F463728

General Info

Members Datasets Scaffolds Average Seq Length
560 268 494 193

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0307043|Ga0453684_0307043_737_1372
Length 211
Sequence MRLNPLINQRIIRRFYKGLCMTEYLLILVGTVFVNNIVMVKILGLCPFMGVSKKLEAAVGMGAATTFVLTLGSGASYLIQHYLLGPDLAYLTTLSFIVVIAGIVQFTEMVVQKTSPALYQVLGIYLPLITTNCAVLGIPLLNVQAKHDFMESLLFGFGGAVGFTLVMVLFAGIRERLEGADVPVIFKGSAIAMITAGLMSLTFMGFSGLVK

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
5 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
6 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
7 2547132512 Azospira oryzae 6a3 Isolate Unclassified
8 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
9 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
10 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
11 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
12 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
13 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
14 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
15 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
16 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
17 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
18 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
19 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
20 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
21 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
22 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
23 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
24 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
25 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
26 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
27 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
28 2847085930 Erwinia persicina B64 Isolate Bulb
29 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
30 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
31 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
32 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
33 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
34 2865014394 Pantoea sp. R-71966 Isolate Unclassified
35 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
36 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
37 2876601092 Pantoea endophytica 596 Isolate Unclassified
38 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
39 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
40 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
41 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
42 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
43 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
44 2904504865 Serratia marcescens 1822 Isolate Unclassified
45 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
46 2919150387 Rahnella aceris 1817 Isolate Unclassified
47 2927143783 Rahnella sp. 2050 Isolate Unclassified
48 2932406140 Serratia sp. 2723 Isolate Rhizosphere
49 2937967321 Serratia sp. YC16 Isolate Unclassified
50 2939577877 Serratia sp. 509 Isolate Rhizosphere
51 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
52 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
53 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
54 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
55 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
56 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
57 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
58 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
59 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
60 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
61 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
62 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
63 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
64 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
128 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
