metagRoot

F463635

General Info

Members	Datasets	Scaffolds	Average Seq Length
560	384	476	325

Family's Representative Sequence

Representative Sequence	3300001979\|JGI24740J21852_10000001\|JGI24740J21852_1000000130
Length	327
Sequence	MKKTKVIRIHENGGPEVMKLEEADLPPPGAGEVQLRQAAIGLNFIDVYFRSGLYKAPQFPLPLGKEAAGTITEVGPGVIDFAVGDRVAYVGSDGAYSVERNIETRHLVKVPDDITLETAASMMLKGMTAEYLLNRTFKVGPGTTLLFHAAAGGVGLIAGQWAKALGAETVIGTAGSAEKVELALAHGYDHVVDYSKENFAERVREITGGKGVDVVYDSVGKDTFPQSLDCLKPRGMWVTFGQSSGPIENFNLAILNQKGSLFATRPSLFAYVGTPEELRASAKALFAVVQSSKVRINIHQTYPLVDAGRAHADLEARKTSGTTLLIP

Samples

	Sample ID	Description	Type	Environment
1	2508501050	Microvirga lupini Lut6	Isolate	Nodule
2	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
3	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
4	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
5	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
6	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
7	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
8	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
9	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
10	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
11	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
12	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
13	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
14	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
15	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
16	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
17	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
18	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
19	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
20	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
21	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
22	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
23	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
24	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
25	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
26	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
27	2643221550	Mesorhizobium sp. Root552	Isolate	Unclassified
28	2643221564	Mesorhizobium sp. Root157	Isolate	Unclassified
29	2643221623	Aminobacter sp. DSM 101952 Root100	Isolate	Unclassified
30	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
31	2718217882	Rhizobium sp. N741	Isolate	Nodule
32	2718217927	Rhizobium sp. N324	Isolate	Nodule
33	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
34	2718218365	Rhizobium sp. N731	Isolate	Nodule
35	2718218423	Rhizobium sp. N941	Isolate	Nodule
36	2721755809	Rhizobium sp. N541	Isolate	Nodule
37	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
38	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
39	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
40	2791355256	Rhizobium sp. M10	Isolate	Nodule
41	2791355264	Rhizobium sp. S9	Isolate	Nodule
42	2791355267	Rhizobium sp. L18	Isolate	Nodule
43	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
44	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
45	2835312727	Microvirga calopogonii CCBAU 65841	Isolate	Nodule
46	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
47	2837678835	Jiella endophytica CBS5Q-3	Isolate	Unclassified
48	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
49	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
50	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
51	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
52	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
53	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
54	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
55	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
56	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
57	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
58	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
59	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
60	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
61	2842694124	Methylopila sp. R-72369	Isolate	Unclassified
62	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
63	2887375801	Parapusillimonas sp. SGNA-6	Isolate	Rhizosphere
64	2894232714	Microvirga tunisiensis Lmie10	Isolate	Nodule
65	2909042592	Labrys sp. LIt4	Isolate	Nodule
66	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
67	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
68	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
69	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
70	2998344455	Vogesella urethralis SLBN-145	Isolate	Rhizosphere
71	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
72	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
73	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
74	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
75	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
76	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
77	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
78	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
79	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
80	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
81	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
82	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
83	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
84	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
85	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
86	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
87	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
88	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
89	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
90	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
91	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
92	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
93	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
94	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
95	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
96	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
97	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
98	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
99	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
100	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
101	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
102	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
103	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
104	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
105	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
106	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
107	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
108	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
109	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
110	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
111	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
112	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
113	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
114	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
115	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
116	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
117	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
118	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
119	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
120	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
121	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
122	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
123	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
124	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
125	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
126	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
127	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
128	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
129	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
130	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
131	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
132	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
133	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
134	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
135	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
136	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
137	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
138	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
139	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
140	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
141	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
142	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
143	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
144	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
145	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
146	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
147	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
148	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
149	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
150	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
151	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
152	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
153	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
154	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
155	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
156	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
157	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
158	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
159	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
160	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
161	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
162	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
163	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
164	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
165	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
166	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
167	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
168	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
169	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
170	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
171	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
172	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
173	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
174	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
175	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
176	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
177	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
178	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
179	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
180	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
181	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
182	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
183	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
184	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
185	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
186	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
187	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
188	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
189	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
190	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
191	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
192	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
193	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
194	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
195	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
197	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
198	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
199	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
200	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
201	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
202	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
203	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
204	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
237	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
241	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
242	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
243	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
244	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
245	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
246	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
247	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
248	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
249	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
250	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
251	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
252	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
253	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
254	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
255	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
256	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
257	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
258	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
259	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
260	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
261	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
262	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
263	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
264	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
265	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
266	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
267	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
268	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
269	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
270	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
271	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
272	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
273	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
274	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
275	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
276	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
277	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
278	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
279	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
280	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
281	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
282	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
283	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
284	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
285	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
286	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
287	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
288	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
289	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
290	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
291	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
292	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
293	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
294	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
295	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
296	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
297	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
298	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
299	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
300	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
301	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
302	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
303	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
304	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
305	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
306	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
307	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
308	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
309	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
310	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
311	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
312	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
313	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
314	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
315	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
316	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
317	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
318	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
319	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
320	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
321	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
322	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
323	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
324	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
325	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
326	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
327	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
328	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
329	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
330	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
331	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
332	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
333	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
334	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
335	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
336	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
337	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
338	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
339	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
340	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
341	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
342	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
343	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
344	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
345	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
346	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
347	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
348	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
349	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
350	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
351	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
352	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
353	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
354	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
355	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
356	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
357	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
358	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
359	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
360	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
361	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
362	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
363	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
364	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
365	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
366	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
367	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
368	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
369	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
370	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
371	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
372	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
373	8005275841	Rhizobium sp. N4311	Isolate	Nodule
374	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
375	8005395548	Rhizobium sp. R339	Isolate	Nodule
376	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
377	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
378	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
379	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
380	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
381	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
382	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
383	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
384	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	85
Metatranscriptomes	0
Isolates	15

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.96
Nodule	8.39
Rhizoplane	8.04
Rhizosphere	68.21
Stem	0
Stem Tuber	0
Unclassified	8.39

