F463603

General Info

Members Datasets Scaffolds Average Seq Length
559 289 1118 544

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0000586|Ga0496109_0000586_2668_4419
Length 583
Sequence LGRCGRRFCSFGTVPAARLRLGRLVIGAFAKPLRTRTIRSMSSTDSGTGERLTIAPIVGPEDPRHFTDSGIEIDRLYTEANLPADLEERTGEPGDYPYTRGPHAEMYRSQLWTMRQYAGYASAKESNERYKYLLSKGSTGLSIAFDLPTQLGLDSDDPRCLGEVGRTGVAIDTIDDMRTAFDSIPLDSVSTSMTINAPATVLLMLYQLVGEEQGVDSTKLRGTVQNDILKEYIARGNYIYPPEASMRLTTDLFAYCKEYIPKWNTVSISGYHFREKGCSAVQEVAFTLSSGIAYAQAAVDAGLDIDSFAPRLAFFFNGHNNVFQEVAKFRAARRMWAKIMKERFGAKDPKSMKLRFHTQTGGVTLTAQQPQNNIVRVALQGFAAVCGGTQSLHTNGFDEALALPTEEAAKIALRTQQIIGYESGATDTVDPFAGSYFVESLTDEIESRALELIAKVDDIGGSTKAIEFITNEIDESAWGYNERYRLEQDVVVGVNKFVEEELEVPDLLRVDPASEAAQLERLKAFKENRDQELVAKRLEELRTAAKGTDNLVPFIREALRDRASMGEVCGAMKDVFGPYRPTF

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
281 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
282 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
283 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
284 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
285 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 11.63
Rhizosphere 80.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0000586 3300048912 Bacteria 30472
2 JGI24740J21852_10008494 3300001979 Bacteria 4091
3 JGI25407J50210_10003650 3300003373 Bacteria 3702
4 JGI25407J50210_10008497 3300003373 Bacteria 2589
5 Ga0070683_100003193 3300005329 Bacteria 13232
6 Ga0070683_100004798 3300005329 Bacteria 11188
7 Ga0070683_100150755 3300005329 Bacteria 2204
8 Ga0070677_10000034 3300005333 Bacteria 41098
9 Ga0070666_10005154 3300005335 Bacteria 8000
10 Ga0070680_100037623 3300005336 Bacteria 3910
11 Ga0070682_100013775 3300005337 Bacteria 4662
12 Ga0068868_100000618 3300005338 Bacteria 23920
13 Ga0070691_10001789 3300005341 Bacteria 9344
14 Ga0070661_100000045 3300005344 Bacteria 94702
15 Ga0070668_100027585 3300005347 Bacteria 4311
16 Ga0070669_100005063 3300005353 Bacteria 9528
17 Ga0070675_100000780 3300005354 Bacteria 22294
18 Ga0070675_100048366 3300005354 Bacteria 3487
19 Ga0070674_100000011 3300005356 Bacteria 134886
20 Ga0070674_100000014 3300005356 Bacteria 100122
21 Ga0070674_100029340 3300005356 Bacteria 3622
22 Ga0070659_100000003 3300005366 Bacteria 309142
23 Ga0070659_100006573 3300005366 Bacteria 8394
24 Ga0070667_100015639 3300005367 Bacteria 6274
25 Ga0070714_100000783 3300005435 Bacteria 22565
26 Ga0070714_100020922 3300005435 Bacteria 5348
27 Ga0070714_100081078 3300005435 Bacteria 2824
28 Ga0070713_100000038 3300005436 Bacteria 85290
29 Ga0070710_10000001 3300005437 Bacteria 552187
30 Ga0070710_10046397 3300005437 Bacteria 2419
31 Ga0070711_100020148 3300005439 Bacteria 4292
32 Ga0070705_100000715 3300005440 Bacteria 18892
33 Ga0070708_100064574 3300005445 Bacteria 3280
34 Ga0070662_100000008 3300005457 Bacteria 168754
35 Ga0070662_100025137 3300005457 Bacteria 4109
36 Ga0070681_10005220 3300005458 Bacteria 12544
37 Ga0070706_100005523 3300005467 Bacteria 12034
38 Ga0070707_100038422 3300005468 Bacteria 4572
39 Ga0070699_100000349 3300005518 Bacteria 44808
40 Ga0070699_100070581 3300005518 Bacteria 3037
41 Ga0070679_100000658 3300005530 Bacteria 29449
42 Ga0070679_100013491 3300005530 Bacteria 7826
43 Ga0070679_100043015 3300005530 Bacteria 4499
44 Ga0070684_100003066 3300005535 Bacteria 12474
45 Ga0070684_100038550 3300005535 Bacteria 4105
46 Ga0070697_100019293 3300005536 Bacteria 5386
47 Ga0068853_100008801 3300005539 Bacteria 8119
48 Ga0068853_100077374 3300005539 Bacteria 2906
49 Ga0070672_100000003 3300005543 Bacteria 159532
50 Ga0070665_100000690 3300005548 Bacteria 45099
51 Ga0070665_100008769 3300005548 Bacteria 10236
52 Ga0070665_100107683 3300005548 Bacteria 2789
53 Ga0068856_100016712 3300005614 Bacteria 7108
54 Ga0068852_100000007 3300005616 Bacteria 158670
55 Ga0068852_100065965 3300005616 Bacteria 3160
56 Ga0068864_100000208 3300005618 Bacteria 52720
57 Ga0068866_10000002 3300005718 Bacteria 394090
58 Ga0068866_10000478 3300005718 Bacteria 18325
59 Ga0068851_10001120 3300005834 Bacteria 11606
60 Ga0068851_10010456 3300005834 Bacteria 4334
61 Ga0068863_100000042 3300005841 Bacteria 154459
62 Ga0068863_100002461 3300005841 Bacteria 18399
63 Ga0068858_100000155 3300005842 Bacteria 72794
64 Ga0068862_100000590 3300005844 Bacteria 37737
65 Ga0081455_10014015 3300005937 Bacteria 7879
66 Ga0081455_10045473 3300005937 Bacteria 3819
67 Ga0081455_10048054 3300005937 Bacteria 3690
68 Ga0081538_10000028 3300005981 Bacteria 124690
69 Ga0081538_10000058 3300005981 Bacteria 102121
70 Ga0081538_10000137 3300005981 Bacteria 75608
71 Ga0081538_10000296 3300005981 Bacteria 57287
72 Ga0081538_10001452 3300005981 Bacteria 24361
73 Ga0081538_10001465 3300005981 Bacteria 24226
74 Ga0081538_10003891 3300005981 Bacteria 13944
75 Ga0081538_10010268 3300005981 Bacteria 7691
76 Ga0081538_10023549 3300005981 Bacteria 4422
77 Ga0081540_1000126 3300005983 Bacteria 81203
78 Ga0081540_1003069 3300005983 Bacteria 13380
79 Ga0081540_1003294 3300005983 Bacteria 12811
80 Ga0081539_10002384 3300005985 Bacteria 26816
81 Ga0081539_10006352 3300005985 Bacteria 11384
82 Ga0070717_10000005 3300006028 Bacteria 357819
83 Ga0070717_10016682 3300006028 Bacteria 5699
84 Ga0070717_10222143 3300006028 Bacteria 1661
85 Ga0075365_10000775 3300006038 Bacteria 13018
86 Ga0075365_10021265 3300006038 Bacteria 4044
