 2753459220 2751185821 Bacteria 6189929
516 2770200212 2767802442 Bacteria 5747986
517 2774118941 2773857670 Bacteria 6407454
518 2776268751 2775506902 Bacteria 6208009
519 2776285131 2775506904 Bacteria 5954060
520 2784312580 2784132072 Bacteria 6596533
521 2809143189 2808606418 Bacteria 6724496
522 2819593500 2818991445 Bacteria 4955017
523 2819614405 2818991449 Bacteria 5518009
524 2838036217 2838035591 Bacteria 7166484
525 2838666487 2838661181 Bacteria 7385261
526 2840770426 2840764183 Bacteria 6358399
527 2842874302 2842871566 Bacteria 4827117
528 2850083620 2850079185 Bacteria 6848280
529 2857545623 2857542790 Bacteria 5326616
530 2857576839 2857576091 Bacteria 5465855
531 2858950816 2858950400 Bacteria 6783797
532 2884816523 2884811622 Bacteria 5552861
533 2884837729 2884836552 Bacteria 5219991
534 2884854021 2884852848 Bacteria 5221161
535 2894656872 2894652903 Bacteria 4587256
536 2896154862 2896154374 Bacteria 5221518
537 2904439101 2904434214 Bacteria 6230908
538 2904479847 2904479285 Bacteria 5073931
539 2904534065 2904530477 Bacteria 5876334
540 2904583673 2904578770 Bacteria 5302906
541 2904589094 2904584206 Bacteria 6028872
542 2904590424 2904589729 Bacteria 6113573
543 2904603707 2904601388 Bacteria 5884906
544 2919046786 2919046199 Bacteria 5567169
545 2919080287 2919079590 Bacteria 5946433
546 2919124814 2919119836 Bacteria 5208557
547 2919126894 2919125081 Bacteria 5385106
548 2919413497 2919408235 Bacteria 6149349
549 2920762031 2920760137 Bacteria 7427611
550 2928084309 2928084124 Bacteria 7159212
551 2928131481 2928130867 Bacteria 5467269
552 2933020363 2933016740 Bacteria 6355406
553 2941485587
554 2954011631 2954011201 Bacteria 4762601
555 8005486451 8005484373 Bacteria 6297373
556 8005685638 8005682033 Bacteria 6726518
557 8018153858 8018150411 Bacteria 5549903
558 8057576224 8057575449 Bacteria 7367519
559 Ga0495649_0043583
560 JGI24740J21852_10000424
561 JGI25155J39150_1000432
562 JGI25155J39150_1000469
563 JGI25156J39149_1001147
564 JGI25156J39149_1001292
565 JGI25162J39368_1000356
566 JGI25154J39366_1000961
567 JGI25154J39366_1001064
568 JGI25157J39369_1000990
569 JGI25152J39213_1003697
570 JGI25152J39213_1008691
571 JGI25159J45721_1002018
572 JGI25151J46595_10000625
573 JGI25165J46597_1000450
574 JGI25160J50197_1000018
575 JGI25161J50226_1000020
576 Ga0055538_1000002
577 Ga0055539_1000002
578 Ga0055533_1000004
579 Ga0055532_1000102
580 Ga0055525_1000002
581 Ga0055535_1003187
582 Ga0055526_1025242
583 Ga0055526_1029305
584 Ga0055528_1000273
585 Ga0055528_1013773
586 Ga0055540_1026204
587 Ga0055541_1000002
588 Ga0058692_1000144
589 Ga0055543_1000004
590 Ga0065165_1000429
591 Ga0065165_1004320
592 Ga0065714_10000082
593 Ga0065714_10087023
594 Ga0065714_10098195
595 Ga0065712_10020728
596 Ga0070668_100337278
597 Ga0070671_100062170
598 Ga0070671_100212534
599 Ga0070659_100025112
600 Ga0070667_100012256
601 Ga0070663_100068038
602 Ga0070678_100018058
603 Ga0068867_100116053
604 Ga0070706_100012987
605 Ga0070707_100217118
606 Ga0068853_100050351
607 Ga0070665_100092444
608 Ga0068855_100109586
609 Ga0068854_100026272