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000001	3300001979	Bacteria	168537
2	JGI25155J39150_1000011	3300002704	Bacteria	207685
3	JGI25156J39149_1000030	3300002705	Bacteria	126029
4	JGI25162J39368_1000387	3300002737	Bacteria	37284
5	JGI25162J39368_1000638	3300002737	Bacteria	24891
6	JGI25154J39366_1000057	3300002738	Bacteria	110584
7	JGI25158J39367_1000093	3300002739	Bacteria	20714
8	JGI25157J39369_1000010	3300002741	Bacteria	207685
9	JGI25152J39213_1002642	3300002773	Bacteria	6645
10	JGI25152J39213_1003082	3300002773	Bacteria	5842
11	JGI25150J39212_1019346	3300002774	Bacteria	1068
12	JGI25159J45721_1006459	3300002987	Bacteria	3504
13	JGI25151J46595_10001628	3300003187	Bacteria	14801
14	JGI25151J46595_10032745	3300003187	Bacteria	2010
15	JGI25165J46597_1000189	3300003214	Bacteria	91790
16	JGI25165J46597_1001157	3300003214	Bacteria	16360
17	JGI25165J46597_1004185	3300003214	Bacteria	3197
18	rootH1_10073327	3300003316	Bacteria	2457
19	rootH2_10151523	3300003320	Bacteria	6388
20	rootL2_10027690	3300003322	Bacteria	11854
21	rootL2_10154185	3300003322	Bacteria	1628
22	JGI25160J50197_1000004	3300003354	Bacteria	419797
23	JGI25161J50226_1000003	3300003374	Bacteria	413345
24	Ga0055526_1004175	3300003771	Bacteria	8786
25	Ga0055524_1038072	3300003775	Bacteria	1264
26	Ga0055543_1000001	3300004625	Bacteria	419949
27	Ga0065165_1000049	3300005262	Bacteria	195588
28	Ga0070658_10154510	3300005327	Bacteria	1923
29	Ga0070676_10012146	3300005328	Bacteria	4696
30	Ga0070690_100000533	3300005330	Bacteria	19053
31	Ga0070670_100001563	3300005331	Bacteria	18448
32	Ga0068869_100137359	3300005334	Bacteria	1885
33	Ga0070666_10000893	3300005335	Bacteria	18149
34	Ga0070680_100027034	3300005336	Bacteria	4593
35	Ga0070682_100003295	3300005337	Bacteria	8951
36	Ga0070689_100022427	3300005340	Bacteria	4713
37	Ga0070691_10003563	3300005341	Bacteria	7021
38	Ga0070661_100004204	3300005344	Bacteria	9937
39	Ga0070668_100076921	3300005347	Bacteria	2608
40	Ga0070669_100007617	3300005353	Bacteria	7738
41	Ga0070675_100014969	3300005354	Bacteria	6125
42	Ga0070671_100018985	3300005355	Bacteria	5591
43	Ga0070673_100004357	3300005364	Bacteria	8938
44	Ga0070688_100005228	3300005365	Bacteria	6817
45	Ga0070659_100011212	3300005366	Bacteria	6622
46	Ga0070667_100015674	3300005367	Bacteria	6266
47	Ga0070703_10014120	3300005406	Bacteria	2272
48	Ga0070709_10003780	3300005434	Bacteria	8137
49	Ga0070713_100043081	3300005436	Bacteria	3688
50	Ga0070710_10023263	3300005437	Bacteria	3254
51	Ga0070701_10003119	3300005438	Bacteria	6501
52	Ga0070711_100028574	3300005439	Bacteria	3671
53	Ga0070705_100001576	3300005440	Bacteria	11942
54	Ga0070700_100016444	3300005441	Bacteria	4214
55	Ga0070700_100164079	3300005441	Bacteria	1532
56	Ga0070694_100004833	3300005444	Bacteria	8108
57	Ga0070694_100290830	3300005444	Bacteria	1249
58	Ga0070663_100003047	3300005455	Bacteria	9575
59	Ga0070678_100000682	3300005456	Bacteria	16729
60	Ga0070662_100010962	3300005457	Bacteria	5973
61	Ga0070662_100069187	3300005457	Bacteria	2597
62	Ga0070681_10389639	3300005458	Bacteria	1304
63	Ga0068853_100007489	3300005539	Bacteria	8740
64	Ga0070672_100003304	3300005543	Bacteria	10444
65	Ga0070686_100000707	3300005544	Bacteria	19394
66	Ga0070695_100005065	3300005545	Bacteria	7762
67	Ga0070695_100006024	3300005545	Bacteria	7160
68	Ga0070696_100000743	3300005546	Bacteria	20824
69	Ga0070693_100005961	3300005547	Bacteria	5889
70	Ga0070665_100041988	3300005548	Bacteria	4597
71	Ga0070704_100002918	3300005549	Bacteria	9711
72	Ga0070704_100028689	3300005549	Bacteria	3706
73	Ga0070704_100162254	3300005549	Bacteria	1769
74	Ga0068855_100033439	3300005563	Bacteria	6136
75	Ga0068855_100361542	3300005563	Bacteria	1597
76	Ga0070664_100008106	3300005564	Bacteria	8492
77	Ga0068857_100037827	3300005577	Bacteria	4275
78	Ga0068854_100010731	3300005578	Bacteria	5945
79	Ga0068856_100032357	3300005614	Bacteria	5120
80	Ga0068856_100091045	3300005614	Bacteria	3034
81	Ga0070702_100000022	3300005615	Bacteria	44333
82	Ga0068852_100016440	3300005616	Bacteria	5770
83	Ga0068852_100337042	3300005616	Bacteria	1469
84	Ga0068859_100019379	3300005617	Bacteria	6835
85	Ga0068859_100061700	3300005617	Bacteria	3778
86	Ga0068864_100011702	3300005618	Bacteria	7245
87	Ga0068866_10006155	3300005718	Bacteria	4993
88	Ga0068861_100006227	3300005719	Bacteria	8116
89	Ga0068851_10030021	3300005834	Bacteria	2694
90	Ga0068863_100039918	3300005841	Bacteria	4463
91	Ga0068858_100075275	3300005842	Bacteria	3135
92	Ga0068858_100170188	3300005842	Bacteria	2054
93	Ga0068860_100005319	3300005843	Bacteria	13065
94	Ga0068860_100011136	3300005843	Bacteria	8860
95	Ga0068862_100016320	3300005844	Bacteria	6180
96	Ga0068862_100017990	3300005844	Bacteria	5887
97	Ga0081455_10002501	3300005937	Bacteria	21812
98	Ga0081539_10106933	3300005985	Bacteria	1415
99	Ga0075365_10007848	3300006038	Bacteria	6012
100	Ga0075432_10011032	3300006058	Bacteria	3070
101	Ga0070712_100004333	3300006175	Bacteria	8743
102	Ga0070712_100399581	3300006175	Bacteria	1135
103	Ga0075367_10004207	3300006178	Bacteria	6986
104	Ga0075370_10061064	3300006353	Bacteria	2148
105	Ga0075428_100103466	3300006844	Bacteria	3105
106	Ga0075428_100123519	3300006844	Bacteria	2818
107	Ga0075431_100010394	3300006847	Bacteria	9355
108	Ga0075433_10068703	3300006852	Bacteria	3111
109	Ga0075433_10149703	3300006852	Bacteria	2076
110	Ga0075434_100021516	3300006871	Bacteria	6269
111	Ga0075434_100206644	3300006871	Bacteria	1984
112	Ga0075429_100159332	3300006880	Bacteria	1976
113	Ga0068865_100071870	3300006881	Bacteria	2456
114	Ga0097620_100019379	3300006931	Bacteria	6835
115	Ga0097620_100061702	3300006931	Bacteria	3778
116	Ga0105250_10003865	3300009092	Bacteria	7022
117	Ga0105240_10000005	3300009093	Bacteria	702630
118	Ga0105240_10013580	3300009093	Bacteria	11176
119	Ga0111539_10012257	3300009094	Bacteria	10751
120	Ga0111539_10091679	3300009094	Bacteria	3570
121	Ga0111539_10139085	3300009094	Bacteria	2844
122	Ga0111539_10145515	3300009094	Bacteria	2775
123	Ga0105245_10094964	3300009098	Bacteria	2750
124	Ga0105245_10114521	3300009098	Bacteria	2512
125	Ga0105243_10000417	3300009148	Bacteria	44794
126	Ga0105243_10048118	3300009148	Bacteria	3360
127	Ga0105243_10079105	3300009148	Bacteria	2679
128	Ga0105241_10008164	3300009174	Bacteria	7709
129	Ga0105242_10005944	3300009176	Bacteria	9413
130	Ga0105248_10000293	3300009177	Bacteria	59383
131	Ga0105237_10000708	3300009545	Bacteria	46177
132	Ga0105237_10018742	3300009545	Bacteria	7156
133	Ga0105238_10006438	3300009551	Bacteria	11682
134	Ga0105249_10003167	3300009553	Bacteria	14233
135	Ga0105249_10008013	3300009553	Bacteria	9207
136	Ga0105239_10005075	3300010375	Bacteria	15545
137	Ga0105239_10009519	3300010375	Bacteria	10935
138	Ga0105239_10124630	3300010375	Bacteria	2863
139	Ga0105246_10000118	3300011119	Bacteria	35893
140	Ga0157373_10022581	3300013100	Bacteria	4563
141	Ga0157371_10083803	3300013102	Bacteria	2257
142	Ga0157370_10000284	3300013104	Bacteria	64323
143	Ga0157370_10139202	3300013104	Bacteria	2261
144	Ga0157369_10005863	3300013105	Bacteria	14271
145	Ga0157378_10004472	3300013297	Bacteria	12279
146	Ga0157378_10542638	3300013297	Bacteria	1167
147	Ga0163162_10028036	3300013306	Bacteria	5570
148	Ga0157372_10067440	3300013307	Bacteria	4021
149	Ga0157375_10030259	3300013308	Bacteria	5103
150	Ga0157375_10220833	3300013308	Bacteria	2053
151	Ga0157375_10389316	3300013308	Bacteria	1561
152	Ga0163163_10013549	3300014325	Bacteria	7469
153	Ga0157380_10001138	3300014326	Bacteria	17181
154	Ga0182008_10052531	3300014497	Bacteria	2020
155	Ga0157377_10002755	3300014745	Bacteria	7824
156	Ga0157379_10000933	3300014968	Bacteria	23653
157	Ga0157379_10113035	3300014968	Bacteria	2440
158	Ga0157379_10186431	3300014968	Bacteria	1875
159	Ga0157376_10002422	3300014969	Bacteria	12617
160	Ga0182007_10019669	3300015262	Bacteria	2424
161	Ga0182005_1010446	3300015265	Bacteria	2670
162	Ga0163161_10004896	3300017792	Bacteria	9329
163	Ga0209435_100022	3300025206	Bacteria	207766
164	Ga0209436_104465	3300025208	Bacteria	3458
165	Ga0209437_100122	3300025233	Bacteria	201364
166	Ga0209437_100160	3300025233	Bacteria	149451
167	Ga0209646_1000078	3300025246	Bacteria	207766
168	Ga0209026_1000065	3300025250	Bacteria	207766
169	Ga0209677_103385	3300025253	Bacteria	5215
170	Ga0209759_1000055	3300025256	Bacteria	207766
171	Ga0209233_1000168	3300025261	Bacteria	149312
172	Ga0209233_1000269	3300025261	Bacteria	74071
173	Ga0209233_1000317	3300025261	Bacteria	53589
174	Ga0209130_1000012	3300025284	Bacteria	421329
175	Ga0207426_1000010	3300025302	Bacteria	796003
176	Ga0207692_10020092	3300025898	Bacteria	3031
177	Ga0207692_10166922	3300025898	Bacteria	1273
178	Ga0207647_10001565	3300025904	Bacteria	17590
179	Ga0207685_10112146	3300025905	Bacteria	1184
180	Ga0207645_10003574	3300025907	Bacteria	11764
181	Ga0207695_10000011	3300025913	Bacteria	910221
182	Ga0207671_10000544	3300025914	Bacteria	50912
183	Ga0207693_10000703	3300025915	Bacteria	30046
184	Ga0207694_10116114	3300025924	Bacteria	2133
185	Ga0207650_10018670	3300025925	Bacteria	4868
186	Ga0207644_10033104	3300025931	Bacteria	3609
187	Ga0207706_10000263	3300025933	Bacteria	57106
188	Ga0207706_10252589	3300025933	Bacteria	1540
189	Ga0207709_10145492	3300025935	Bacteria	1635
190	Ga0207670_10003232	3300025936	Bacteria	8635
191	Ga0207669_10192244	3300025937	Bacteria	1473
192	Ga0207665_10004257	3300025939	Bacteria	9512
193	Ga0207691_10046132	3300025940	Bacteria	4007