87 Ga0075365_10055853 3300006038 Bacteria 2623
88 Ga0075364_10035886 3300006051 Bacteria 3204
89 Ga0075364_10075014 3300006051 Bacteria 2231
90 Ga0070712_100000172 3300006175 Bacteria 35623
91 Ga0070712_100014604 3300006175 Bacteria 5041
92 Ga0070712_100105962 3300006175 Bacteria 2089
93 Ga0075430_100031248 3300006846 Bacteria 4519
94 Ga0075430_100033483 3300006846 Bacteria 4361
95 Ga0075430_100093340 3300006846 Bacteria 2516
96 Ga0075430_100122441 3300006846 Bacteria 2168
97 Ga0075431_100052231 3300006847 Bacteria 4214
98 Ga0075431_100120234 3300006847 Bacteria 2710
99 Ga0075433_10001381 3300006852 Bacteria 17859
100 Ga0075433_10001478 3300006852 Bacteria 17346
101 Ga0075433_10028520 3300006852 Bacteria 4746
102 Ga0075429_100090212 3300006880 Bacteria 2673
103 Ga0068865_100013206 3300006881 Bacteria 5214
104 Ga0075436_100013848 3300006914 Bacteria 5523
105 Ga0105240_10008169 3300009093 Bacteria 15007
106 Ga0105240_10181855 3300009093 Bacteria 2480
107 Ga0105240_10218967 3300009093 Bacteria 2219
108 Ga0111539_10143288 3300009094 Bacteria 2797
109 Ga0105245_10000585 3300009098 Bacteria 33073
110 Ga0105245_10001540 3300009098 Bacteria 20906
111 Ga0105245_10029454 3300009098 Bacteria 4850
112 Ga0105247_10000208 3300009101 Bacteria 56889
113 Ga0114129_10004531 3300009147 Bacteria 19614
114 Ga0114129_10012136 3300009147 Bacteria 12266
115 Ga0105242_10000239 3300009176 Bacteria 43273
116 Ga0105242_10000975 3300009176 Bacteria 22368
117 Ga0105237_10032576 3300009545 Bacteria 5276
118 Ga0105238_10000051 3300009551 Bacteria 141705
119 Ga0105249_10000085 3300009553 Bacteria 133497
120 Ga0105249_10005283 3300009553 Bacteria 11149
121 Ga0105249_10049532 3300009553 Bacteria 3831
122 Ga0105239_10077037 3300010375 Bacteria 3669
123 Ga0105239_10135369 3300010375 Bacteria 2743
124 Ga0157369_10000173 3300013105 Bacteria 90860
125 Ga0157369_10007562 3300013105 Bacteria 12502
126 Ga0157372_10074490 3300013307 Bacteria 3828
127 Ga0157375_10010005 3300013308 Bacteria 8337
128 Ga0157375_10061652 3300013308 Bacteria 3724
129 Ga0157380_10000017 3300014326 Bacteria 119468
130 Ga0157380_10000072 3300014326 Bacteria 56363
131 Ga0157379_10028049 3300014968 Bacteria 5011
132 Ga0163161_10000173 3300017792 Bacteria 59103
133 Ga0213874_10013016 3300021377 Bacteria 2146
134 Ga0213876_10036468 3300021384 Bacteria 2593
135 Ga0213876_10043163 3300021384 Bacteria 2383
136 Ga0213876_10070034 3300021384 Bacteria 1853
137 Ga0213875_10000146 3300021388 Bacteria 75051
138 Ga0213875_10013661 3300021388 Bacteria 3979
139 Ga0213875_10047212 3300021388 Bacteria 2020
140 Ga0207656_10000068 3300025321 Bacteria 39207
141 Ga0207656_10010442 3300025321 Bacteria 3480
142 Ga0207682_10000488 3300025893 Bacteria 18303
143 Ga0207692_10000007 3300025898 Bacteria 233250
144 Ga0207642_10000001 3300025899 Bacteria 714030
145 Ga0207642_10000003 3300025899 Bacteria 650651
146 Ga0207642_10000049 3300025899 Bacteria 34592
147 Ga0207710_10000620 3300025900 Bacteria 20642
148 Ga0207688_10027284 3300025901 Bacteria 3141
149 Ga0207685_10000001 3300025905 Bacteria 604473
150 Ga0207684_10001232 3300025910 Bacteria 28435
151 Ga0207684_10006542 3300025910 Bacteria 10613
152 Ga0207707_10026419 3300025912 Bacteria 5075
153 Ga0207695_10008917 3300025913 Bacteria 12487
154 Ga0207695_10049964 3300025913 Bacteria 4402
155 Ga0207671_10007363 3300025914 Bacteria 9559
156 Ga0207693_10000185 3300025915 Bacteria 56784
157 Ga0207693_10004835 3300025915 Bacteria 11335
158 Ga0207693_10009617 3300025915 Bacteria 7872
159 Ga0207693_10046330 3300025915 Bacteria 3416
160 Ga0207663_10005527 3300025916 Bacteria 6375
161 Ga0207657_10070396 3300025919 Bacteria 2965
162 Ga0207649_10000021 3300025920 Bacteria 209660
163 Ga0207652_10000150 3300025921 Bacteria 75189
164 Ga0207652_10002609 3300025921 Bacteria 15140
165 Ga0207652_10178113 3300025921 Bacteria 1910
166 Ga0207646_10002039 3300025922 Bacteria 24260
167 Ga0207646_10012381 3300025922 Bacteria 8203
168 Ga0207646_10027347 3300025922 Bacteria 5202
169 Ga0207681_10014867 3300025923 Bacteria 4847
170 Ga0207694_10000035 3300025924 Bacteria 195870
171 Ga0207659_10000074 3300025926 Bacteria 63348
172 Ga0207687_10000021 3300025927 Bacteria 226396
173 Ga0207687_10000027 3300025927 Bacteria 168505
174 Ga0207700_10000013 3300025928 Bacteria 230462
175 Ga0207700_10066346 3300025928 Bacteria 2758
176 Ga0207664_10000035 3300025929 Bacteria 173780
177 Ga0207664_10016640 3300025929 Bacteria 5370
178 Ga0207690_10000021 3300025932 Bacteria 217710
179 Ga0207706_10000016 3300025933 Bacteria 170697
180 Ga0207706_10030440 3300025933 Bacteria 4814
181 Ga0207706_10131876 3300025933 Bacteria 2198
182 Ga0207686_10000016 3300025934 Bacteria 198779
183 Ga0207686_10005526 3300025934 Bacteria 6778
184 Ga0207669_10000007 3300025937 Bacteria 169904
185 Ga0207669_10000027 3300025937 Bacteria 91216
186 Ga0207704_10000029 3300025938 Bacteria 120526
187 Ga0207665_10099497 3300025939 Bacteria 2028
188 Ga0207691_10000005 3300025940 Bacteria 163117
189 Ga0207711_10000019 3300025941 Bacteria 412779
190 Ga0207661_10000983 3300025944 Bacteria 18831
191 Ga0207661_10004769 3300025944 Bacteria 9492
192 Ga0207661_10033729 3300025944 Bacteria 3975
193 Ga0207661_10145474 3300025944 Bacteria 2044
194 Ga0207651_10007189 3300025960 Bacteria 5916
195 Ga0207712_10000033 3300025961 Bacteria 209336
196 Ga0207712_10007222 3300025961 Bacteria 7005