610 Ga0068852_100061870
611 Ga0068859_100063973
612 Ga0068861_100210297
613 Ga0068863_100060151
614 Ga0068860_100208581
615 Ga0075365_10006192
616 Ga0075365_10037936
617 Ga0075368_10020547
618 Ga0075363_100007382
619 Ga0075362_10033262
620 Ga0075362_10038201
621 Ga0075367_10000621
622 Ga0075369_10000377
623 Ga0075369_10019565
624 Ga0075366_10064282
625 Ga0075370_10012137
626 Ga0097620_100063974
627 Ga0105251_10000101
628 Ga0105251_10000114
629 Ga0105251_10000659
630 Ga0105251_10000900
631 Ga0105251_10002850
632 Ga0105251_10039735
633 Ga0105244_10064484
634 Ga0105250_10000268
635 Ga0105240_10006815
636 Ga0105240_10040183
637 Ga0105240_10063805
638 Ga0105240_10185576
639 Ga0105243_10108888
640 Ga0105242_10120114
641 Ga0105242_10336382
642 Ga0105248_10511151
643 Ga0105237_10000564
644 Ga0105238_10019161
645 Ga0105249_10242913
646 Ga0123342_1020141
647 Ga0105239_10005868
648 Ga0105239_10018822
649 Ga0157370_10009041
650 Ga0157374_10112930
651 Ga0163162_10000665
652 Ga0163162_10042896
653 Ga0163162_10075638
654 Ga0163162_10382762
655 Ga0157375_10210765
656 Ga0157375_10223087
657 Ga0163163_10368378
658 Ga0157379_10016569
659 Ga0182006_1002816
660 Ga0182006_1007399
661 Ga0182007_10007393
662 Ga0163161_10015863
663 Ga0163161_10044079
664 Ga0163161_10092736
665 Ga0213872_10031309
666 Ga0209435_100030
667 Ga0209435_100134
668 Ga0209784_100002
669 Ga0209566_100003
670 Ga0209674_100004
671 Ga0209147_100159
672 Ga0209563_100006
673 Ga0209437_100286
674 Ga0209437_100317
675 Ga0209258_100259
676 Ga0209646_1000057
677 Ga0209646_1000100
678 Ga0209026_1000091
679 Ga0209677_100003
680 Ga0209148_1005591
681 Ga0209759_1000084
682 Ga0209759_1000141
683 Ga0209129_1000182
684 Ga0209129_1003600
685 Ga0209233_1000249
686 Ga0209455_1008345
687 Ga0209673_1000691
688 Ga0209673_1010739
689 Ga0209130_1000035
690 Ga0209025_1000461
691 Ga0209564_1002222
692 Ga0209564_1015018
693 Ga0209758_1029740
694 Ga0209256_1000648
695 Ga0207426_1000017
696 Ga0207426_1000851
697 Ga0207426_1001839
698 Ga0209051_1000932
699 Ga0209051_1005930
700 Ga0209051_1006880
701 Ga0207696_1000020
702 Ga0207655_1021552
703 Ga0207655_1030571
704 Ga0207713_1000032
705 Ga0207713_1000200
706 Ga0207713_1003128
707 Ga0207713_1021002
708 Ga0207647_10143723
709 Ga0207684_10015012
710 Ga0207695_10005698
711 Ga0207695_10060576
712 Ga0207695_10080303
713 Ga0207671_10006250
714 Ga0207694_10026948
715 Ga0207706_10036995
716 Ga0207706_10215203
717 Ga0207709_10045430
718 Ga0207665_10154329
719 Ga0207658_10008255
720 Ga0207678_10072977
721 Ga0207648_10020423
722 Ga0207674_10078966
723 Ga0207683_10031236
724 Ga0207698_10044170
725 Ga0207698_10119392
726 Ga0209371_1000001
727 Ga0209371_1018037
728 Ga0268264_10163972
729 Ga0307517_10151891
730 Ga0307515_10000492
731 Ga0307515_10000571
732 Ga0307515_10105341
733 Ga0307515_10132008
734 Ga0268256_1000001
735 Ga0268256_1020125
736 Ga0307513_10013229
737 Ga0307513_10123405
738 Ga0307513_10132353
739 Ga0307513_10232792
740 Ga0307509_10000654
741 Ga0307509_10008448
742 Ga0307514_10000708
743 Ga0307516_10006124
744 Ga0307516_10053150
745 Ga0307405_10268844
746 Ga0307412_10010053