152 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
157 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
158 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
172 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
173 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
174 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
175 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
176 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
179 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
180 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
181 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
247 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 639633007 Azoarcus olearius BH72 Isolate Unclassified
261 640753048 Serratia proteamaculans 568 Isolate Endosphere
262 8004592986 Serratia sp. S119 Isolate Unclassified
263 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
264 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
265 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
266 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
267 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
268 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.43
Metatranscriptomes 6.79
Isolates 11.79

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0.18
Endosphere 4.29
Nodule 0.71
Rhizoplane 2.32
Rhizosphere 77.86
Stem 0
Stem Tuber 0.71
Unclassified 13.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25163J39215_1000150 3300002771 Bacteria 27415
2 JGI25164J39214_1000002 3300002772 Bacteria 406570
3 Ga0055538_1000015 3300003751 Bacteria 311166
4 Ga0055539_1000009 3300003752 Bacteria 406566
5 Ga0055533_1000012 3300003756 Bacteria 406566
6 Ga0055525_1000014 3300003759 Bacteria 406566
7 Ga0055541_1000006 3300003841 Bacteria 406566
8 Ga0058692_1000066 3300003856 Bacteria 89302
9 Ga0058692_1000072 3300003856 Bacteria 77728
10 Ga0065704_10000959 3300005289 Bacteria 34794
11 Ga0070676_10101840 3300005328 Bacteria 1775
12 Ga0070660_100681644 3300005339 Bacteria 861
13 Ga0070668_100008502 3300005347 Bacteria 7625
14 Ga0070669_100025230 3300005353 Bacteria 4269
15 Ga0070674_100035871 3300005356 Bacteria 3324
16 Ga0070703_10112111 3300005406 Bacteria 977
17 Ga0070662_100078587 3300005457 Bacteria 2451
18 Ga0070699_100036733 3300005518 Bacteria 4238
19 Ga0070672_100045098 3300005543 Bacteria 3408
20 Ga0068857_100669723 3300005577 Bacteria 984
21 Ga0068861_100599871 3300005719 Bacteria 1010
22 Ga0068862_100046646 3300005844 Bacteria 3696
23 Ga0075364_10109799 3300006051 Bacteria 1840
24 Ga0075428_100264649 3300006844 Bacteria 1851
25 Ga0075430_100694813 3300006846 Bacteria 839
26 Ga0075431_100055162 3300006847 Bacteria 4099
27 Ga0075429_100101975 3300006880 Bacteria 2505
28 Ga0075429_100228159 3300006880 Bacteria 1631
29 Ga0079104_1000292 3300006946 Bacteria 63382
30 Ga0079104_1002042 3300006946 Bacteria 11744
31 Ga0105251_10000002 3300009011 Bacteria 350843
32 Ga0105251_10000462 3300009011 Bacteria 38817
33 Ga0105251_10000668 3300009011 Bacteria 31643
34 Ga0105251_10000978 3300009011 Bacteria 25288
35 Ga0105251_10010712 3300009011 Bacteria 5290
36 Ga0105251_10012905 3300009011 Bacteria 4700
37 Ga0105251_10064519 3300009011 Bacteria 1716
38 Ga0105251_10132017 3300009011 Bacteria 1131
39 Ga0105244_10000645 3300009036 Bacteria 30769
40 Ga0105244_10000960 3300009036 Bacteria 24197
41 Ga0105244_10001340 3300009036 Bacteria 20097
42 Ga0105244_10001722 3300009036 Bacteria 17235
43 Ga0105244_10002160 3300009036 Bacteria 15082
44 Ga0105244_10003297 3300009036 Bacteria 11626
45 Ga0105244_10031854 3300009036 Bacteria 2797
46 Ga0105250_10000002 3300009092 Bacteria 566949
47 Ga0105250_10000619 3300009092 Bacteria 23016
48 Ga0105250_10000837 3300009092 Bacteria 18280
49 Ga0105250_10004014 3300009092 Bacteria 6860
50 Ga0105250_10008934 3300009092 Bacteria 4239
51 Ga0111539_10008302 3300009094 Bacteria 13218
52 Ga0111539_10278802 3300009094 Bacteria 1945