197 Ga0207712_10020390 3300025961 Bacteria 4340
198 Ga0207712_10081626 3300025961 Bacteria 2355
199 Ga0207668_10017236 3300025972 Bacteria 4521
200 Ga0207640_10000367 3300025981 Bacteria 29333
201 Ga0207658_10011416 3300025986 Bacteria 6046
202 Ga0207677_10000225 3300026023 Bacteria 44520
203 Ga0207677_10006121 3300026023 Bacteria 6570
204 Ga0207703_10000072 3300026035 Bacteria 120727
205 Ga0207703_10000861 3300026035 Bacteria 29699
206 Ga0207639_10004807 3300026041 Bacteria 9115
207 Ga0207678_10003823 3300026067 Bacteria 13545
208 Ga0207708_10034873 3300026075 Bacteria 3828
209 Ga0207702_10116348 3300026078 Bacteria 2386
210 Ga0207641_10000066 3300026088 Bacteria 155638
211 Ga0207641_10003308 3300026088 Bacteria 14333
212 Ga0207676_10000197 3300026095 Bacteria 52737
213 Ga0207675_100009863 3300026118 Bacteria 8933
214 Ga0207698_10000002 3300026142 Bacteria 404991
215 Ga0268266_10000076 3300028379 Bacteria 217644
216 Ga0268266_10003280 3300028379 Bacteria 16280
217 Ga0268266_10058209 3300028379 Bacteria 3327
218 Ga0268265_10004945 3300028380 Bacteria 9160
219 Ga0268264_10038311 3300028381 Bacteria 3956
220 Ga0265337_1000004 3300028556 Bacteria 106708
221 Ga0265337_1003519 3300028556 Bacteria 6764
222 Ga0265326_10000071 3300028558 Bacteria 57770
223 Ga0265326_10000088 3300028558 Bacteria 48958
224 Ga0265326_10000538 3300028558 Bacteria 14355
225 Ga0265319_1000029 3300028563 Bacteria 131291
226 Ga0265319_1000769 3300028563 Bacteria 20833
227 Ga0265319_1006395 3300028563 Bacteria 5464
228 Ga0265318_10006440 3300028577 Bacteria 5408
229 Ga0265322_10000006 3300028654 Bacteria 231685
230 Ga0265336_10000019 3300028666 Bacteria 218636
231 Ga0265336_10002286 3300028666 Bacteria 8006
232 Ga0265338_10000179 3300028800 Bacteria 117995
233 Ga0265338_10000272 3300028800 Bacteria 94567
234 Ga0265324_10000713 3300029957 Bacteria 22085
235 Ga0265324_10002871 3300029957 Bacteria 8475
236 Ga0265324_10008146 3300029957 Bacteria 4189
237 Ga0265328_10003113 3300031239 Bacteria 7401
238 Ga0265320_10000001 3300031240 Bacteria 847191
239 Ga0265325_10006193 3300031241 Bacteria 7296
240 Ga0265329_10002947 3300031242 Bacteria 7572
241 Ga0265340_10000004 3300031247 Bacteria 218649
242 Ga0265331_10000513 3300031250 Bacteria 36313
243 Ga0265327_10000003 3300031251 Bacteria 852750
244 Ga0265316_10008842 3300031344 Bacteria 9302
245 Ga0265314_10000535 3300031711 Bacteria 49105
246 Ga0307410_10015837 3300031852 Bacteria 4481
247 Ga0307409_100045715 3300031995 Bacteria 3308
248 Ga0307409_100141562 3300031995 Bacteria 2073
249 Ga0307416_100197716 3300032002 Bacteria 1904
250 Ga0307416_100203380 3300032002 Bacteria 1881
251 Ga0373954_0058721 3300035118 Bacteria 1813
252 Ga0373937_0027352 3300036401 Bacteria 5157
253 Ga0373925_0029025 3300037068 Bacteria 4057
254 Ga0395899_0048542 3300037312 Bacteria 3159
255 Ga0395900_0081417 3300037418 Bacteria 3326
256 Ga0395898_0008873 3300037466 Bacteria 10592
257 Ga0395905_0003280 3300037471 Bacteria 17376
258 Ga0395905_0063717 3300037471 Bacteria 3449
259 Ga0436364_0251195 3300037853 Bacteria 6558
260 Ga0436364_0534390 3300037853 Bacteria 5740
261 Ga0436364_0942527 3300037853 Bacteria 46992
262 Ga0436364_1036550 3300037853 Bacteria 14878
263 Ga0436364_1559580 3300037853 Bacteria 8861
264 Ga0395901_0015078 3300038443 Bacteria 7860
265 Ga0436365_0398469 3300039437 Bacteria 9838
266 Ga0436365_0689271 3300039437 Bacteria 11971
267 Ga0436365_0869438 3300039437 Bacteria 7351
268 Ga0436365_0958174 3300039437 Bacteria 3611
269 Ga0436365_0968347 3300039437 Bacteria 4671
270 Ga0436365_1363106 3300039437 Bacteria 5322
271 Ga0436365_1661798 3300039437 Bacteria 2942
272 Ga0436365_1673300 3300039437 Bacteria 7544
273 Ga0436363_0919101 3300039450 Bacteria 21832
274 Ga0436363_1210547 3300039450 Bacteria 8044
275 Ga0436362_0083769 3300039453 Bacteria 2347
276 Ga0451833_0314658 3300041491 Bacteria 1723
277 Ga0439448_0002045 3300042005 Bacteria 5407
278 Ga0466969_0014768 3300044656 Bacteria 4103
279 Ga0466965_0017097 3300044683 Bacteria 3462
280 Ga0466961_0007777 3300044693 Bacteria 6822
281 Ga0466961_0009306 3300044693 Bacteria 6256
282 Ga0466961_0011693 3300044693 Bacteria 5610
283 Ga0466963_0000034 3300044694 Bacteria 44604
284 Ga0466963_0001411 3300044694 Bacteria 12910
285 Ga0466963_0004582 3300044694 Bacteria 8045
286 Ga0466963_0015950 3300044694 Bacteria 4663
287 Ga0466963_0031267 3300044694 Bacteria 3440
288 Ga0466963_0053192 3300044694 Bacteria 2688
289 Ga0466964_0033532 3300044706 Bacteria 2046
290 Ga0466971_0002541 3300044719 Bacteria 7715
291 Ga0466968_0010968 3300044735 Bacteria 3522
292 Ga0466957_0000907 3300044842 Bacteria 15155
293 Ga0466960_0000339 3300044901 Bacteria 15960
294 Ga0466960_0018984 3300044901 Bacteria 3022
295 Ga0466959_0003612 3300045049 Bacteria 10197
296 Ga0466959_0013135 3300045049 Bacteria 5998
297 Ga0466959_0036571 3300045049 Bacteria 3628
298 Ga0466959_0037743 3300045049 Bacteria 3570
299 Ga0466959_0049763 3300045049 Bacteria 3078
300 Ga0466958_0001144 3300045836 Bacteria 12286
301 Ga0466958_0002530 3300045836 Bacteria 9214
302 Ga0466958_0007750 3300045836 Bacteria 5923
303 Ga0466958_0008886 3300045836 Bacteria 5580
304 Ga0466958_0010409 3300045836 Bacteria 5208
305 Ga0466958_0021808 3300045836 Bacteria 3746
306 Ga0466958_0062678 3300045836 Bacteria 2267
307 Ga0466967_0000818 3300045976 Bacteria 16339
308 Ga0466967_0002230 3300045976 Bacteria 11934