747 Ga0307412_10046935
748 Ga0307510_10001775
749 Ga0307510_10040139
750 Ga0395905_0027725
751 Ga0436361_0163520
752 Ga0436361_0456842
753 Ga0439465_0004220
754 Ga0451795_1074212
755 Ga0439451_020130
756 Ga0450911_000247
757 Ga0450902_000035
758 Ga0450902_000345
759 Ga0450903_001670
760 Ga0450905_000968
761 Ga0451577_0029453
762 Ga0451577_0292037
763 Ga0453683_0237437
764 Ga0466965_0064287
765 Ga0466960_0038620
766 Ga0466967_0109771
767 Ga0495617_004568
768 Ga0495617_026767
769 Ga0495603_0000130
770 Ga0495603_0000827
771 Ga0495603_0011081
772 Ga0495603_0030596
773 Ga0495590_0002504
774 Ga0495590_0013638
775 Ga0495591_000453
776 Ga0495591_006075
777 Ga0495591_007180
778 Ga0495591_049239
779 Ga0495629_0000131
780 Ga0495638_0000129
781 Ga0495638_0000163
782 Ga0495638_0046061
783 Ga0495653_0000110
784 Ga0495653_0009746
785 Ga0495650_0001340
786 Ga0495650_0001356
787 Ga0495650_0025673
788 Ga0495580_0003084
789 Ga0495582_0019489
790 Ga0495605_0000790
791 Ga0495605_0001903
792 Ga0495605_0052114
793 Ga0495584_0000517
794 Ga0495584_0003139
795 Ga0495584_0018419
796 Ga0495585_0000283
797 Ga0495585_0001302
798 Ga0495585_0020176
799 Ga0495585_0021200
800 Ga0495585_0050057
801 Ga0495596_0000876
802 Ga0495596_0020539
803 Ga0495596_0040202
804 Ga0495607_0000021
805 Ga0495607_0005001
806 Ga0495607_0016893
807 Ga0495607_0018192
808 Ga0495583_0001424
809 Ga0495583_0009518
810 Ga0495583_0025577
811 Ga0495583_0062018
812 Ga0495606_0000421
813 Ga0495606_0191932
814 Ga0495610_0013173
815 Ga0495610_0048013
816 Ga0495616_0006786
817 Ga0495616_0006880
818 Ga0495620_0014489
819 Ga0495620_0059236
820 Ga0495628_0002410
821 Ga0495630_0032332
822 Ga0495631_0086726
823 Ga0495632_0000229
824 Ga0495632_0003134
825 Ga0495632_0005181
826 Ga0495632_0015557
827 Ga0495632_0021728
828 Ga0495637_0001388
829 Ga0495637_0002621
830 Ga0495643_0004168
831 Ga0495643_0010338
832 Ga0495644_0000248
833 Ga0495644_0031417
834 Ga0495644_0036155
835 Ga0495648_0002059
836 Ga0495648_0080664
837 Ga0495648_0146777
838 Ga0495642_0000024
839 Ga0495642_0001197
840 Ga0495654_0004143
841 Ga0495654_0005836
842 Ga0495654_0010039
843 Ga0495654_0052383
844 Ga0495654_0106488
845 Ga0495587_0011494
846 Ga0495609_0012039
847 Ga0495597_0000087
848 Ga0495597_0011499
849 Ga0495597_0013662
850 Ga0495645_0039747
851 Ga0495645_0063533
852 Ga0495622_0002201
853 Ga0495656_0003448
854 Ga0495668_0004657
855 Ga0495634_0091774
856 Ga0495611_0000967
857 Ga0495611_0065802
858 Ga0495625_0001843
859 Ga0495625_0004068
860 Ga0495625_0013786
861 Ga0495635_0084994
862 Ga0495659_0004103
863 Ga0495661_0000013
864 Ga0495588_0107541
865 Ga0495623_0007956
866 Ga0495623_0071871
867 Ga0495646_0035256
868 Ga0495658_0059223
869 Ga0495658_0065593
870 Ga0495669_0000568
871 Ga0495669_0012052
872 Ga0495669_0037723
873 Ga0495613_0228101
874 Ga0495624_0004662
875 Ga0495670_0004932
876 Ga0495670_0009461
877 Ga0495670_0013015
878 Ga0495670_0078157
879 Ga0495671_0000995
880 Ga0495671_0002467
881 Ga0495671_0044243
882 Ga0495671_0092893
883 Ga0495649_0000412
884 Ga0495649_0000637
885 Ga0495649_0001602
886 Ga0495649_0016231