53 Ga0105247_10000129 3300009101 Bacteria 73190
54 Ga0114129_10430974 3300009147 Bacteria 1732
55 Ga0105241_10000002 3300009174 Bacteria 869480
56 Ga0105246_10091157 3300011119 Bacteria 2196
57 Ga0105246_10469960 3300011119 Bacteria 1061
58 Ga0157373_10000405 3300013100 Bacteria 34603
59 Ga0157373_10003517 3300013100 Bacteria 11843
60 Ga0157373_10009834 3300013100 Bacteria 7051
61 Ga0157373_10028548 3300013100 Bacteria 4025
62 Ga0157373_10122358 3300013100 Bacteria 1829
63 Ga0157371_10000008 3300013102 Bacteria 393028
64 Ga0157371_10005712 3300013102 Bacteria 10430
65 Ga0157371_10007075 3300013102 Bacteria 9123
66 Ga0157371_10015776 3300013102 Bacteria 5653
67 Ga0157370_10000064 3300013104 Bacteria 114340
68 Ga0157370_10003634 3300013104 Bacteria 18031
69 Ga0157369_10177615 3300013105 Bacteria 2241
70 Ga0163162_10040950 3300013306 Bacteria 4634
71 Ga0163162_10105162 3300013306 Bacteria 2917
72 Ga0163162_10119886 3300013306 Bacteria 2734
73 Ga0163162_10990729 3300013306 Bacteria 950
74 Ga0157372_10016000 3300013307 Bacteria 8046
75 Ga0157372_10057410 3300013307 Bacteria 4351
76 Ga0157372_10111483 3300013307 Bacteria 3134
77 Ga0157372_10150255 3300013307 Bacteria 2688
78 Ga0157372_10150703 3300013307 Bacteria 2684
79 Ga0157372_10208820 3300013307 Bacteria 2262
80 Ga0157372_10208997 3300013307 Bacteria 2261
81 Ga0157380_10308383 3300014326 Bacteria 1461
82 Ga0182008_10001733 3300014497 Bacteria 14318
83 Ga0163161_10000001 3300017792 Bacteria 2041488
84 Ga0163161_10036661 3300017792 Bacteria 3513
85 Ga0209760_100051 3300025207 Bacteria 105257
86 Ga0209760_103221 3300025207 Bacteria 1461
87 Ga0209784_100001 3300025224 Bacteria 3600592
88 Ga0209566_100001 3300025225 Bacteria 3600765
89 Ga0209674_100002 3300025226 Bacteria 3600592
90 Ga0209563_100002 3300025230 Bacteria 2045675
91 Ga0207427_100020 3300025231 Bacteria 507515
92 Ga0209437_100001 3300025233 Bacteria 2045675
93 Ga0209437_100109 3300025233 Bacteria 217031
94 Ga0209437_100111 3300025233 Bacteria 214944
95 Ga0209677_100002 3300025253 Bacteria 2045675
96 Ga0209233_1007860 3300025261 Bacteria 3344
97 Ga0207696_1000001 3300025711 Bacteria 2579611
98 Ga0207696_1000086 3300025711 Bacteria 194626
99 Ga0207696_1000292 3300025711 Bacteria 58466
100 Ga0207696_1001252 3300025711 Bacteria 14282
101 Ga0207696_1005788 3300025711 Bacteria 5078
102 Ga0207655_1000037 3300025728 Bacteria 354473
103 Ga0207655_1000069 3300025728 Bacteria 239968
104 Ga0207655_1000413 3300025728 Bacteria 58877
105 Ga0207655_1000853 3300025728 Bacteria 32501
106 Ga0207655_1001583 3300025728 Bacteria 20414
107 Ga0207655_1002281 3300025728 Bacteria 15795
108 Ga0207655_1005502 3300025728 Bacteria 8593
109 Ga0207655_1049009 3300025728 Bacteria 1729
110 Ga0207655_1064699 3300025728 Bacteria 1393
111 Ga0207655_1120464 3300025728 Bacteria 870
112 Ga0207713_1000001 3300025735 Bacteria 2295391
113 Ga0207713_1000008 3300025735 Bacteria 553952
114 Ga0207713_1000016 3300025735 Bacteria 421689
115 Ga0207713_1000916 3300025735 Bacteria 26485
116 Ga0207713_1014127 3300025735 Bacteria 4167
117 Ga0207713_1023907 3300025735 Bacteria 2862
118 Ga0207713_1049323 3300025735 Bacteria 1689
119 Ga0207713_1052024 3300025735 Bacteria 1625
120 Ga0207713_1070731 3300025735 Bacteria 1289
121 Ga0207642_10186930 3300025899 Bacteria 1133
122 Ga0207710_10000113 3300025900 Bacteria 102300
123 Ga0207645_10000895 3300025907 Bacteria 24726
124 Ga0207643_10003637 3300025908 Bacteria 8312
125 Ga0207654_10000005 3300025911 Bacteria 869492
126 Ga0207660_10231082 3300025917 Bacteria 1454
127 Ga0207706_10001580 3300025933 Bacteria 22595
128 Ga0207669_10963682 3300025937 Bacteria 715
129 Ga0207691_10008966 3300025940 Bacteria 9595
130 Ga0207668_10126613 3300025972 Bacteria 1943
131 Ga0207668_10252524 3300025972 Bacteria 1433
132 Ga0207648_10001051 3300026089 Bacteria 30933
133 Ga0207674_10687315 3300026116 Bacteria 988
134 Ga0207675_100011630 3300026118 Bacteria 8229