194	Ga0207689_10008341	3300025942	Bacteria	9026
195	Ga0207661_10020139	3300025944	Bacteria	4982
196	Ga0207679_10033477	3300025945	Bacteria	3616
197	Ga0207667_10347475	3300025949	Bacteria	1513
198	Ga0207712_10005684	3300025961	Bacteria	7866
199	Ga0207712_10245172	3300025961	Bacteria	1445
200	Ga0207640_10134716	3300025981	Bacteria	1791
201	Ga0207658_10022165	3300025986	Bacteria	4419
202	Ga0207703_10014921	3300026035	Bacteria	6063
203	Ga0207703_10021259	3300026035	Bacteria	5081
204	Ga0207703_10165105	3300026035	Bacteria	1942
205	Ga0207678_10000209	3300026067	Bacteria	51832
206	Ga0207708_10000953	3300026075	Bacteria	21674
207	Ga0207702_10023532	3300026078	Bacteria	5109
208	Ga0207674_10000719	3300026116	Bacteria	43313
209	Ga0207675_100001925	3300026118	Bacteria	20707
210	Ga0207675_100029566	3300026118	Bacteria	5104
211	Ga0207675_100049547	3300026118	Bacteria	3920
212	Ga0207675_100104961	3300026118	Bacteria	2663
213	Ga0207683_10001900	3300026121	Bacteria	18486
214	Ga0207683_10278497	3300026121	Bacteria	1528
215	Ga0209371_1012481	3300027312	Bacteria	2453
216	Ga0209998_10003091	3300027717	Bacteria	3686
217	Ga0207428_10033553	3300027907	Bacteria	4214
218	Ga0207428_10036359	3300027907	Bacteria	4017
219	Ga0268266_10049143	3300028379	Bacteria	3616
220	Ga0268265_10008817	3300028380	Bacteria	6814
221	Ga0268265_10014778	3300028380	Bacteria	5327
222	Ga0268264_10026868	3300028381	Bacteria	4702
223	Ga0268264_10182013	3300028381	Bacteria	1909
224	Ga0268256_1013616	3300030500	Bacteria	2453
225	Ga0265330_10025716	3300031235	Bacteria	2667
226	Ga0265330_10028136	3300031235	Bacteria	2536
227	Ga0265328_10041793	3300031239	Bacteria	1688
228	Ga0265320_10015408	3300031240	Bacteria	4323
229	Ga0265325_10057696	3300031241	Bacteria	1979
230	Ga0265329_10008688	3300031242	Bacteria	3835
231	Ga0265340_10000530	3300031247	Bacteria	21027
232	Ga0265340_10011211	3300031247	Bacteria	4773
233	Ga0265340_10101147	3300031247	Bacteria	1339
234	Ga0265340_10122213	3300031247	Bacteria	1197
235	Ga0265339_10002725	3300031249	Bacteria	12558
236	Ga0265331_10074339	3300031250	Bacteria	1586
237	Ga0265316_10006074	3300031344	Bacteria	11587
238	Ga0265316_10192030	3300031344	Bacteria	1516
239	Ga0265313_10002080	3300031595	Bacteria	17898
240	Ga0265313_10028495	3300031595	Bacteria	2901
241	Ga0265314_10158033	3300031711	Bacteria	1382
242	Ga0265314_10243575	3300031711	Bacteria	1036
243	Ga0265342_10004271	3300031712	Bacteria	11316
244	Ga0265342_10014694	3300031712	Bacteria	5187
245	Ga0265342_10031395	3300031712	Bacteria	3284
246	Ga0265342_10035992	3300031712	Bacteria	3026
247	Ga0316578_10114842	3300031728	Bacteria	1617
248	Ga0307410_10026591	3300031852	Bacteria	3645
249	Ga0307410_10178518	3300031852	Bacteria	1606
250	Ga0307412_10011360	3300031911	Bacteria	5156
251	Ga0307416_100146287	3300032002	Bacteria	2158
252	Ga0373941_0077017	3300035115	Bacteria	1119
253	Ga0373935_0376571	3300035692	Bacteria	1016
254	Ga0373927_0001115	3300035695	Bacteria	20393
255	Ga0373927_0250768	3300035695	Bacteria	1164
256	Ga0373947_0001465	3300035725	Bacteria	14517
257	Ga0373947_0102051	3300035725	Bacteria	1804
258	Ga0373925_0001344	3300037068	Bacteria	21480
259	Ga0373925_0049254	3300037068	Bacteria	3140
260	Ga0395900_0013943	3300037418	Bacteria	8203
261	Ga0395898_0008941	3300037466	Bacteria	10551
262	Ga0395905_0002720	3300037471	Bacteria	19373
263	Ga0395905_0002883	3300037471	Bacteria	18791
264	Ga0436361_0183040	3300039447	Bacteria	40114
265	Ga0436363_0110911	3300039450	Bacteria	3183
266	Ga0439465_0007850	3300041413	Bacteria	3381
267	Ga0451807_0812615	3300041486	Bacteria	938
268	Ga0451833_0253399	3300041491	Bacteria	3491
269	Ga0466963_0061313	3300044694	Bacteria	2514
270	Ga0466970_0007357	3300044765	Bacteria	5516
271	Ga0466967_0136778	3300045976	Bacteria	2279
272	Ga0466967_0186835	3300045976	Bacteria	1957
273	Ga0495603_0004837	3300046455	Bacteria	8053
274	Ga0495638_0000335	3300046460	Bacteria	59334
275	Ga0495641_0011447	3300046461	Bacteria	5053
276	Ga0495650_0085693	3300046471	Bacteria	1207
277	Ga0495580_0027077	3300046472	Bacteria	4174
278	Ga0495582_0001405	3300046473	Bacteria	13569
279	Ga0495605_0001291	3300046474	Bacteria	16626
280	Ga0495639_0016537	3300046475	Bacteria	3203
281	Ga0495584_0015186	3300046491	Bacteria	3923
282	Ga0495585_0040052	3300046492	Bacteria	2632
283	Ga0495594_0000336	3300046499	Bacteria	23343
284	Ga0495594_0200103	3300046499	Bacteria	1139
285	Ga0495606_0010518	3300046507	Bacteria	7665
286	Ga0495606_0163624	3300046507	Bacteria	1296
287	Ga0495620_0069913	3300046515	Bacteria	1439
288	Ga0495666_0073130	3300046526	Bacteria	1627
289	Ga0495665_0023297	3300046531	Bacteria	3325
290	Ga0495622_0026080	3300046557	Bacteria	2730
291	Ga0495656_0040156	3300046615	Bacteria	1949
292	Ga0495588_0002308	3300046674	Bacteria	8161
293	Ga0495588_0200469	3300046674	Bacteria	1054
294	Ga0495613_0001504	3300046689	Bacteria	17747
295	Ga0495660_0032458	3300046810	Bacteria	2932
296	Ga0495581_0003643	3300047315	Bacteria	8871
297	Ga0495676_0073687	3300047321	Bacteria	2617
298	Ga0495687_021842	3300047443	Bacteria	3085
299	Ga0495593_0002792	3300047673	Bacteria	10521
300	Ga0496100_0101944	3300048903	Bacteria	1979
301	Ga0496100_0296114	3300048903	Bacteria	1210
302	Ga0496101_0024355	3300048904	Bacteria	4189
303	Ga0496101_0059086	3300048904	Bacteria	2779
304	Ga0496101_0098071	3300048904	Bacteria	2189
305	Ga0496101_0369174	3300048904	Bacteria	1128
306	Ga0496102_0031838	3300048905	Bacteria	4734
307	Ga0496102_0129534	3300048905	Bacteria	2360
308	Ga0496102_0210094	3300048905	Bacteria	1835
309	Ga0496102_0408579	3300048905	Bacteria	1276
310	Ga0496102_0601294	3300048905	Bacteria	1023
311	Ga0496103_0017351	3300048906	Bacteria	4308
312	Ga0496103_0147097	3300048906	Bacteria	1508
313	Ga0496104_0003432	3300048907	Bacteria	13669
314	Ga0496104_0069493	3300048907	Bacteria	3347
315	Ga0496104_0169545	3300048907	Bacteria	2093
316	Ga0496104_0263964	3300048907	Bacteria	1634
317	Ga0496105_0192148	3300048908	Bacteria	1669
318	Ga0496106_0039849	3300048909	Bacteria	3518
319	Ga0496106_0098109	3300048909	Bacteria	2269
320	Ga0496106_0156077	3300048909	Bacteria	1802
321	Ga0496107_0043321	3300048910	Bacteria	3233
322	Ga0496107_0064725	3300048910	Bacteria	2650
323	Ga0496108_0009814	3300048911	Bacteria	7756
324	Ga0496108_0052499	3300048911	Bacteria	3417
325	Ga0496108_0128188	3300048911	Bacteria	2180
326	Ga0496109_0143389	3300048912	Bacteria	2234
327	Ga0496109_0222139	3300048912	Bacteria	1776
328	Ga0496109_0278422	3300048912	Bacteria	1577
329	Ga0496110_0007676	3300048913	Bacteria	8631
330	Ga0496110_0076603	3300048913	Bacteria	2974
331	Ga0496110_0247708	3300048913	Bacteria	1622
332	Ga0496110_0593028	3300048913	Bacteria	1006
333	Ga0496111_0039224	3300048914	Bacteria	3395
334	Ga0496111_0120891	3300048914	Bacteria	1934
335	Ga0496111_0146404	3300048914	Bacteria	1751
336	Ga0496112_0007236	3300048915	Bacteria	9837
337	Ga0496112_0067988	3300048915	Bacteria	3518
338	Ga0496112_0088812	3300048915	Bacteria	3059
339	Ga0496112_0139105	3300048915	Bacteria	2397
340	Ga0496113_0129117	3300048916	Bacteria	1982
341	Ga0496113_0194064	3300048916	Bacteria	1612
342	Ga0496115_0227112	3300048918	Bacteria	1540
343	Ga0496116_0095302	3300048919	Bacteria	1796
344	Ga0496116_0160832	3300048919	Bacteria	1232
345	Ga0496117_0000338	3300048920	Bacteria	82688
346	Ga0496117_0006887	3300048920	Bacteria	11278
347	Ga0496118_0001299	3300048921	Bacteria	38053
348	Ga0496119_0115298	3300048922	Bacteria	1484
349	Ga0496121_0003368	3300048924	Bacteria	22917
350	Ga0496121_0184407	3300048924	Bacteria	1502
351	Ga0496122_0039438	3300048925	Bacteria	3766
352	Ga0496123_0018423	3300048926	Bacteria	5557
353	Ga0496123_0051415	3300048926	Bacteria	2744
354	Ga0496124_0021817	3300048927	Bacteria	5889
355	Ga0496124_0041576	3300048927	Bacteria	3965
356	Ga0496124_0064231	3300048927	Bacteria	3065
357	Ga0496124_0068871	3300048927	Bacteria	2940
358	Ga0496125_0023168	3300048928	Bacteria	5741
359	Ga0496126_0066742	3300048929	Bacteria	3216
360	Ga0496126_0411816	3300048929	Bacteria	1094
361	Ga0501031_0013164	3300049568	Bacteria	5399
362	Ga0501031_0060947	3300049568	Bacteria	2459
363	Ga0501031_0097605	3300049568	Bacteria	1918
364	Ga0501031_0101590	3300049568	Bacteria	1876
365	Ga0501032_0041409	3300049569	Bacteria	3129
366	Ga0501032_0209301	3300049569	Bacteria	1272
367	Ga0501033_0047466	3300049570	Bacteria	3192
368	Ga0501033_0067133	3300049570	Bacteria	2637
369	Ga0501033_0242271	3300049570	Bacteria	1279
370	Ga0501034_0009256	3300049571	Bacteria	10322
371	Ga0501034_0353871	3300049571	Bacteria	1396
372	Ga0501036_0017862	3300049572	Bacteria	5938
373	Ga0501036_0085242	3300049572	Bacteria	2670
374	Ga0501036_0120099	3300049572	Bacteria	2220
375	Ga0501036_0140934	3300049572	Bacteria	2035
376	Ga0501036_0203187	3300049572	Bacteria	1666
377	Ga0501037_0036181	3300049573	Bacteria	3639
378	Ga0501038_0013946	3300049574	Bacteria	7325
379	Ga0501038_0063885	3300049574	Bacteria	3141
380	Ga0501038_0149113	3300049574	Bacteria	1908
381	Ga0501038_0166076	3300049574	Bacteria	1790
382	Ga0501039_0028581	3300049575	Bacteria	4292
383	Ga0501039_0120252	3300049575	Bacteria	2058
384	Ga0501040_0010870	3300049576	Bacteria	5950
385	Ga0501040_0218820	3300049576	Bacteria	1355
386	Ga0501041_0008610	3300049577	Bacteria	6010
387	Ga0501041_0041225	3300049577	Bacteria	2803
388	Ga0501042_0023228	3300049578	Bacteria	4337
389	Ga0501042_0104432	3300049578	Bacteria	2039
390	Ga0501042_0309722	3300049578	Bacteria	1141