887 Ga0495649_0213375
888 Ga0495589_0000774
889 Ga0495589_0014859
890 Ga0495589_0016529
891 Ga0495589_0016861
892 Ga0495600_0003625
893 Ga0495660_0004264
894 Ga0495660_0004950
895 Ga0495660_0016432
896 Ga0495660_0023656
897 Ga0495660_0073243
898 Ga0495581_0000960
899 Ga0495672_0007650
900 Ga0495672_0014016
901 Ga0495672_0054614
902 Ga0495676_0027229
903 Ga0495680_0001202
904 Ga0495680_0003258
905 Ga0495680_0010186
906 Ga0495680_0110575
907 Ga0495683_0003792
908 Ga0495683_0006472
909 Ga0495683_0023169
910 Ga0495683_0043265
911 Ga0495683_0045977
912 Ga0495687_031474
913 Ga0495675_0001160
914 Ga0495675_0063139
915 Ga0495677_0002281
916 Ga0495679_032664
917 Ga0495679_037916
918 Ga0495685_006742
919 Ga0495673_0015526
920 Ga0495673_0020707
921 Ga0495673_0044004
922 Ga0495681_0007412
923 Ga0495681_0055665
924 Ga0495681_0070021
925 Ga0495686_0000045
926 Ga0495686_0075378
927 Ga0495593_0002097
928 Ga0495593_0002305
929 Ga0495593_0017702
930 Ga0495614_0089265
931 Ga0495626_0060515
932 Ga0496100_0004410
933 Ga0496100_0006158
934 Ga0496101_0004224
935 Ga0496101_0025760
936 Ga0496101_0093954
937 Ga0496102_0014822
938 Ga0496102_0025839
939 Ga0496102_0078191
940 Ga0496102_0100425
941 Ga0496103_0010732
942 Ga0496104_0002548
943 Ga0496104_0032031
944 Ga0496104_0112044
945 Ga0496105_0007903
946 Ga0496105_0025926
947 Ga0496105_0054299
948 Ga0496105_0234822
949 Ga0496106_0006261
950 Ga0496106_0166502
951 Ga0496107_0005634
952 Ga0496110_0029915
953 Ga0496110_0050478
954 Ga0496110_0202129
955 Ga0496111_0007158
956 Ga0496111_0063328
957 Ga0496111_0113421
958 Ga0496112_0032470
959 Ga0496112_0343842
960 Ga0496113_0008848
961 Ga0496113_0010853
962 Ga0496114_0004014
963 Ga0496116_0007831
964 Ga0496116_0007962
965 Ga0496116_0020976
966 Ga0496116_0041603
967 Ga0496116_0117759
968 Ga0496117_0011794
969 Ga0496117_0023641
970 Ga0496118_0019324
971 Ga0496118_0056854
972 Ga0496119_0009017
973 Ga0496120_0011277
974 Ga0496121_0000478
975 Ga0496121_0002169
976 Ga0496121_0003781
977 Ga0496121_0009279
978 Ga0496121_0015635
979 Ga0496121_0031960
980 Ga0496121_0039492
981 Ga0496121_0154606
982 Ga0496122_0000748
983 Ga0496122_0001544
984 Ga0496122_0016770
985 Ga0496122_0032085
986 Ga0496123_0000432
987 Ga0496123_0001196
988 Ga0496123_0016224
989 Ga0496123_0016506
990 Ga0496123_0037366
991 Ga0496123_0074480
992 Ga0496124_0000004
993 Ga0496124_0013134
994 Ga0496124_0014294
995 Ga0496124_0081505
996 Ga0496124_0276013
997 Ga0496125_0000146
998 Ga0496125_0006650
999 Ga0496125_0007191
1000 Ga0496125_0024108
1001 Ga0496125_0034410
1002 Ga0496125_0053276
1003 Ga0496125_0056608
1004 Ga0496126_0018095
1005 Ga0496126_0057911
1006 Ga0496126_0079915
1007 Ga0496126_0113381
1008 Ga0495678_004938
1009 Ga0495678_006919
1010 Ga0501034_0000353
1011 nmdc:mga03683_16844_c1
1012 nmdc:mga03683_20885_c1
1013 nmdc:mga00v17_91962_c1
1014 nmdc:mga0yw44_4186_c1
1015 nmdc:mga0k408_41768_c1
1016 nmdc:mga06z11_4960_c1
1017 nmdc:mga07m45_80102_c1
1018 nmdc:mga07m45_8294_c1
1019 Ga0500610_0000927
1020 Ga0500578_0000086
1021 Ga0500643_004909
1022 Ga0500651_0000338
1023 Ga0500566_0089066
1024 Ga0500557_000312
1025 Ga0500569_000738