309 Ga0466967_0007189 3300045976 Bacteria 7996
310 Ga0466967_0122268 3300045976 Bacteria 2407
311 Ga0495592_0000638 3300046454 Bacteria 24306
312 Ga0495592_0034629 3300046454 Bacteria 3806
313 Ga0495603_0000045 3300046455 Bacteria 53543
314 Ga0495603_0000783 3300046455 Bacteria 18136
315 Ga0495603_0004367 3300046455 Bacteria 8431
316 Ga0495629_0000746 3300046459 Bacteria 26275
317 Ga0495629_0017020 3300046459 Bacteria 5216
318 Ga0495629_0130013 3300046459 Bacteria 1754
319 Ga0495638_0063659 3300046460 Bacteria 2273
320 Ga0495641_0000001 3300046461 Bacteria 485224
321 Ga0495641_0027382 3300046461 Bacteria 2772
322 Ga0495641_0030226 3300046461 Bacteria 2601
323 Ga0495651_0095338 3300046462 Bacteria 2225
324 Ga0495653_0000576 3300046463 Bacteria 28174
325 Ga0495650_0000012 3300046471 Bacteria 613144
326 Ga0495582_0000022 3300046473 Bacteria 83315
327 Ga0495662_0001515 3300046476 Bacteria 11527
328 Ga0495662_0001572 3300046476 Bacteria 11362
329 Ga0495662_0033626 3300046476 Bacteria 2477
330 Ga0495664_0000133 3300046477 Bacteria 37867
331 Ga0495594_0000005 3300046499 Bacteria 175437
332 Ga0495606_0000131 3300046507 Bacteria 127298
333 Ga0495608_0000021 3300046511 Bacteria 168462
334 Ga0495608_0000517 3300046511 Bacteria 26493
335 Ga0495608_0019722 3300046511 Bacteria 4637
336 Ga0495618_0000004 3300046514 Bacteria 245690
337 Ga0495618_0000023 3300046514 Bacteria 123643
338 Ga0495618_0021554 3300046514 Bacteria 3974
339 Ga0495620_0000325 3300046515 Bacteria 33527
340 Ga0495628_0000194 3300046516 Bacteria 53139
341 Ga0495628_0073625 3300046516 Bacteria 2661
342 Ga0495630_0000416 3300046517 Bacteria 32826
343 Ga0495630_0000540 3300046517 Bacteria 27715
344 Ga0495630_0004180 3300046517 Bacteria 10108
345 Ga0495644_0000121 3300046523 Bacteria 37231
346 Ga0495652_0000022 3300046529 Bacteria 178368
347 Ga0495652_0042497 3300046529 Bacteria 3919
348 Ga0495640_0002167 3300046533 Bacteria 15693
349 Ga0495640_0016229 3300046533 Bacteria 5576
350 Ga0495586_0001413 3300046535 Bacteria 13291
351 Ga0495621_0001176 3300046539 Bacteria 6765
352 Ga0495645_0000043 3300046543 Bacteria 91036
353 Ga0495645_0008305 3300046543 Bacteria 7246
354 Ga0495645_0009603 3300046543 Bacteria 6766
355 Ga0495622_0000026 3300046557 Bacteria 137934
356 Ga0495667_0000044 3300046559 Bacteria 121910
357 Ga0495667_0001992 3300046559 Bacteria 13531
358 Ga0495667_0032057 3300046559 Bacteria 3524
359 Ga0495634_0001214 3300046642 Bacteria 23764
360 Ga0495625_0000095 3300046660 Bacteria 143468
361 Ga0495635_0000063 3300046663 Bacteria 65304
362 Ga0495588_0000262 3300046674 Bacteria 42637
363 Ga0495657_0000019 3300046675 Bacteria 168441
364 Ga0495657_0000021 3300046675 Bacteria 153590
365 Ga0495657_0003376 3300046675 Bacteria 13056
366 Ga0495657_0044519 3300046675 Bacteria 3019
367 Ga0495646_0007783 3300046680 Bacteria 6806
368 Ga0495646_0071323 3300046680 Bacteria 2044
369 Ga0495647_0000003 3300046681 Bacteria 145235
370 Ga0495647_0000160 3300046681 Bacteria 17444
371 Ga0495658_0000008 3300046683 Bacteria 115426
372 Ga0495658_0001910 3300046683 Bacteria 10637
373 Ga0495669_0000473 3300046684 Bacteria 18704
374 Ga0495613_0001030 3300046689 Bacteria 21257
375 Ga0495613_0001034 3300046689 Bacteria 21223
376 Ga0495624_0000305 3300046690 Bacteria 38658
377 Ga0495624_0003319 3300046690 Bacteria 11978
378 Ga0495649_0001488 3300046694 Bacteria 17602
379 Ga0495600_0004722 3300046809 Bacteria 8178
380 Ga0495600_0058117 3300046809 Bacteria 2526
381 Ga0495604_0000033 3300047317 Bacteria 134810
382 Ga0495604_0000329 3300047317 Bacteria 42476
383 Ga0495604_0000813 3300047317 Bacteria 26163
384 Ga0495604_0042786 3300047317 Bacteria 3548
385 Ga0495674_0000108 3300047319 Bacteria 61101
386 Ga0495674_0054079 3300047319 Bacteria 3527
387 Ga0495672_0005838 3300047320 Bacteria 9657
388 Ga0495676_0001148 3300047321 Bacteria 22495
389 Ga0495676_0021410 3300047321 Bacteria 5648
390 Ga0495680_0002055 3300047322 Bacteria 21001
391 Ga0495680_0003667 3300047322 Bacteria 14993
392 Ga0495680_0006304 3300047322 Bacteria 11042
393 Ga0495680_0017860 3300047322 Bacteria 6037
394 Ga0495675_0000047 3300047444 Bacteria 82513
395 Ga0495675_0016044 3300047444 Bacteria 4737
396 Ga0495684_0001445 3300047471 Bacteria 19013
397 Ga0495684_0015105 3300047471 Bacteria 5947
398 Ga0495602_0000008 3300048088 Bacteria 260157
399 Ga0495602_0032495 3300048088 Bacteria 4912
400 Ga0495602_0053321 3300048088 Bacteria 3583
401 Ga0496100_0000003 3300048903 Bacteria 360802
402 Ga0496100_0000063 3300048903 Bacteria 60957
403 Ga0496101_0000003 3300048904 Bacteria 406565
404 Ga0496101_0000012 3300048904 Bacteria 268127
405 Ga0496101_0000699 3300048904 Bacteria 20164
406 Ga0496101_0054382 3300048904 Bacteria 2890
407 Ga0496102_0000061 3300048905 Bacteria 167066
408 Ga0496102_0010621 3300048905 Bacteria 7932
409 Ga0496102_0065252 3300048905 Bacteria 3336
410 Ga0496103_0000044 3300048906 Bacteria 167066
411 Ga0496104_0000007 3300048907 Bacteria 524804
412 Ga0496104_0000066 3300048907 Bacteria 108721
413 Ga0496104_0070701 3300048907 Bacteria 3318
414 Ga0496104_0074093 3300048907 Bacteria 3241
415 Ga0496105_0000002 3300048908 Bacteria 753215
416 Ga0496105_0000020 3300048908 Bacteria 181484
417 Ga0496105_0000110 3300048908 Bacteria 56223
418 Ga0496105_0006970 3300048908 Bacteria 8707
419 Ga0496105_0041213 3300048908 Bacteria 3805