391	Ga0501043_0069410	3300049579	Bacteria	2768
392	Ga0501043_0093941	3300049579	Bacteria	2358
393	Ga0501043_0152015	3300049579	Bacteria	1811
394	Ga0501046_0040482	3300049580	Bacteria	3723
395	Ga0501046_0098389	3300049580	Bacteria	2246
396	Ga0501046_0110874	3300049580	Bacteria	2096
397	Ga0501048_0200578	3300049582	Bacteria	1414
398	Ga0501068_0031881	3300049584	Bacteria	3131
399	Ga0501070_0064561	3300049586	Bacteria	3031
400	Ga0501070_0079911	3300049586	Bacteria	2706
401	Ga0501070_0217166	3300049586	Bacteria	1569
402	Ga0501070_0306586	3300049586	Bacteria	1293
403	Ga0501070_0314108	3300049586	Bacteria	1275
404	Ga0501070_0373649	3300049586	Bacteria	1155
405	Ga0501071_0011184	3300049587	Bacteria	6036
406	Ga0501071_0026338	3300049587	Bacteria	4081
407	Ga0501071_0105071	3300049587	Bacteria	2085
408	Ga0501072_0007185	3300049588	Bacteria	8448
409	Ga0501072_0183206	3300049588	Bacteria	1671
410	Ga0501072_0312794	3300049588	Bacteria	1248
411	Ga0501072_0319044	3300049588	Bacteria	1235
412	Ga0501073_0017226	3300049589	Bacteria	5234
413	Ga0501074_0018269	3300049590	Bacteria	5095
414	Ga0501074_0159597	3300049590	Bacteria	1610
415	Ga0501075_0010371	3300049591	Bacteria	6547
416	Ga0501075_0045414	3300049591	Bacteria	3297
417	Ga0501075_0099314	3300049591	Bacteria	2210
418	Ga0501075_0183767	3300049591	Bacteria	1595
419	Ga0501076_0005048	3300049592	Bacteria	9445
420	Ga0501076_0056429	3300049592	Bacteria	3117
421	Ga0501076_0072539	3300049592	Bacteria	2755
422	Ga0501076_0206258	3300049592	Bacteria	1606
423	Ga0501076_0347313	3300049592	Bacteria	1218
424	Ga0501077_0004400	3300049593	Bacteria	8545
425	Ga0501077_0009019	3300049593	Bacteria	6191
426	Ga0501077_0030154	3300049593	Bacteria	3451
427	Ga0501077_0037294	3300049593	Bacteria	3096
428	Ga0501079_0031301	3300049741	Bacteria	4089
429	Ga0501079_0043328	3300049741	Bacteria	3473
430	Ga0501079_0114096	3300049741	Bacteria	2100
431	Ga0501080_0022085	3300049742	Bacteria	5895
432	Ga0501080_0081722	3300049742	Bacteria	3001
433	Ga0501080_0290574	3300049742	Bacteria	1484
434	Ga0501081_0013974	3300049743	Bacteria	5286
435	Ga0501081_0063883	3300049743	Bacteria	2555
436	Ga0501081_0094606	3300049743	Bacteria	2105
437	Ga0501083_0047138	3300049744	Bacteria	2913
438	Ga0501035_0017248	3300049822	Bacteria	6656
439	Ga0501035_0120705	3300049822	Bacteria	2291
440	Ga0501044_0146675	3300049823	Bacteria	2345
441	Ga0501045_0012769	3300049824	Bacteria	5918
442	Ga0501045_0025083	3300049824	Bacteria	4283
443	Ga0501045_0083580	3300049824	Bacteria	2355
444	Ga0501045_0085109	3300049824	Bacteria	2333
445	nmdc:mga03n38_5371_c1	3300050490	Bacteria	4355
446	nmdc:mga0k408_91799_c1	3300050493	Bacteria	1784
447	nmdc:mga06z11_105198_c1	3300050494	Bacteria	1555
448	nmdc:mga06z11_32224_c1	3300050494	Bacteria	2554
449	nmdc:mga06z11_6627_c1	3300050494	Bacteria	4730
450	nmdc:mga05p37_90551_c1	3300050507	Bacteria	3770
451	nmdc:mga0qj67_11473_c1	3300050509	Bacteria	6641
452	nmdc:mga0qj67_420034_c1	3300050509	Bacteria	1078
453	nmdc:mga06r32_99645_c1	3300050510	Bacteria	2850
454	nmdc:mga08y16_6601_c1	3300050511	Bacteria	12170
455	nmdc:mga0n895_120186_c1	3300050512	Bacteria	2648
456	nmdc:mga0n895_154115_c1	3300050512	Bacteria	2328
457	nmdc:mga0rr50_75731_c1	3300050513	Bacteria	2581
458	nmdc:mga08x19_18248_c1	3300050514	Bacteria	4300
459	nmdc:mga0a205_15093_c1	3300050515	Bacteria	7215
460	Ga0495601_0040550	3300053077	Bacteria	2916
461	Ga0495612_0063817	3300053078	Bacteria	1528
462	Ga0500610_0014034	3300053079	Bacteria	3748
463	Ga0495619_0018964	3300053085	Bacteria	4369
464	Ga0500559_0006631	3300053136	Bacteria	5210
465	Ga0500577_0053537	3300053142	Bacteria	1526
466	Ga0500622_0001529	3300053156	Bacteria	18331
467	Ga0501084_0041723	3300054114	Bacteria	3839
468	Ga0501084_0041868	3300054114	Bacteria	3831
469	Ga0501082_0006366	3300060353	Bacteria	10246
470	Ga0501082_0041539	3300060353	Bacteria	3965
471	Ga0501082_0083517	3300060353	Bacteria	2755
472	Ga0501082_0509103	3300060353	Bacteria	1052
473	Ga0530510_0009380	3300061734	Bacteria	6862
474	Ga0530510_0021477	3300061734	Bacteria	4593
475	Ga0530510_0025419	3300061734	Bacteria	4234
476	Ga0530510_0073422	3300061734	Bacteria	2483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046674	Ga0495588_0200469	Ga0495588_0200469_27_827	265
2	3300045976	Ga0466967_0136778	Ga0466967_0136778_1448_2251	267
3	3300041486	Ga0451807_0812615	Ga0451807_0812615_40_849	268
4	3300046515	Ga0495620_0069913	Ga0495620_0069913_615_1424	268
5	3300049586	Ga0501070_0314108	Ga0501070_0314108_370_1251	293
6	iso_pu_bacteria	2970184632	2970188517	296
7	3300046499	Ga0495594_0200103	Ga0495594_0200103_193_1119	298
8	3300025898	Ga0207692_10166922	Ga0207692_101669221	302
9	3300049573	Ga0501037_0036181	Ga0501037_0036181_779_1759	304
10	3300031728	Ga0316578_10114842	Ga0316578_101148422	307
11	3300035692	Ga0373935_0376571	Ga0373935_0376571_56_982	308
12	3300048913	Ga0496110_0593028	Ga0496110_0593028_22_948	308
13	3300049588	Ga0501072_0183206	Ga0501072_0183206_32_964	309
14	3300053136	Ga0500559_0006631	Ga0500559_0006631_451_1428	311
15	3300049574	Ga0501038_0149113	Ga0501038_0149113_401_1378	313
16	3300005842	Ga0068858_100075275	Ga0068858_1000752753	314
17	3300026035	Ga0207703_10165105	Ga0207703_101651053	314
18	3300005843	Ga0068860_100005319	Ga0068860_1000053198	315
19	3300005844	Ga0068862_100016320	Ga0068862_1000163202	315
20	3300028380	Ga0268265_10014778	Ga0268265_100147785	315
21	3300028381	Ga0268264_10026868	Ga0268264_100268684	315
22	3300048929	Ga0496126_0411816	Ga0496126_0411816_75_1043	315
23	3300048919	Ga0496116_0160832	Ga0496116_0160832_58_1008	316
24	3300048920	Ga0496117_0006887	Ga0496117_0006887_9892_10842	316
25	3300048927	Ga0496124_0064231	Ga0496124_0064231_810_1760	316
26	iso_pu_bacteria	2508501050	2508730846	319
27	iso_pu_bacteria	2835312727	2835313152	319
28	iso_pu_bacteria	2842694124	2842696049	319
29	iso_pu_bacteria	2887375801	2887377670	319
30	iso_pu_bacteria	2894232714	2894236832	319
31	iso_pu_bacteria	2998344455	2998345267	319
32	iso_pu_bacteria	8054558443	8054559599	319
33	iso_pu_bacteria	2643221550	2643771026	320
34	iso_pu_bacteria	2643221564	2643837346	320
35	iso_pu_bacteria	2643221623	2644132032	320
36	iso_pu_bacteria	2738543024	2739309091	320
37	iso_pu_bacteria	2837651117	2837653129	320
38	iso_pu_bacteria	2837678835	2837679733	320
39	iso_pu_bacteria	2909042592	2909045989	320
40	3300005842	Ga0068858_100170188	Ga0068858_1001701882	321
41	3300026035	Ga0207703_10021259	Ga0207703_100212595	321
42	iso_pu_bacteria	3005409236	3005409607	321
43	3300005545	Ga0070695_100005065	Ga0070695_1000050656	322
44	3300031235	Ga0265330_10025716	Ga0265330_100257162	322
45	3300031239	Ga0265328_10041793	Ga0265328_100417931	322
46	3300031247	Ga0265340_10000530	Ga0265340_1000053014	322
47	3300031247	Ga0265340_10011211	Ga0265340_100112117	322
48	3300031249	Ga0265339_10002725	Ga0265339_1000272510	322
49	3300031344	Ga0265316_10006074	Ga0265316_100060747	322
50	3300031595	Ga0265313_10002080	Ga0265313_100020807	322
51	3300031712	Ga0265342_10004271	Ga0265342_100042716	322
52	3300031712	Ga0265342_10031395	Ga0265342_100313951	322
53	3300044694	Ga0466963_0061313	Ga0466963_0061313_374_1342	322
54	iso_pu_bacteria	2509276021	2509386957	322
55	iso_pu_bacteria	2510917022	2511133737	322
56	iso_pu_bacteria	2513237088	2513594429	322
57	iso_pu_bacteria	2513237138	2513866959	322
58	iso_pu_bacteria	2513237146	2513926603	322
59	iso_pu_bacteria	2515075009	2515111961	322
60	iso_pu_bacteria	2516653077	2517035701	322
61	iso_pu_bacteria	2517287029	2517406497	322
62	iso_pu_bacteria	2582581294	2585199997	322
63	iso_pu_bacteria	2582581307	2585270628	322
64	iso_pu_bacteria	2582581308	2585276976	322
65	iso_pu_bacteria	2582581867	2585403489	322
66	iso_pu_bacteria	2585427527	2585536985	322
67	iso_pu_bacteria	2585427530	2585551837	322
68	iso_pu_bacteria	2585427531	2585558333	322
69	iso_pu_bacteria	2585427590	2585819543	322
70	iso_pu_bacteria	2585427608	2585897726	322
71	iso_pu_bacteria	2585427609	2585904679	322
72	iso_pu_bacteria	2585428125	2587980205	322
73	iso_pu_bacteria	2615840626	2616308349	322
74	iso_pu_bacteria	2718217882	2719180922	322
75	iso_pu_bacteria	2718217927	2719385524	322
76	iso_pu_bacteria	2718218233	2720619884	322
77	iso_pu_bacteria	2718218365	2721158545	322
78	iso_pu_bacteria	2718218423	2721399272	322
79	iso_pu_bacteria	2721755809	2724038085	322
80	iso_pu_bacteria	2721755823	2724109932	322
81	iso_pu_bacteria	2791355256	2793298299	322
82	iso_pu_bacteria	2791355264	2793347560	322
83	iso_pu_bacteria	2791355267	2793369704	322
84	iso_pu_bacteria	2818991453	2819638135	322
85	iso_pu_bacteria	2838661181	2838666263	322
86	iso_pu_bacteria	2841864319	2841864828	322
87	iso_pu_bacteria	2842341865	2842347239	322
88	iso_pu_bacteria	2842363717	2842366576	322
89	iso_pu_bacteria	2842395702	2842397388	322
90	iso_pu_bacteria	2842447887	2842451820	322
91	iso_pu_bacteria	2852387548	2852389630	322
92	iso_pu_bacteria	2923556063	2923560845	322
93	iso_pu_bacteria	8005275841	8005280298	322
94	iso_pu_bacteria	8005395548	8005396962	322
95	iso_pu_bacteria	8005556819	8005558023	322
96	iso_pu_bacteria	8005695170	8005696055	322
97	iso_pu_bacteria	8046767195	8046772753	322
98	iso_pu_bacteria	8056375014	8056377150	322
99	iso_pu_bacteria	8057575449	8057578287	322
100	3300005937	Ga0081455_10002501	Ga0081455_1000250112	323
101	3300005985	Ga0081539_10106933	Ga0081539_101069331	323
102	3300006852	Ga0075433_10149703	Ga0075433_101497032	323