1026 Ga0500571_000087
1027 Ga0500593_000084
1028 Ga0500593_000441
1029 Ga0500593_001716
1030 Ga0500597_086192
1031 Ga0500607_003436
1032 Ga0500618_000790
1033 Ga0500618_005721
1034 Ga0500655_001139
1035 Ga0500658_0001092
1036 Ga0500658_0001599
1037 Ga0500659_0002710
1038 Ga0500568_0000587
1039 Ga0500616_0000308
1040 Ga0500616_0001233
1041 Ga0500616_0006911
1042 Ga0500634_0009930
1043 Ga0500634_0027305
1044 Ga0500636_0034147
1045 2511132226
1046 2511169760
1047 2511183908
1048 2511249039
1049 2511280457
1050 2511353906
1051 2511390974
1052 2513589772
1053 2513867214
1054 2513924051
1055 2548498690
1056 2550696000
1057 2585204694
1058 2585334464
1059 2585402603
1060 2585560958
1061 2585820472
1062 2585899833
1063 2585908455
1064 2587729422
1065 2587754930
1066 2587983509
1067 2588293052
1068 2599416095
1069 2616557503
1070 2617385280
1071 2644237777
1072 2644649422
1073 2753459220
1074 2770200212
1075 2774118941
1076 2776268751
1077 2776285131
1078 2784312580
1079 2809143189
1080 2819593500
1081 2819614405
1082 2838036217
1083 2838666487
1084 2840770426
1085 2842874302
1086 2850083620
1087 2857545623
1088 2857576839
1089 2858950816
1090 2884816523
1091 2884837729
1092 2884854021
1093 2894656872
1094 2896154862
1095 2904439101
1096 2904479847
1097 2904534065
1098 2904583673
1099 2904589094
1100 2904590424
1101 2904603707
1102 2919046786
1103 2919080287
1104 2919124814
1105 2919126894
1106 2919413497
1107 2920762031
1108 2928084309
1109 2928131481
1110 2933020363
1111 2941485587
1112 2954011631
1113 8005486451
1114 8005685638
1115 8018153858
1116 8057576224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

60

256

0.88

PF13379

NMT1_2

NMT1-like family

48

265

0.84

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

70

245

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uif-assembly1.cif.gz_A crystal structure of putative sulfonate abc transporter, periplasmic sulfonate-binding protein ssua from methylobacillus flagellatus kt 0.8845 28 350
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8656 28 330
3uif-assembly1.cif.gz_A crystal structure of putative sulfonate abc transporter, periplasmic sulfonate-binding protein ssua from methylobacillus flagellatus kt 0.8647 28 350
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8546 28 330
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8175 29 327
ID Description Score Start End Superfamily
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.959 124 224 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9411 124 224 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9204 126 218 3.40.190.10
3uifA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8847 28 350 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8646 125 213 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1I4IA24-F1-model_v4 Sulfonate transport system substrate-binding protein 0.9536 232 358
AF-A0A561L3T3-F1-model_v4 deleted 0.9524 24 358
AF-A0A561L3T3-F1-model_v4 deleted 0.9469 24 358
AF-A0A3S0YIY9-F1-model_v4 deleted 0.9425 23 336
AF-A0A7K1PMB1-F1-model_v4 deleted 0.9371 1 358

Map