420 Ga0496105_0053908 3300048908 Bacteria 3321
421 Ga0496106_0000015 3300048909 Bacteria 187570
422 Ga0496106_0000020 3300048909 Bacteria 169168
423 Ga0496106_0000147 3300048909 Bacteria 51986
424 Ga0496106_0029705 3300048909 Bacteria 4075
425 Ga0496106_0054408 3300048909 Bacteria 3024
426 Ga0496107_0000008 3300048910 Bacteria 251874
427 Ga0496107_0000014 3300048910 Bacteria 176738
428 Ga0496107_0007096 3300048910 Bacteria 7720
429 Ga0496107_0034868 3300048910 Bacteria 3606
430 Ga0496108_0000002 3300048911 Bacteria 700890
431 Ga0496108_0000025 3300048911 Bacteria 177919
432 Ga0496108_0000351 3300048911 Bacteria 38963
433 Ga0496108_0002731 3300048911 Bacteria 14111
434 Ga0496109_0000001 3300048912 Bacteria 700852
435 Ga0496109_0000025 3300048912 Bacteria 171741
436 Ga0496109_0000103 3300048912 Bacteria 88192
437 Ga0496109_0007245 3300048912 Bacteria 9380
438 Ga0496109_0016362 3300048912 Bacteria 6482
439 Ga0496109_0022515 3300048912 Bacteria 5582
440 Ga0496109_0090295 3300048912 Bacteria 2833
441 Ga0496109_0107554 3300048912 Bacteria 2591
442 Ga0496110_0000003 3300048913 Bacteria 144124
443 Ga0496110_0000034 3300048913 Bacteria 65177
444 Ga0496110_0012513 3300048913 Bacteria 6978
445 Ga0496110_0022366 3300048913 Bacteria 5368
446 Ga0496110_0031136 3300048913 Bacteria 4602
447 Ga0496111_0000007 3300048914 Bacteria 103885
448 Ga0496111_0043659 3300048914 Bacteria 3222
449 Ga0496111_0070765 3300048914 Bacteria 2538
450 Ga0496112_0000003 3300048915 Bacteria 660147
451 Ga0496112_0002890 3300048915 Bacteria 13980
452 Ga0496112_0007041 3300048915 Bacteria 9935
453 Ga0496112_0022915 3300048915 Bacteria 5958
454 Ga0496112_0030313 3300048915 Bacteria 5233
455 Ga0496112_0097031 3300048915 Bacteria 2918
456 Ga0496112_0229822 3300048915 Bacteria 1809
457 Ga0496113_0000019 3300048916 Bacteria 72625
458 Ga0496113_0011334 3300048916 Bacteria 5940
459 Ga0496114_0000010 3300048917 Bacteria 363396
460 Ga0496114_0047470 3300048917 Bacteria 3572
461 Ga0496115_0000053 3300048918 Bacteria 106425
462 Ga0496115_0000082 3300048918 Bacteria 87212
463 Ga0496115_0000270 3300048918 Bacteria 45613
464 Ga0496115_0219946 3300048918 Bacteria 1567
465 Ga0496116_0000383 3300048919 Bacteria 65450
466 Ga0496117_0004822 3300048920 Bacteria 14583
467 Ga0496118_0000151 3300048921 Bacteria 122978
468 Ga0496119_0001491 3300048922 Bacteria 28020
469 Ga0496120_0002107 3300048923 Bacteria 21303
470 Ga0496121_0006267 3300048924 Bacteria 14881
471 Ga0496121_0024519 3300048924 Bacteria 5765
472 Ga0501031_0003529 3300049568 Bacteria 10038
473 Ga0501032_0006366 3300049569 Bacteria 8702
474 Ga0501033_0000714 3300049570 Bacteria 30480
475 Ga0501034_0006870 3300049571 Bacteria 12167
476 Ga0501034_0023948 3300049571 Bacteria 6213
477 Ga0501036_0005945 3300049572 Bacteria 9889
478 Ga0501036_0160911 3300049572 Bacteria 1893
479 Ga0501037_0004508 3300049573 Bacteria 10122
480 Ga0501038_0000681 3300049574 Bacteria 30246
481 Ga0501039_0020547 3300049575 Bacteria 5061
482 Ga0501040_0024281 3300049576 Bacteria 4067
483 Ga0501040_0026913 3300049576 Bacteria 3869
484 Ga0501043_0005753 3300049579 Bacteria 9988
485 Ga0501046_0006461 3300049580 Bacteria 10370
486 Ga0501047_0000063 3300049581 Bacteria 136761
487 Ga0501047_0174684 3300049581 Bacteria 2016
488 Ga0501048_0000390 3300049582 Bacteria 30459
489 Ga0501048_0112630 3300049582 Bacteria 1922
490 Ga0501070_0001914 3300049586 Bacteria 18377
491 Ga0501071_0021968 3300049587 Bacteria 4448
492 Ga0501071_0072311 3300049587 Bacteria 2515
493 Ga0501072_0002015 3300049588 Bacteria 15125
494 Ga0501073_0015719 3300049589 Bacteria 5486
495 Ga0501074_0018555 3300049590 Bacteria 5052
496 Ga0501074_0048315 3300049590 Bacteria 3074
497 Ga0501075_0009302 3300049591 Bacteria 6876
498 Ga0501076_0076283 3300049592 Bacteria 2688
499 Ga0501080_0028682 3300049742 Bacteria 5181
500 Ga0501083_0004350 3300049744 Bacteria 9976
501 Ga0501035_0000963 3300049822 Bacteria 30420
502 Ga0501044_0009798 3300049823 Bacteria 10417
503 Ga0501045_0070055 3300049824 Bacteria 2579
504 nmdc:mga00v17_64674_c1 3300050491 Bacteria 2254
505 nmdc:mga0yw44_17950_c1 3300050492 Bacteria 3864
506 nmdc:mga05p37_191271_c1 3300050507 Bacteria 2484
507 nmdc:mga05p37_75073_c1 3300050507 Bacteria 4161
508 nmdc:mga09592_6709_c1 3300050508 Bacteria 9375
509 nmdc:mga06r32_29294_c1 3300050510 Bacteria 5158
510 nmdc:mga06r32_54285_c1 3300050510 Bacteria 3842
511 nmdc:mga06r32_67999_c1 3300050510 Bacteria 3441
512 nmdc:mga08y16_25598_c1 3300050511 Bacteria 6225
513 nmdc:mga08y16_27703_c1 3300050511 Bacteria 5970
514 nmdc:mga08y16_45511_c1 3300050511 Bacteria 4598
515 nmdc:mga08y16_72890_c1 3300050511 Bacteria 3579
516 nmdc:mga0n895_149922_c1 3300050512 Bacteria 2362
517 nmdc:mga0n895_42197_c1 3300050512 Bacteria 4438
518 nmdc:mga0rr50_59731_c1 3300050513 Bacteria 2864
519 nmdc:mga08x19_26737_c1 3300050514 Bacteria 3602
520 nmdc:mga08x19_81242_c1 3300050514 Bacteria 2128
521 nmdc:mga0a205_108433_c1 3300050515 Bacteria 2675
522 nmdc:mga0a205_1_c1 3300050515 Bacteria 62269
523 nmdc:mga0a205_31936_c1 3300050515 Bacteria 5047
524 nmdc:mga0a205_527_c1 3300050515 Bacteria 25208
525 Ga0495601_0000037 3300053077 Bacteria 81377
526 Ga0495601_0002665 3300053077 Bacteria 10120
527 Ga0495601_0002710 3300053077 Bacteria 10053
528 Ga0495601_0005710 3300053077 Bacteria 7253
529 Ga0495601_0009319 3300053077 Bacteria 5806
530 Ga0495612_0000037 3300053078 Bacteria 64138