103	3300006871	Ga0075434_100021516	Ga0075434_1000215162	323
104	3300009094	Ga0111539_10012257	Ga0111539_100122577	323
105	3300009094	Ga0111539_10091679	Ga0111539_100916793	323
106	3300009098	Ga0105245_10094964	Ga0105245_100949642	323
107	3300014968	Ga0157379_10113035	Ga0157379_101130352	323
108	3300026118	Ga0207675_100029566	Ga0207675_1000295665	323
109	3300026118	Ga0207675_100104961	Ga0207675_1001049613	323
110	3300027907	Ga0207428_10036359	Ga0207428_100363593	323
111	3300031852	Ga0307410_10026591	Ga0307410_100265912	323
112	3300031852	Ga0307410_10178518	Ga0307410_101785181	323
113	3300032002	Ga0307416_100146287	Ga0307416_1001462872	323
114	3300035695	Ga0373927_0250768	Ga0373927_0250768_101_1072	323
115	3300035725	Ga0373947_0102051	Ga0373947_0102051_498_1469	323
116	3300039447	Ga0436361_0183040	Ga0436361_0183040_35635_36609	323
117	3300039450	Ga0436363_0110911	Ga0436363_0110911_1222_2196	323
118	3300048904	Ga0496101_0059086	Ga0496101_0059086_177_1148	323
119	3300048905	Ga0496102_0031838	Ga0496102_0031838_265_1236	323
120	3300048905	Ga0496102_0408579	Ga0496102_0408579_151_1122	323
121	3300048907	Ga0496104_0003432	Ga0496104_0003432_4511_5482	323
122	3300048909	Ga0496106_0039849	Ga0496106_0039849_1649_2620	323
123	3300048911	Ga0496108_0052499	Ga0496108_0052499_2186_3157	323
124	3300048911	Ga0496108_0128188	Ga0496108_0128188_745_1716	323
125	3300048912	Ga0496109_0143389	Ga0496109_0143389_1227_2198	323
126	3300048914	Ga0496111_0146404	Ga0496111_0146404_374_1345	323
127	3300048915	Ga0496112_0067988	Ga0496112_0067988_2440_3411	323
128	3300048915	Ga0496112_0088812	Ga0496112_0088812_1922_2893	323
129	3300048929	Ga0496126_0066742	Ga0496126_0066742_177_1157	323
130	3300049568	Ga0501031_0013164	Ga0501031_0013164_3481_4455	323
131	3300049568	Ga0501031_0060947	Ga0501031_0060947_1144_2118	323
132	3300049570	Ga0501033_0047466	Ga0501033_0047466_611_1585	323
133	3300049571	Ga0501034_0009256	Ga0501034_0009256_2472_3446	323
134	3300049571	Ga0501034_0353871	Ga0501034_0353871_133_1107	323
135	3300049572	Ga0501036_0120099	Ga0501036_0120099_597_1568	323
136	3300049572	Ga0501036_0203187	Ga0501036_0203187_388_1362	323
137	3300049574	Ga0501038_0063885	Ga0501038_0063885_350_1324	323
138	3300049574	Ga0501038_0166076	Ga0501038_0166076_204_1178	323
139	3300049575	Ga0501039_0120252	Ga0501039_0120252_628_1602	323
140	3300049578	Ga0501042_0309722	Ga0501042_0309722_156_1127	323
141	3300049579	Ga0501043_0152015	Ga0501043_0152015_557_1531	323
142	3300049580	Ga0501046_0110874	Ga0501046_0110874_1052_2026	323
143	3300049586	Ga0501070_0064561	Ga0501070_0064561_1314_2288	323
144	3300049586	Ga0501070_0306586	Ga0501070_0306586_53_1024	323
145	3300049586	Ga0501070_0373649	Ga0501070_0373649_100_1071	323
146	3300049587	Ga0501071_0105071	Ga0501071_0105071_552_1523	323
147	3300049588	Ga0501072_0319044	Ga0501072_0319044_47_1018	323
148	3300049590	Ga0501074_0159597	Ga0501074_0159597_212_1183	323
149	3300049591	Ga0501075_0099314	Ga0501075_0099314_1093_2064	323
150	3300049592	Ga0501076_0056429	Ga0501076_0056429_1111_2082	323
151	3300049593	Ga0501077_0030154	Ga0501077_0030154_1640_2611	323
152	3300049741	Ga0501079_0031301	Ga0501079_0031301_2223_3194	323
153	3300049742	Ga0501080_0081722	Ga0501080_0081722_436_1407	323
154	3300049822	Ga0501035_0017248	Ga0501035_0017248_1152_2126	323
155	3300049824	Ga0501045_0083580	Ga0501045_0083580_797_1768	323
156	3300049824	Ga0501045_0085109	Ga0501045_0085109_488_1459	323
157	3300050509	nmdc:mga0qj67_11473_c1	nmdc:mga0qj67_11473_c1_1248_2219	323
158	3300050511	nmdc:mga08y16_6601_c1	nmdc:mga08y16_6601_c1_6483_7454	323
159	3300050512	nmdc:mga0n895_154115_c1	nmdc:mga0n895_154115_c1_144_1115	323
160	3300054114	Ga0501084_0041868	Ga0501084_0041868_1019_1990	323
161	3300060353	Ga0501082_0006366	Ga0501082_0006366_2576_3547	323
162	3300060353	Ga0501082_0509103	Ga0501082_0509103_69_1040	323
163	3300061734	Ga0530510_0025419	Ga0530510_0025419_516_1487	323
164	3300061734	Ga0530510_0073422	Ga0530510_0073422_1072_2043	323
165	iso_pu_bacteria	2524023209	2524460420	323
166	iso_pu_bacteria	2582581315	2585324022	323
167	iso_pu_bacteria	2582581316	2585333583	323
168	iso_pu_bacteria	2615840698	2616556589	323
169	iso_pu_bacteria	2617270742	2617386184	323
170	iso_pu_bacteria	2667528174	2671115745	323
171	iso_pu_bacteria	2775507266	2778176485	323
172	iso_pu_bacteria	2818991448	2819610399	323
173	iso_pu_bacteria	2838029111	2838034592	323
174	iso_pu_bacteria	2842298080	2842301828	323
175	iso_pu_bacteria	2842357229	2842357253	323
176	iso_pu_bacteria	2842475841	2842481339	323
177	iso_pu_bacteria	2842482326	2842487120	323
178	iso_pu_bacteria	2842502639	2842508239	323
179	iso_pu_bacteria	2919408235	2919409798	323
180	iso_pu_bacteria	3005416602	3005420336	323
181	iso_pu_bacteria	8005314921	8005317287	323
182	iso_pu_bacteria	8005484373	8005486648	323
183	iso_pu_bacteria	8005645114	8005646210	323
184	iso_pu_bacteria	8005682033	8005686343	323
185	3300005327	Ga0070658_10154510	Ga0070658_101545102	324
186	3300005328	Ga0070676_10012146	Ga0070676_100121465	324
187	3300005330	Ga0070690_100000533	Ga0070690_10000053319	324
188	3300005331	Ga0070670_100001563	Ga0070670_10000156318	324
189	3300005334	Ga0068869_100137359	Ga0068869_1001373592	324
190	3300005335	Ga0070666_10000893	Ga0070666_1000089317	324
191	3300005336	Ga0070680_100027034	Ga0070680_1000270342	324
192	3300005337	Ga0070682_100003295	Ga0070682_1000032958	324
193	3300005340	Ga0070689_100022427	Ga0070689_1000224272	324
194	3300005341	Ga0070691_10003563	Ga0070691_100035639	324
195	3300005344	Ga0070661_100004204	Ga0070661_1000042044	324
196	3300005347	Ga0070668_100076921	Ga0070668_1000769212	324
197	3300005353	Ga0070669_100007617	Ga0070669_1000076175	324
198	3300005354	Ga0070675_100014969	Ga0070675_1000149692	324
199	3300005355	Ga0070671_100018985	Ga0070671_1000189855	324
200	3300005364	Ga0070673_100004357	Ga0070673_1000043579	324
201	3300005365	Ga0070688_100005228	Ga0070688_1000052285	324
202	3300005366	Ga0070659_100011212	Ga0070659_1000112122	324
203	3300005367	Ga0070667_100015674	Ga0070667_1000156742	324
204	3300005406	Ga0070703_10014120	Ga0070703_100141202	324
205	3300005434	Ga0070709_10003780	Ga0070709_100037805	324
206	3300005436	Ga0070713_100043081	Ga0070713_1000430812	324
207	3300005437	Ga0070710_10023263	Ga0070710_100232632	324
208	3300005438	Ga0070701_10003119	Ga0070701_100031195	324
209	3300005439	Ga0070711_100028574	Ga0070711_1000285742	324
210	3300005440	Ga0070705_100001576	Ga0070705_1000015769	324
211	3300005441	Ga0070700_100016444	Ga0070700_1000164442	324
212	3300005441	Ga0070700_100164079	Ga0070700_1001640792	324
213	3300005444	Ga0070694_100004833	Ga0070694_1000048335	324
214	3300005444	Ga0070694_100290830	Ga0070694_1002908301	324
215	3300005455	Ga0070663_100003047	Ga0070663_1000030475	324
216	3300005456	Ga0070678_100000682	Ga0070678_1000006824	324
217	3300005457	Ga0070662_100010962	Ga0070662_1000109625	324
218	3300005457	Ga0070662_100069187	Ga0070662_1000691872	324
219	3300005458	Ga0070681_10389639	Ga0070681_103896391	324
220	3300005539	Ga0068853_100007489	Ga0068853_1000074897	324
221	3300005543	Ga0070672_100003304	Ga0070672_1000033044	324
222	3300005544	Ga0070686_100000707	Ga0070686_10000070718	324
223	3300005545	Ga0070695_100006024	Ga0070695_1000060245	324
224	3300005546	Ga0070696_100000743	Ga0070696_10000074319	324
225	3300005547	Ga0070693_100005961	Ga0070693_1000059618	324
226	3300005548	Ga0070665_100041988	Ga0070665_1000419882	324
227	3300005549	Ga0070704_100002918	Ga0070704_10000291810	324
228	3300005549	Ga0070704_100028689	Ga0070704_1000286892	324
229	3300005549	Ga0070704_100162254	Ga0070704_1001622542	324
230	3300005563	Ga0068855_100033439	Ga0068855_1000334394	324
231	3300005564	Ga0070664_100008106	Ga0070664_1000081065	324
232	3300005577	Ga0068857_100037827	Ga0068857_1000378274	324
233	3300005578	Ga0068854_100010731	Ga0068854_1000107317	324
234	3300005614	Ga0068856_100091045	Ga0068856_1000910452	324
235	3300005615	Ga0070702_100000022	Ga0070702_10000002210	324
236	3300005616	Ga0068852_100016440	Ga0068852_1000164405	324
237	3300005617	Ga0068859_100019379	Ga0068859_1000193798	324
238	3300005618	Ga0068864_100011702	Ga0068864_1000117024	324
239	3300005718	Ga0068866_10006155	Ga0068866_100061552	324
240	3300005719	Ga0068861_100006227	Ga0068861_1000062275	324
241	3300005834	Ga0068851_10030021	Ga0068851_100300212	324
242	3300005841	Ga0068863_100039918	Ga0068863_1000399184	324
243	3300005843	Ga0068860_100011136	Ga0068860_1000111368	324
244	3300005844	Ga0068862_100017990	Ga0068862_1000179903	324
245	3300006058	Ga0075432_10011032	Ga0075432_100110322	324
246	3300006175	Ga0070712_100004333	Ga0070712_1000043335	324
247	3300006175	Ga0070712_100399581	Ga0070712_1003995812	324
248	3300006353	Ga0075370_10061064	Ga0075370_100610641	324
249	3300006844	Ga0075428_100103466	Ga0075428_1001034662	324
250	3300006844	Ga0075428_100123519	Ga0075428_1001235192	324
251	3300006847	Ga0075431_100010394	Ga0075431_1000103943	324
252	3300006852	Ga0075433_10068703	Ga0075433_100687032	324
253	3300006880	Ga0075429_100159332	Ga0075429_1001593322	324
254	3300006881	Ga0068865_100071870	Ga0068865_1000718702	324
255	3300006931	Ga0097620_100019379	Ga0097620_1000193798	324
256	3300009092	Ga0105250_10003865	Ga0105250_100038655	324
257	3300009093	Ga0105240_10013580	Ga0105240_1001358010	324
258	3300009094	Ga0111539_10139085	Ga0111539_101390852	324
259	3300009098	Ga0105245_10114521	Ga0105245_101145212	324
260	3300009148	Ga0105243_10000417	Ga0105243_1000041746	324