531 Ga0495612_0003517 3300053078 Bacteria 6493
532 Ga0495655_0000003 3300053083 Bacteria 303053
533 Ga0495655_0000300 3300053083 Bacteria 8798
534 Ga0495595_0000004 3300053084 Bacteria 260821
535 Ga0495595_0000407 3300053084 Bacteria 16380
536 Ga0495595_0038197 3300053084 Bacteria 2186
537 Ga0495619_0000015 3300053085 Bacteria 252787
538 Ga0495619_0000038 3300053085 Bacteria 121365
539 Ga0495619_0000525 3300053085 Bacteria 25392
540 Ga0495619_0001428 3300053085 Bacteria 15706
541 Ga0495619_0003181 3300053085 Bacteria 10640
542 Ga0495619_0004008 3300053085 Bacteria 9442
543 Ga0495619_0012803 3300053085 Bacteria 5282
544 Ga0495619_0035229 3300053085 Bacteria 3255
545 Ga0500566_0042801 3300053094 Bacteria 2611
546 Ga0500641_0002846 3300053096 Bacteria 6134
547 Ga0500556_0000471 3300053104 Bacteria 28323
548 Ga0500614_001286 3300053123 Bacteria 6068
549 Ga0500628_000002 3300053129 Bacteria 357687
550 Ga0500599_004134 3300053736 Bacteria 1790
551 Ga0501084_0009218 3300054114 Bacteria 8163
552 Ga0501084_0011368 3300054114 Bacteria 7373
553 Ga0501084_0058143 3300054114 Bacteria 3235
554 Ga0501082_0009145 3300060353 Bacteria 8543
555 Ga0466962_0008235 3300061719 Bacteria 4998
556 Ga0466962_0013151 3300061719 Bacteria 3981
557 Ga0466962_0018285 3300061719 Bacteria 3371
558 Ga0530510_0004681 3300061734 Bacteria 9463
559 Ga0530510_0028076 3300061734 Bacteria 4035
560 Ga0496109_0000586
561 JGI24740J21852_10008494
562 JGI25407J50210_10003650
563 JGI25407J50210_10008497
564 Ga0070683_100003193
565 Ga0070683_100004798
566 Ga0070683_100150755
567 Ga0070677_10000034
568 Ga0070666_10005154
569 Ga0070680_100037623
570 Ga0070682_100013775
571 Ga0068868_100000618
572 Ga0070691_10001789
573 Ga0070661_100000045
574 Ga0070668_100027585
575 Ga0070669_100005063
576 Ga0070675_100000780
577 Ga0070675_100048366
578 Ga0070674_100000011
579 Ga0070674_100000014
580 Ga0070674_100029340
581 Ga0070659_100000003
582 Ga0070659_100006573
583 Ga0070667_100015639
584 Ga0070714_100000783
585 Ga0070714_100020922
586 Ga0070714_100081078
587 Ga0070713_100000038
588 Ga0070710_10000001
589 Ga0070710_10046397
590 Ga0070711_100020148
591 Ga0070705_100000715
592 Ga0070708_100064574
593 Ga0070662_100000008
594 Ga0070662_100025137
595 Ga0070681_10005220
596 Ga0070706_100005523
597 Ga0070707_100038422
598 Ga0070699_100000349
599 Ga0070699_100070581
600 Ga0070679_100000658
601 Ga0070679_100013491
602 Ga0070679_100043015
603 Ga0070684_100003066
604 Ga0070684_100038550
605 Ga0070697_100019293
606 Ga0068853_100008801
607 Ga0068853_100077374
608 Ga0070672_100000003
609 Ga0070665_100000690
610 Ga0070665_100008769
611 Ga0070665_100107683
612 Ga0068856_100016712
613 Ga0068852_100000007
614 Ga0068852_100065965
615 Ga0068864_100000208
616 Ga0068866_10000002
617 Ga0068866_10000478
618 Ga0068851_10001120
619 Ga0068851_10010456
620 Ga0068863_100000042
621 Ga0068863_100002461
622 Ga0068858_100000155
623 Ga0068862_100000590
624 Ga0081455_10014015
625 Ga0081455_10045473
626 Ga0081455_10048054
627 Ga0081538_10000028
628 Ga0081538_10000058
629 Ga0081538_10000137
630 Ga0081538_10000296
631 Ga0081538_10001452
632 Ga0081538_10001465
633 Ga0081538_10003891
634 Ga0081538_10010268
635 Ga0081538_10023549
636 Ga0081540_1000126
637 Ga0081540_1003069
638 Ga0081540_1003294
639 Ga0081539_10002384
640 Ga0081539_10006352
641 Ga0070717_10000005
642 Ga0070717_10016682
643 Ga0070717_10222143
644 Ga0075365_10000775
645 Ga0075365_10021265
646 Ga0075365_10055853
647 Ga0075364_10035886
648 Ga0075364_10075014
649 Ga0070712_100000172
650 Ga0070712_100014604
651 Ga0070712_100105962
652 Ga0075430_100031248
653 Ga0075430_100033483
654 Ga0075430_100093340
655 Ga0075430_100122441
656 Ga0075431_100052231
657 Ga0075431_100120234
658 Ga0075433_10001381
659 Ga0075433_10001478
660 Ga0075433_10028520
661 Ga0075429_100090212
662 Ga0068865_100013206
663 Ga0075436_100013848
664 Ga0105240_10008169
665 Ga0105240_10181855
666 Ga0105240_10218967
667 Ga0111539_10143288
668 Ga0105245_10000585
669 Ga0105245_10001540
670 Ga0105245_10029454
671 Ga0105247_10000208
672 Ga0114129_10004531
673 Ga0114129_10012136
674 Ga0105242_10000239
675 Ga0105242_10000975
676 Ga0105237_10032576
677 Ga0105238_10000051
678 Ga0105249_10000085
679 Ga0105249_10005283
680 Ga0105249_10049532
681 Ga0105239_10077037
682 Ga0105239_10135369
683 Ga0157369_10000173
684 Ga0157369_10007562
685 Ga0157372_10074490
686 Ga0157375_10010005
687 Ga0157375_10061652
688 Ga0157380_10000017
689 Ga0157380_10000072
690 Ga0157379_10028049
691 Ga0163161_10000173
692 Ga0213874_10013016
693 Ga0213876_10036468
694 Ga0213876_10043163
695 Ga0213876_10070034
696 Ga0213875_10000146
697 Ga0213875_10013661
698 Ga0213875_10047212
699 Ga0207656_10000068
700 Ga0207656_10010442
701 Ga0207682_10000488
702 Ga0207692_10000007
703 Ga0207642_10000001
704 Ga0207642_10000003
705 Ga0207642_10000049
706 Ga0207710_10000620
707 Ga0207688_10027284
708 Ga0207685_10000001
709 Ga0207684_10001232
710 Ga0207684_10006542
711 Ga0207707_10026419
712 Ga0207695_10008917
713 Ga0207695_10049964
714 Ga0207671_10007363
715 Ga0207693_10000185
716 Ga0207693_10004835
717 Ga0207693_10009617
718 Ga0207693_10046330
719 Ga0207663_10005527
720 Ga0207657_10070396
721 Ga0207649_10000021
722 Ga0207652_10000150
723 Ga0207652_10002609
724 Ga0207652_10178113
725 Ga0207646_10002039
726 Ga0207646_10012381
727 Ga0207646_10027347
728 Ga0207681_10014867
729 Ga0207694_10000035
730 Ga0207659_10000074
731 Ga0207687_10000021
732 Ga0207687_10000027
733 Ga0207700_10000013
734 Ga0207700_10066346
735 Ga0207664_10000035
736 Ga0207664_10016640
737 Ga0207690_10000021
738 Ga0207706_10000016
739 Ga0207706_10030440
740 Ga0207706_10131876
741 Ga0207686_10000016
742 Ga0207686_10005526
743 Ga0207669_10000007
744 Ga0207669_10000027
745 Ga0207704_10000029
746 Ga0207665_10099497
747 Ga0207691_10000005
748 Ga0207711_10000019
749 Ga0207661_10000983
750 Ga0207661_10004769
751 Ga0207661_10033729
752 Ga0207661_10145474
753 Ga0207651_10007189
754 Ga0207712_10000033
755 Ga0207712_10007222
756 Ga0207712_10020390
757 Ga0207712_10081626
758 Ga0207668_10017236
759 Ga0207640_10000367
760 Ga0207658_10011416
761 Ga0207677_10000225
762 Ga0207677_10006121
763 Ga0207703_10000072
764 Ga0207703_10000861
765 Ga0207639_10004807
766 Ga0207678_10003823
767 Ga0207708_10034873
768 Ga0207702_10116348
769 Ga0207641_10000066
770 Ga0207641_10003308
771 Ga0207676_10000197
772 Ga0207675_100009863
773 Ga0207698_10000002
774 Ga0268266_10000076
775 Ga0268266_10003280
776 Ga0268266_10058209
777 Ga0268265_10004945
778 Ga0268264_10038311
779 Ga0265337_1000004
780 Ga0265337_1003519
781 Ga0265326_10000071
782 Ga0265326_10000088
783 Ga0265326_10000538
784 Ga0265319_1000029
785 Ga0265319_1000769
786 Ga0265319_1006395
787 Ga0265318_10006440
788 Ga0265322_10000006
789 Ga0265336_10000019
790 Ga0265336_10002286
791 Ga0265338_10000179
792 Ga0265338_10000272
793 Ga0265324_10000713
794 Ga0265324_10002871
795 Ga0265324_10008146
796 Ga0265328_10003113
797 Ga0265320_10000001
798 Ga0265325_10006193
799 Ga0265329_10002947
800 Ga0265340_10000004
801 Ga0265331_10000513
802 Ga0265327_10000003
803 Ga0265316_10008842
804 Ga0265314_10000535
805 Ga0307410_10015837
806 Ga0307409_100045715
807 Ga0307409_100141562
808 Ga0307416_100197716
809 Ga0307416_100203380
810 Ga0373954_0058721
811 Ga0373937_0027352
812 Ga0373925_0029025
813 Ga0395899_0048542
814 Ga0395900_0081417
815 Ga0395898_0008873
816 Ga0395905_0003280
817 Ga0395905_0063717
818 Ga0436364_0251195
819 Ga0436364_0534390
820 Ga0436364_0942527
821 Ga0436364_1036550
822 Ga0436364_1559580
823 Ga0395901_0015078
824 Ga0436365_0398469
825 Ga0436365_0689271
826 Ga0436365_0869438
827 Ga0436365_0958174
828 Ga0436365_0968347
829 Ga0436365_1363106
830 Ga0436365_1661798
831 Ga0436365_1673300
832 Ga0436363_0919101
833 Ga0436363_1210547
834 Ga0436362_0083769
835 Ga0451833_0314658
836 Ga0439448_0002045
837 Ga0466969_0014768
838 Ga0466965_0017097
839 Ga0466961_0007777
840 Ga0466961_0009306
841 Ga0466961_0011693
842 Ga0466963_0000034
843 Ga0466963_0001411
844 Ga0466963_0004582
845 Ga0466963_0015950
846 Ga0466963_0031267
847 Ga0466963_0053192
848 Ga0466964_0033532
849 Ga0466971_0002541
850 Ga0466968_0010968
851 Ga0466957_0000907
852 Ga0466960_0000339
853 Ga0466960_0018984
854 Ga0466959_0003612
855 Ga0466959_0013135
856 Ga0466959_0036571
857 Ga0466959_0037743
858 Ga0466959_0049763
859 Ga0466958_0001144
860 Ga0466958_0002530
861 Ga0466958_0007750
862 Ga0466958_0008886
863 Ga0466958_0010409
864 Ga0466958_0021808
865 Ga0466958_0062678
866 Ga0466967_0000818
867 Ga0466967_0002230
868 Ga0466967_0007189
869 Ga0466967_0122268
870 Ga0495592_0000638
871 Ga0495592_0034629
872 Ga0495603_0000045
873 Ga0495603_0000783
874 Ga0495603_0004367
875 Ga0495629_0000746
876 Ga0495629_0017020
877 Ga0495629_0130013
878 Ga0495638_0063659
879 Ga0495641_0000001
880 Ga0495641_0027382
881 Ga0495641_0030226
882 Ga0495651_0095338
883 Ga0495653_0000576
884 Ga0495650_0000012
885 Ga0495582_0000022
886 Ga0495662_0001515
887 Ga0495662_0001572
888 Ga0495662_0033626
889 Ga0495664_0000133
890 Ga0495594_0000005
891 Ga0495606_0000131
892 Ga0495608_0000021
893 Ga0495608_0000517
894 Ga0495608_0019722
895 Ga0495618_0000004
896 Ga0495618_0000023
897 Ga0495618_0021554
898 Ga0495620_0000325
899 Ga0495628_0000194
900 Ga0495628_0073625
901 Ga0495630_0000416
902 Ga0495630_0000540
903 Ga0495630_0004180
904 Ga0495644_0000121
905 Ga0495652_0000022
906 Ga0495652_0042497
907 Ga0495640_0002167
908 Ga0495640_0016229
909 Ga0495586_0001413
910 Ga0495621_0001176
911 Ga0495645_0000043
912 Ga0495645_0008305
913 Ga0495645_0009603
914 Ga0495622_0000026
915 Ga0495667_0000044
916 Ga0495667_0001992
917 Ga0495667_0032057
918 Ga0495634_0001214
919 Ga0495625_0000095
920 Ga0495635_0000063
921 Ga0495588_0000262
922 Ga0495657_0000019
923 Ga0495657_0000021
924 Ga0495657_0003376
925 Ga0495657_0044519
926 Ga0495646_0007783
927 Ga0495646_0071323
928 Ga0495647_0000003
929 Ga0495647_0000160
930 Ga0495658_0000008
931 Ga0495658_0001910
932 Ga0495669_0000473
933 Ga0495613_0001030
934 Ga0495613_0001034
935 Ga0495624_0000305
936 Ga0495624_0003319
937 Ga0495649_0001488
938 Ga0495600_0004722
939 Ga0495600_0058117
940 Ga0495604_0000033
941 Ga0495604_0000329
942 Ga0495604_0000813
943 Ga0495604_0042786
944 Ga0495674_0000108
945 Ga0495674_0054079
946 Ga0495672_0005838
947 Ga0495676_0001148
948 Ga0495676_0021410
949 Ga0495680_0002055
950 Ga0495680_0003667
951 Ga0495680_0006304
952 Ga0495680_0017860
953 Ga0495675_0000047
954 Ga0495675_0016044
955 Ga0495684_0001445
956 Ga0495684_0015105
957 Ga0495602_0000008
958 Ga0495602_0032495
959 Ga0495602_0053321
960 Ga0496100_0000003
961 Ga0496100_0000063
962 Ga0496101_0000003
963 Ga0496101_0000012
964 Ga0496101_0000699
965 Ga0496101_0054382
966 Ga0496102_0000061
967 Ga0496102_0010621