261	3300009148	Ga0105243_10079105	Ga0105243_100791054	324
262	3300009174	Ga0105241_10008164	Ga0105241_100081645	324
263	3300009176	Ga0105242_10005944	Ga0105242_100059445	324
264	3300009177	Ga0105248_10000293	Ga0105248_100002932	324
265	3300009545	Ga0105237_10018742	Ga0105237_100187426	324
266	3300009551	Ga0105238_10006438	Ga0105238_100064385	324
267	3300009553	Ga0105249_10003167	Ga0105249_1000316716	324
268	3300009553	Ga0105249_10008013	Ga0105249_100080132	324
269	3300010375	Ga0105239_10009519	Ga0105239_1000951910	324
270	3300010375	Ga0105239_10124630	Ga0105239_101246302	324
271	3300011119	Ga0105246_10000118	Ga0105246_1000011836	324
272	3300013100	Ga0157373_10022581	Ga0157373_100225814	324
273	3300013102	Ga0157371_10083803	Ga0157371_100838032	324
274	3300013104	Ga0157370_10139202	Ga0157370_101392022	324
275	3300013105	Ga0157369_10005863	Ga0157369_1000586313	324
276	3300013297	Ga0157378_10004472	Ga0157378_100044727	324
277	3300013297	Ga0157378_10542638	Ga0157378_105426382	324
278	3300013306	Ga0163162_10028036	Ga0163162_100280362	324
279	3300013307	Ga0157372_10067440	Ga0157372_100674402	324
280	3300013308	Ga0157375_10030259	Ga0157375_100302594	324
281	3300013308	Ga0157375_10220833	Ga0157375_102208332	324
282	3300013308	Ga0157375_10389316	Ga0157375_103893161	324
283	3300014325	Ga0163163_10013549	Ga0163163_100135496	324
284	3300014326	Ga0157380_10001138	Ga0157380_100011387	324
285	3300014745	Ga0157377_10002755	Ga0157377_100027558	324
286	3300014968	Ga0157379_10000933	Ga0157379_100009335	324
287	3300014969	Ga0157376_10002422	Ga0157376_1000242212	324
288	3300017792	Ga0163161_10004896	Ga0163161_100048965	324
289	3300025898	Ga0207692_10020092	Ga0207692_100200922	324
290	3300025904	Ga0207647_10001565	Ga0207647_100015654	324
291	3300025905	Ga0207685_10112146	Ga0207685_101121462	324
292	3300025907	Ga0207645_10003574	Ga0207645_100035743	324
293	3300025915	Ga0207693_10000703	Ga0207693_1000070326	324
294	3300025924	Ga0207694_10116114	Ga0207694_101161141	324
295	3300025925	Ga0207650_10018670	Ga0207650_100186705	324
296	3300025931	Ga0207644_10033104	Ga0207644_100331042	324
297	3300025933	Ga0207706_10000263	Ga0207706_1000026352	324
298	3300025936	Ga0207670_10003232	Ga0207670_1000323212	324
299	3300025937	Ga0207669_10192244	Ga0207669_101922442	324
300	3300025939	Ga0207665_10004257	Ga0207665_1000425713	324
301	3300025940	Ga0207691_10046132	Ga0207691_100461321	324
302	3300025942	Ga0207689_10008341	Ga0207689_100083418	324
303	3300025944	Ga0207661_10020139	Ga0207661_100201394	324
304	3300025945	Ga0207679_10033477	Ga0207679_100334772	324
305	3300025961	Ga0207712_10005684	Ga0207712_100056842	324
306	3300025961	Ga0207712_10245172	Ga0207712_102451722	324
307	3300025981	Ga0207640_10134716	Ga0207640_101347162	324
308	3300025986	Ga0207658_10022165	Ga0207658_100221655	324
309	3300026035	Ga0207703_10014921	Ga0207703_100149216	324
310	3300026067	Ga0207678_10000209	Ga0207678_100002093	324
311	3300026075	Ga0207708_10000953	Ga0207708_100009537	324
312	3300026116	Ga0207674_10000719	Ga0207674_1000071938	324
313	3300026118	Ga0207675_100001925	Ga0207675_10000192510	324
314	3300026121	Ga0207683_10001900	Ga0207683_100019009	324
315	3300026121	Ga0207683_10278497	Ga0207683_102784971	324
316	3300027907	Ga0207428_10033553	Ga0207428_100335532	324
317	3300028379	Ga0268266_10049143	Ga0268266_100491432	324
318	3300028380	Ga0268265_10008817	Ga0268265_100088174	324
319	3300028381	Ga0268264_10182013	Ga0268264_101820132	324
320	3300031235	Ga0265330_10028136	Ga0265330_100281363	324
321	3300031240	Ga0265320_10015408	Ga0265320_100154087	324
322	3300031241	Ga0265325_10057696	Ga0265325_100576962	324
323	3300031242	Ga0265329_10008688	Ga0265329_100086884	324
324	3300031247	Ga0265340_10101147	Ga0265340_101011472	324
325	3300031247	Ga0265340_10122213	Ga0265340_101222132	324
326	3300031250	Ga0265331_10074339	Ga0265331_100743392	324
327	3300031344	Ga0265316_10192030	Ga0265316_101920302	324
328	3300031595	Ga0265313_10028495	Ga0265313_100284953	324
329	3300031711	Ga0265314_10158033	Ga0265314_101580331	324
330	3300031711	Ga0265314_10243575	Ga0265314_102435751	324
331	3300031712	Ga0265342_10014694	Ga0265342_100146942	324
332	3300031712	Ga0265342_10035992	Ga0265342_100359922	324
333	3300035115	Ga0373941_0077017	Ga0373941_0077017_90_1082	324
334	3300035725	Ga0373947_0001465	Ga0373947_0001465_10918_11892	324
335	3300037068	Ga0373925_0049254	Ga0373925_0049254_345_1319	324
336	3300037418	Ga0395900_0013943	Ga0395900_0013943_5604_6578	324
337	3300037466	Ga0395898_0008941	Ga0395898_0008941_1838_2812	324
338	3300037471	Ga0395905_0002720	Ga0395905_0002720_14257_15231	324
339	3300046455	Ga0495603_0004837	Ga0495603_0004837_1729_2703	324
340	3300046461	Ga0495641_0011447	Ga0495641_0011447_1793_2767	324
341	3300046472	Ga0495580_0027077	Ga0495580_0027077_3173_4147	324
342	3300046473	Ga0495582_0001405	Ga0495582_0001405_6846_7820	324
343	3300046475	Ga0495639_0016537	Ga0495639_0016537_156_1130	324
344	3300046491	Ga0495584_0015186	Ga0495584_0015186_485_1459	324
345	3300046492	Ga0495585_0040052	Ga0495585_0040052_734_1726	324
346	3300046499	Ga0495594_0000336	Ga0495594_0000336_15161_16135	324
347	3300046526	Ga0495666_0073130	Ga0495666_0073130_541_1515	324
348	3300046531	Ga0495665_0023297	Ga0495665_0023297_318_1292	324
349	3300046557	Ga0495622_0026080	Ga0495622_0026080_156_1130	324
350	3300046615	Ga0495656_0040156	Ga0495656_0040156_474_1466	324
351	3300046674	Ga0495588_0002308	Ga0495588_0002308_3089_4063	324
352	3300046689	Ga0495613_0001504	Ga0495613_0001504_5499_6473	324
353	3300047315	Ga0495581_0003643	Ga0495581_0003643_4658_5632	324
354	3300047321	Ga0495676_0073687	Ga0495676_0073687_263_1237	324
355	3300047673	Ga0495593_0002792	Ga0495593_0002792_1206_2180	324
356	3300048903	Ga0496100_0101944	Ga0496100_0101944_665_1639	324
357	3300048903	Ga0496100_0296114	Ga0496100_0296114_17_1009	324
358	3300048904	Ga0496101_0098071	Ga0496101_0098071_991_1965	324
359	3300048904	Ga0496101_0369174	Ga0496101_0369174_40_1032	324
360	3300048905	Ga0496102_0210094	Ga0496102_0210094_249_1223	324
361	3300048905	Ga0496102_0601294	Ga0496102_0601294_15_989	324
362	3300048906	Ga0496103_0017351	Ga0496103_0017351_2789_3781	324
363	3300048907	Ga0496104_0069493	Ga0496104_0069493_578_1552	324
364	3300048907	Ga0496104_0169545	Ga0496104_0169545_164_1138	324
365	3300048907	Ga0496104_0263964	Ga0496104_0263964_160_1134	324
366	3300048908	Ga0496105_0192148	Ga0496105_0192148_110_1084	324
367	3300048909	Ga0496106_0098109	Ga0496106_0098109_936_1910	324
368	3300048909	Ga0496106_0156077	Ga0496106_0156077_42_1034	324
369	3300048910	Ga0496107_0043321	Ga0496107_0043321_1454_2446	324
370	3300048910	Ga0496107_0064725	Ga0496107_0064725_305_1279	324
371	3300048911	Ga0496108_0009814	Ga0496108_0009814_4164_5138	324
372	3300048912	Ga0496109_0222139	Ga0496109_0222139_665_1639	324
373	3300048912	Ga0496109_0278422	Ga0496109_0278422_567_1541	324
374	3300048913	Ga0496110_0007676	Ga0496110_0007676_3713_4687	324
375	3300048913	Ga0496110_0076603	Ga0496110_0076603_1804_2796	324
376	3300048913	Ga0496110_0247708	Ga0496110_0247708_80_1054	324
377	3300048914	Ga0496111_0039224	Ga0496111_0039224_563_1537	324
378	3300048914	Ga0496111_0120891	Ga0496111_0120891_927_1919	324
379	3300048915	Ga0496112_0007236	Ga0496112_0007236_4838_5812	324
380	3300048915	Ga0496112_0139105	Ga0496112_0139105_764_1738	324
381	3300048916	Ga0496113_0129117	Ga0496113_0129117_867_1841	324
382	3300048916	Ga0496113_0194064	Ga0496113_0194064_61_1035	324
383	3300048918	Ga0496115_0227112	Ga0496115_0227112_53_1027	324
384	3300049568	Ga0501031_0097605	Ga0501031_0097605_347_1321	324
385	3300049569	Ga0501032_0209301	Ga0501032_0209301_220_1212	324
386	3300049570	Ga0501033_0067133	Ga0501033_0067133_1479_2471	324
387	3300049570	Ga0501033_0242271	Ga0501033_0242271_275_1267	324
388	3300049572	Ga0501036_0085242	Ga0501036_0085242_1242_2234	324
389	3300049572	Ga0501036_0140934	Ga0501036_0140934_81_1073	324
390	3300049576	Ga0501040_0218820	Ga0501040_0218820_54_1028	324
391	3300049577	Ga0501041_0041225	Ga0501041_0041225_315_1307	324
392	3300049578	Ga0501042_0104432	Ga0501042_0104432_362_1336	324
393	3300049579	Ga0501043_0093941	Ga0501043_0093941_475_1467	324
394	3300049580	Ga0501046_0098389	Ga0501046_0098389_485_1477	324
395	3300049582	Ga0501048_0200578	Ga0501048_0200578_374_1366	324
396	3300049586	Ga0501070_0217166	Ga0501070_0217166_90_1064	324
397	3300049587	Ga0501071_0026338	Ga0501071_0026338_937_1920	324
398	3300049588	Ga0501072_0312794	Ga0501072_0312794_68_1051	324
399	3300049589	Ga0501073_0017226	Ga0501073_0017226_1418_2395	324
400	3300049591	Ga0501075_0045414	Ga0501075_0045414_985_1977	324
401	3300049591	Ga0501075_0183767	Ga0501075_0183767_230_1204	324
402	3300049592	Ga0501076_0072539	Ga0501076_0072539_1450_2442	324
403	3300049592	Ga0501076_0206258	Ga0501076_0206258_58_1032	324
404	3300049592	Ga0501076_0347313	Ga0501076_0347313_181_1173	324
405	3300049593	Ga0501077_0009019	Ga0501077_0009019_1632_2624	324
406	3300049593	Ga0501077_0037294	Ga0501077_0037294_40_1032	324
407	3300049741	Ga0501079_0043328	Ga0501079_0043328_2483_3463	324
408	3300049741	Ga0501079_0114096	Ga0501079_0114096_770_1762	324
409	3300049742	Ga0501080_0290574	Ga0501080_0290574_105_1079	324
410	3300049743	Ga0501081_0063883	Ga0501081_0063883_344_1336	324
411	3300049743	Ga0501081_0094606	Ga0501081_0094606_584_1576	324
412	3300049744	Ga0501083_0047138	Ga0501083_0047138_1566_2558	324
413	3300049824	Ga0501045_0025083	Ga0501045_0025083_1641_2633	324
414	3300050490	nmdc:mga03n38_5371_c1	nmdc:mga03n38_5371_c1_2626_3600	324
415	3300050493	nmdc:mga0k408_91799_c1	nmdc:mga0k408_91799_c1_377_1351	324
416	3300050494	nmdc:mga06z11_32224_c1	nmdc:mga06z11_32224_c1_438_1412	324
417	3300050494	nmdc:mga06z11_6627_c1	nmdc:mga06z11_6627_c1_3121_4095	324
418	3300050507	nmdc:mga05p37_90551_c1	nmdc:mga05p37_90551_c1_1230_2204	324
419	3300050509	nmdc:mga0qj67_420034_c1	nmdc:mga0qj67_420034_c1_57_1049	324
420	3300050510	nmdc:mga06r32_99645_c1	nmdc:mga06r32_99645_c1_782_1774	324
421	3300050513	nmdc:mga0rr50_75731_c1	nmdc:mga0rr50_75731_c1_550_1524	324
422	3300050514	nmdc:mga08x19_18248_c1	nmdc:mga08x19_18248_c1_402_1376	324
423	3300050515	nmdc:mga0a205_15093_c1	nmdc:mga0a205_15093_c1_4368_5342	324
424	3300053077	Ga0495601_0040550	Ga0495601_0040550_1810_2802	324
425	3300053078	Ga0495612_0063817	Ga0495612_0063817_436_1428	324
426	3300053085	Ga0495619_0018964	Ga0495619_0018964_330_1304	324
427	3300060353	Ga0501082_0083517	Ga0501082_0083517_1320_2312	324
428	3300061734	Ga0530510_0021477	Ga0530510_0021477_2846_3820	324
429	iso_pu_bacteria	2842509118	2842510221	324
430	iso_pu_bacteria	2915650412	2915652533	324
431	3300005617	Ga0068859_100061700	Ga0068859_1000617004	325
432	3300006931	Ga0097620_100061702	Ga0097620_1000617022	325
433	3300035695	Ga0373927_0001115	Ga0373927_0001115_15761_16741	325
434	3300037068	Ga0373925_0001344	Ga0373925_0001344_16596_17576	325
435	3300037471	Ga0395905_0002883	Ga0395905_0002883_14837_15817	325
436	3300053142	Ga0500577_0053537	Ga0500577_0053537_61_1041	325
437	3300053156	Ga0500622_0001529	Ga0500622_0001529_15000_15980	325
438	3300002739	JGI25158J39367_1000093	JGI25158J39367_10000935	326
439	3300002773	JGI25152J39213_1002642	JGI25152J39213_10026421	326
440	3300002773	JGI25152J39213_1003082	JGI25152J39213_10030825	326
441	3300002774	JGI25150J39212_1019346	JGI25150J39212_10193461	326
442	3300002987	JGI25159J45721_1006459	JGI25159J45721_10064592	326
443	3300003187	JGI25151J46595_10001628	JGI25151J46595_100016283	326
444	3300003187	JGI25151J46595_10032745	JGI25151J46595_100327452	326
445	3300003214	JGI25165J46597_1004185	JGI25165J46597_10041852	326
446	3300003322	rootL2_10154185	rootL2_101541852	326
447	3300003354	JGI25160J50197_1000004	JGI25160J50197_100000460	326
448	3300003374	JGI25161J50226_1000003	JGI25161J50226_1000003368	326
449	3300003771	Ga0055526_1004175	Ga0055526_10041759	326
450	3300003775	Ga0055524_1038072	Ga0055524_10380721	326
451	3300004625	Ga0055543_1000001	Ga0055543_1000001374	326
452	3300005262	Ga0065165_1000049	Ga0065165_100004938	326
453	3300005563	Ga0068855_100361542	Ga0068855_1003615422	326
454	3300005616	Ga0068852_100337042	Ga0068852_1003370422	326
455	3300006038	Ga0075365_10007848	Ga0075365_100078484	326
456	3300006178	Ga0075367_10004207	Ga0075367_100042072	326
457	3300006871	Ga0075434_100206644	Ga0075434_1002066442	326
458	3300009093	Ga0105240_10000005	Ga0105240_10000005364	326
459	3300009094	Ga0111539_10145515	Ga0111539_101455152	326
460	3300009148	Ga0105243_10048118	Ga0105243_100481183	326
461	3300009545	Ga0105237_10000708	Ga0105237_1000070830	326
462	3300010375	Ga0105239_10005075	Ga0105239_1000507512	326
463	3300013104	Ga0157370_10000284	Ga0157370_1000028446	326
464	3300014497	Ga0182008_10052531	Ga0182008_100525312	326
465	3300014968	Ga0157379_10186431	Ga0157379_101864311	326
466	3300015262	Ga0182007_10019669	Ga0182007_100196692	326
467	3300015265	Ga0182005_1010446	Ga0182005_10104463	326
468	3300025208	Ga0209436_104465	Ga0209436_1044654	326
469	3300025253	Ga0209677_103385	Ga0209677_1033853	326
470	3300025261	Ga0209233_1000269	Ga0209233_100026926	326
471	3300025284	Ga0209130_1000012	Ga0209130_100001260	326
472	3300025302	Ga0207426_1000010	Ga0207426_1000010419	326
473	3300025913	Ga0207695_10000011	Ga0207695_10000011551	326
474	3300025914	Ga0207671_10000544	Ga0207671_1000054419	326
475	3300025933	Ga0207706_10252589	Ga0207706_102525892	326
476	3300025935	Ga0207709_10145492	Ga0207709_101454922	326
477	3300025949	Ga0207667_10347475	Ga0207667_103474752	326
478	3300026118	Ga0207675_100049547	Ga0207675_1000495474	326
479	3300027717	Ga0209998_10003091	Ga0209998_100030913	326
480	3300031911	Ga0307412_10011360	Ga0307412_100113606	326
481	3300041413	Ga0439465_0007850	Ga0439465_0007850_143_1123	326
482	3300041491	Ga0451833_0253399	Ga0451833_0253399_1582_2562	326
483	3300046460	Ga0495638_0000335	Ga0495638_0000335_36684_37664	326
484	3300046471	Ga0495650_0085693	Ga0495650_0085693_196_1179	326
485	3300046474	Ga0495605_0001291	Ga0495605_0001291_10282_11262	326
486	3300046507	Ga0495606_0163624	Ga0495606_0163624_304_1284	326
487	3300046810	Ga0495660_0032458	Ga0495660_0032458_352_1332	326
488	3300047443	Ga0495687_021842	Ga0495687_021842_488_1474	326
489	3300048905	Ga0496102_0129534	Ga0496102_0129534_473_1453	326
490	3300048906	Ga0496103_0147097	Ga0496103_0147097_25_1005	326
491	3300048919	Ga0496116_0095302	Ga0496116_0095302_792_1772	326
492	3300048920	Ga0496117_0000338	Ga0496117_0000338_23375_24355	326
493	3300048921	Ga0496118_0001299	Ga0496118_0001299_23655_24635	326
494	3300048922	Ga0496119_0115298	Ga0496119_0115298_349_1329	326
495	3300048924	Ga0496121_0003368	Ga0496121_0003368_12976_13956	326
496	3300048924	Ga0496121_0184407	Ga0496121_0184407_109_1089	326
497	3300048926	Ga0496123_0018423	Ga0496123_0018423_473_1453	326
498	3300048927	Ga0496124_0021817	Ga0496124_0021817_1278_2258	326
499	3300048927	Ga0496124_0068871	Ga0496124_0068871_735_1715	326
500	3300048928	Ga0496125_0023168	Ga0496125_0023168_342_1322	326
501	3300049568	Ga0501031_0101590	Ga0501031_0101590_278_1330	326
502	3300049569	Ga0501032_0041409	Ga0501032_0041409_969_2021	326
503	3300049572	Ga0501036_0017862	Ga0501036_0017862_2212_3264	326
504	3300049574	Ga0501038_0013946	Ga0501038_0013946_4608_5660	326
505	3300049575	Ga0501039_0028581	Ga0501039_0028581_1351_2403	326
506	3300049576	Ga0501040_0010870	Ga0501040_0010870_3072_4124	326
507	3300049577	Ga0501041_0008610	Ga0501041_0008610_1716_2768	326
508	3300049578	Ga0501042_0023228	Ga0501042_0023228_1827_2879	326
509	3300049579	Ga0501043_0069410	Ga0501043_0069410_398_1450	326
510	3300049580	Ga0501046_0040482	Ga0501046_0040482_171_1223	326
511	3300049584	Ga0501068_0031881	Ga0501068_0031881_944_1996	326
512	3300049586	Ga0501070_0079911	Ga0501070_0079911_746_1798	326
513	3300049587	Ga0501071_0011184	Ga0501071_0011184_3982_5034	326
514	3300049588	Ga0501072_0007185	Ga0501072_0007185_5433_6485	326
515	3300049590	Ga0501074_0018269	Ga0501074_0018269_2376_3428	326
516	3300049591	Ga0501075_0010371	Ga0501075_0010371_3058_4110	326
517	3300049592	Ga0501076_0005048	Ga0501076_0005048_6297_7349	326
518	3300049593	Ga0501077_0004400	Ga0501077_0004400_1620_2672	326
519	3300049742	Ga0501080_0022085	Ga0501080_0022085_3513_4565	326
520	3300049743	Ga0501081_0013974	Ga0501081_0013974_1634_2686	326
521	3300049822	Ga0501035_0120705	Ga0501035_0120705_1224_2276	326
522	3300049823	Ga0501044_0146675	Ga0501044_0146675_691_1743	326
523	3300049824	Ga0501045_0012769	Ga0501045_0012769_1656_2708	326
524	3300050494	nmdc:mga06z11_105198_c1	nmdc:mga06z11_105198_c1_82_1062	326
525	3300050512	nmdc:mga0n895_120186_c1	nmdc:mga0n895_120186_c1_337_1335	326
526	3300053079	Ga0500610_0014034	Ga0500610_0014034_232_1212	326
527	3300054114	Ga0501084_0041723	Ga0501084_0041723_1619_2671	326
528	3300060353	Ga0501082_0041539	Ga0501082_0041539_1543_2595	326
529	3300061734	Ga0530510_0009380	Ga0530510_0009380_3018_4070	326
530	3300001979	JGI24740J21852_10000001	JGI24740J21852_1000000130	327
531	3300002704	JGI25155J39150_1000011	JGI25155J39150_1000011152	327
532	3300002705	JGI25156J39149_1000030	JGI25156J39149_100003066	327
533	3300002737	JGI25162J39368_1000387	JGI25162J39368_100038715	327
534	3300002737	JGI25162J39368_1000638	JGI25162J39368_10006386	327
535	3300002738	JGI25154J39366_1000057	JGI25154J39366_100005779	327
536	3300002741	JGI25157J39369_1000010	JGI25157J39369_100001060	327
537	3300003214	JGI25165J46597_1000189	JGI25165J46597_100018982	327
538	3300003214	JGI25165J46597_1001157	JGI25165J46597_100115712	327
539	3300003316	rootH1_10073327	rootH1_100733273	327
540	3300003320	rootH2_10151523	rootH2_101515236	327
541	3300003322	rootL2_10027690	rootL2_100276905	327
542	3300005614	Ga0068856_100032357	Ga0068856_1000323572	327
543	3300025206	Ga0209435_100022	Ga0209435_10002258	327
544	3300025233	Ga0209437_100122	Ga0209437_100122194	327
545	3300025233	Ga0209437_100160	Ga0209437_10016057	327
546	3300025246	Ga0209646_1000078	Ga0209646_100007858	327
547	3300025250	Ga0209026_1000065	Ga0209026_100006558	327
548	3300025256	Ga0209759_1000055	Ga0209759_100005558	327
549	3300025261	Ga0209233_1000168	Ga0209233_1000168103	327
550	3300025261	Ga0209233_1000317	Ga0209233_100031722	327
551	3300026078	Ga0207702_10023532	Ga0207702_100235322	327
552	3300027312	Ga0209371_1012481	Ga0209371_10124812	327
553	3300030500	Ga0268256_1013616	Ga0268256_10136162	327
554	3300044765	Ga0466970_0007357	Ga0466970_0007357_435_1418	327
555	3300045976	Ga0466967_0186835	Ga0466967_0186835_380_1363	327
556	3300046507	Ga0495606_0010518	Ga0495606_0010518_2865_3848	327
557	3300048904	Ga0496101_0024355	Ga0496101_0024355_2238_3221	327
558	3300048925	Ga0496122_0039438	Ga0496122_0039438_2322_3305	327
559	3300048926	Ga0496123_0051415	Ga0496123_0051415_1285_2268	327
560	3300048927	Ga0496124_0041576	Ga0496124_0041576_575_1558	327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