968 Ga0496102_0065252
969 Ga0496103_0000044
970 Ga0496104_0000007
971 Ga0496104_0000066
972 Ga0496104_0070701
973 Ga0496104_0074093
974 Ga0496105_0000002
975 Ga0496105_0000020
976 Ga0496105_0000110
977 Ga0496105_0006970
978 Ga0496105_0041213
979 Ga0496105_0053908
980 Ga0496106_0000015
981 Ga0496106_0000020
982 Ga0496106_0000147
983 Ga0496106_0029705
984 Ga0496106_0054408
985 Ga0496107_0000008
986 Ga0496107_0000014
987 Ga0496107_0007096
988 Ga0496107_0034868
989 Ga0496108_0000002
990 Ga0496108_0000025
991 Ga0496108_0000351
992 Ga0496108_0002731
993 Ga0496109_0000001
994 Ga0496109_0000025
995 Ga0496109_0000103
996 Ga0496109_0007245
997 Ga0496109_0016362
998 Ga0496109_0022515
999 Ga0496109_0090295
1000 Ga0496109_0107554
1001 Ga0496110_0000003
1002 Ga0496110_0000034
1003 Ga0496110_0012513
1004 Ga0496110_0022366
1005 Ga0496110_0031136
1006 Ga0496111_0000007
1007 Ga0496111_0043659
1008 Ga0496111_0070765
1009 Ga0496112_0000003
1010 Ga0496112_0002890
1011 Ga0496112_0007041
1012 Ga0496112_0022915
1013 Ga0496112_0030313
1014 Ga0496112_0097031
1015 Ga0496112_0229822
1016 Ga0496113_0000019
1017 Ga0496113_0011334
1018 Ga0496114_0000010
1019 Ga0496114_0047470
1020 Ga0496115_0000053
1021 Ga0496115_0000082
1022 Ga0496115_0000270
1023 Ga0496115_0219946
1024 Ga0496116_0000383
1025 Ga0496117_0004822
1026 Ga0496118_0000151
1027 Ga0496119_0001491
1028 Ga0496120_0002107
1029 Ga0496121_0006267
1030 Ga0496121_0024519
1031 Ga0501031_0003529
1032 Ga0501032_0006366
1033 Ga0501033_0000714
1034 Ga0501034_0006870
1035 Ga0501034_0023948
1036 Ga0501036_0005945
1037 Ga0501036_0160911
1038 Ga0501037_0004508
1039 Ga0501038_0000681
1040 Ga0501039_0020547
1041 Ga0501040_0024281
1042 Ga0501040_0026913
1043 Ga0501043_0005753
1044 Ga0501046_0006461
1045 Ga0501047_0000063
1046 Ga0501047_0174684
1047 Ga0501048_0000390
1048 Ga0501048_0112630
1049 Ga0501070_0001914
1050 Ga0501071_0021968
1051 Ga0501071_0072311
1052 Ga0501072_0002015
1053 Ga0501073_0015719
1054 Ga0501074_0018555
1055 Ga0501074_0048315
1056 Ga0501075_0009302
1057 Ga0501076_0076283
1058 Ga0501080_0028682
1059 Ga0501083_0004350
1060 Ga0501035_0000963
1061 Ga0501044_0009798
1062 Ga0501045_0070055
1063 nmdc:mga00v17_64674_c1
1064 nmdc:mga0yw44_17950_c1
1065 nmdc:mga05p37_191271_c1
1066 nmdc:mga05p37_75073_c1
1067 nmdc:mga09592_6709_c1
1068 nmdc:mga06r32_29294_c1
1069 nmdc:mga06r32_54285_c1
1070 nmdc:mga06r32_67999_c1
1071 nmdc:mga08y16_25598_c1
1072 nmdc:mga08y16_27703_c1
1073 nmdc:mga08y16_45511_c1
1074 nmdc:mga08y16_72890_c1
1075 nmdc:mga0n895_149922_c1
1076 nmdc:mga0n895_42197_c1
1077 nmdc:mga0rr50_59731_c1
1078 nmdc:mga08x19_26737_c1
1079 nmdc:mga08x19_81242_c1
1080 nmdc:mga0a205_108433_c1
1081 nmdc:mga0a205_1_c1
1082 nmdc:mga0a205_31936_c1
1083 nmdc:mga0a205_527_c1
1084 Ga0495601_0000037
1085 Ga0495601_0002665
1086 Ga0495601_0002710
1087 Ga0495601_0005710
1088 Ga0495601_0009319
1089 Ga0495612_0000037
1090 Ga0495612_0003517
1091 Ga0495655_0000003
1092 Ga0495655_0000300
1093 Ga0495595_0000004
1094 Ga0495595_0000407
1095 Ga0495595_0038197
1096 Ga0495619_0000015
1097 Ga0495619_0000038
1098 Ga0495619_0000525
1099 Ga0495619_0001428
1100 Ga0495619_0003181
1101 Ga0495619_0004008
1102 Ga0495619_0012803
1103 Ga0495619_0035229
1104 Ga0500566_0042801
1105 Ga0500641_0002846
1106 Ga0500556_0000471
1107 Ga0500614_001286
1108 Ga0500628_000002
1109 Ga0500599_004134
1110 Ga0501084_0009218
1111 Ga0501084_0011368
1112 Ga0501084_0058143
1113 Ga0501082_0009145
1114 Ga0466962_0008235
1115 Ga0466962_0013151
1116 Ga0466962_0018285
1117 Ga0530510_0004681
1118 Ga0530510_0028076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01642

MM_CoA_mutase

Methylmalonyl-CoA mutase

66

577

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r3u-assembly1.cif.gz_A crystal structure of 2-hydroxyisobutyryl-coa mutase 0.9658 21 540
4r3u-assembly2.cif.gz_B crystal structure of 2-hydroxyisobutyryl-coa mutase 0.965 21 540
6oxd-assembly1.cif.gz_A structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin 0.9605 20 544
2xiq-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa 0.9484 20 545
8gju-assembly1.cif.gz_J crystal structure of human methylmalonyl-coa mutase (mmut) in complex with methylmalonic acidemia type a protein (mmaa), coenzyme a, and gdp 0.9458 20 540
ID Description Score Start End Superfamily
4r3uB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Methylmalonyl-CoA mutase 0.965 21 540 3.20.20.240
af_A4I2L1_6_566_3.20.20.240 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Methylmalonyl-CoA mutase 0.9576 20 545 3.20.20.240
af_A4I2L1_6_566_3.20.20.240 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Methylmalonyl-CoA mutase 0.9232 20 545 3.20.20.240
4r3uB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Methylmalonyl-CoA mutase 0.9199 21 540 3.20.20.240
1reqB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Methylmalonyl-CoA mutase 0.9131 25 470 3.20.20.240
ID Description Score Start End GO Terms
AF-T0ZQD9-F1-model_v4 Methylmalonyl-CoA mutase, large subunit 0.9865 99 255 GO:0016866
GO:0031419
AF-A0A6G2ZFW5-F1-model_v4 deleted 0.9854 70 306
AF-A0A3B9WP84-F1-model_v4 methylmalonyl-CoA mutase (EC 5.4.99.2) 0.9847 85 227 GO:0016866
GO:0031419
AF-A0A6I5GEM0-F1-model_v4 methylmalonyl-CoA mutase (EC 5.4.99.2) 0.9842 100 233 GO:0016866
GO:0031419
AF-A0A3A5VW95-F1-model_v4 Methylmalonyl-CoA mutase 0.9802 116 256 GO:0016866
GO:0031419

Map