153

285

0.9 PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

186

325

0.81 PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

29

139

0.76 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1qor-assembly1.cif.gz_B	crystal structure of escherichia coli quinone oxidoreductase complexed with nadph	0.9794	5	327
1qor-assembly1.cif.gz_B	crystal structure of escherichia coli quinone oxidoreductase complexed with nadph	0.9676	5	327
4rvu-assembly2.cif.gz_C	the native structure of mycobacterial rv1454c complexed with nadph	0.9572	5	327
3jyl-assembly1.cif.gz_A	crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase	0.9538	4	327
8j6e-assembly1.cif.gz_A	structure insights into the nadph quinone oxidoreductase from leishmania donovani	0.9533	4	326

ID	Description	Score	Start	End	Superfamily
af_I1LVH0_176_320_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9892	126	271	3.40.50.720
af_Q336S6_1_326_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9841	2	327	3.90.180.10
af_I1LVH0_49_172_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9795	2	121	3.90.180.10
af_P28304_2_327_2.170.150.20	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase.	0.9793	5	327	2.170.150.20
af_I1LVH0_176_320_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9758	126	271	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A528FI11-F1-model_v4	Quinone oxidoreductase	0.9947	110	327	GO:0003960 GO:0005829 GO:0008270 GO:0035925 GO:0070402
AF-A0A4V1TF63-F1-model_v4	Quinone oxidoreductase	0.9937	145	327	GO:0003960 GO:0005829 GO:0035925 GO:0070402
AF-A0A5B7AB61-F1-model_v4	Putative quinone oxidoreductase isoform X2 (EC 1.6.5.5)	0.9927	123	327	GO:0003960 GO:0005829 GO:0035925 GO:0070402
AF-A0A7U7GCB8-F1-model_v4	Quinone oxidoreductase, NADPH-dependent (EC 1.6.5.5)	0.9905	4	327	GO:0003960 GO:0005829 GO:0008270 GO:0035925 GO:0070402
AF-A0A699GSK4-F1-model_v4	GroES-like zinc-binding alcohol dehydrogenase family protein	0.9904	123	327	GO:0003960 GO:0005829 GO:0035925 GO:0070402

Feature Viewer

pLDDT	pTM	Quality
95.74	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F463635

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

153

285

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

186

325

0.81

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

29

139

0.76

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map