135 Ga0209281_1000003 3300027111 Bacteria 1260089
136 Ga0209281_1000181 3300027111 Bacteria 146200
137 Ga0209371_1000005 3300027312 Bacteria 1061740
138 Ga0209371_1000124 3300027312 Bacteria 131108
139 Ga0209371_1000183 3300027312 Bacteria 91570
140 Ga0209371_1000212 3300027312 Bacteria 80989
141 Ga0209371_1001786 3300027312 Bacteria 13463
142 Ga0209371_1002558 3300027312 Bacteria 10044
143 Ga0209371_1003308 3300027312 Bacteria 7965
144 Ga0209371_1004008 3300027312 Bacteria 6682
145 Ga0209371_1006965 3300027312 Bacteria 4053
146 Ga0209982_1008688 3300027552 Bacteria 1493
147 Ga0209970_1002977 3300027614 Bacteria 2859
148 Ga0209983_1002519 3300027665 Bacteria 4000
149 Ga0209971_1000377 3300027682 Bacteria 12230
150 Ga0209974_10011562 3300027876 Bacteria 2962
151 Ga0207428_10085280 3300027907 Bacteria 2460
152 Ga0207428_10767260 3300027907 Bacteria 686
153 Ga0268265_10267766 3300028380 Bacteria 1522
154 Ga0265336_10001293 3300028666 Bacteria 11743
155 Ga0265324_10000001 3300029957 Bacteria 562975
156 Ga0265324_10000160 3300029957 Bacteria 52007
157 Ga0265324_10099453 3300029957 Bacteria 989
158 Ga0268256_1000006 3300030500 Bacteria 1063991
159 Ga0268256_1000155 3300030500 Bacteria 91570
160 Ga0268256_1000186 3300030500 Bacteria 73618
161 Ga0268256_1001014 3300030500 Bacteria 18957
162 Ga0268256_1001115 3300030500 Bacteria 17475
163 Ga0268256_1001689 3300030500 Bacteria 12600
164 Ga0268256_1003739 3300030500 Bacteria 6682
165 Ga0268256_1007099 3300030500 Bacteria 4053
166 Ga0268256_1014882 3300030500 Bacteria 2289
167 Ga0265330_10003523 3300031235 Bacteria 8159
168 Ga0265332_10000016 3300031238 Bacteria 229887
169 Ga0265332_10001660 3300031238 Bacteria 12164
170 Ga0265328_10000021 3300031239 Bacteria 125696
171 Ga0265328_10021150 3300031239 Bacteria 2486
172 Ga0265328_10033750 3300031239 Bacteria 1896
173 Ga0265328_10199756 3300031239 Bacteria 759
174 Ga0265325_10000150 3300031241 Bacteria 49297
175 Ga0265325_10004569 3300031241 Bacteria 8708
176 Ga0265331_10000044 3300031250 Bacteria 186644
177 Ga0265331_10003477 3300031250 Bacteria 10157
178 Ga0265331_10005818 3300031250 Bacteria 7388
179 Ga0265327_10000102 3300031251 Bacteria 186668
180 Ga0265327_10000583 3300031251 Bacteria 61267
181 Ga0265327_10000706 3300031251 Bacteria 52819
182 Ga0265327_10004647 3300031251 Bacteria 12043
183 Ga0265327_10005149 3300031251 Bacteria 11087
184 Ga0265327_10026240 3300031251 Bacteria 3379
185 Ga0265316_10101082 3300031344 Bacteria 2191
186 Ga0265316_10344190 3300031344 Bacteria 1080
187 Ga0307508_10002254 3300031616 Bacteria 20561
188 Ga0316575_10000017 3300031665 Bacteria 43424
189 Ga0316575_10003969 3300031665 Bacteria 5179
190 Ga0316575_10017854 3300031665 Bacteria 2699
191 Ga0316575_10150683 3300031665 Bacteria 959
192 Ga0316579_10000486 3300031691 Bacteria 12928
193 Ga0316579_10000793 3300031691 Bacteria 10883
194 Ga0316579_10088223 3300031691 Bacteria 1480
195 Ga0316579_10140425 3300031691 Bacteria 1164
196 Ga0265314_10000185 3300031711 Bacteria 92226
197 Ga0265314_10040899 3300031711 Bacteria 3323
198 Ga0316576_10000048 3300031727 Bacteria 37298
199 Ga0316576_10001109 3300031727 Bacteria 14064
200 Ga0316576_10002746 3300031727 Bacteria 10092
201 Ga0316576_10008482 3300031727 Bacteria 6560
202 Ga0316576_10021236 3300031727 Bacteria 4486
203 Ga0316576_10028393 3300031727 Bacteria 3943
204 Ga0316576_10038117 3300031727 Bacteria 3444
205 Ga0316576_10085243 3300031727 Bacteria 2348
206 Ga0316576_10093097 3300031727 Bacteria 2246
207 Ga0316576_10143057 3300031727 Bacteria 1801
208 Ga0316576_10271713 3300031727 Bacteria 1270
209 Ga0316578_10002436 3300031728 Bacteria 8163
210 Ga0316578_10004122 3300031728 Bacteria 6803
211 Ga0316578_10004817 3300031728 Bacteria 6439
212 Ga0316578_10011206 3300031728 Bacteria 4680
213 Ga0316578_10013571 3300031728 Bacteria 4325
214 Ga0316578_10018521 3300031728 Bacteria 3818
215 Ga0316578_10079611 3300031728 Bacteria 1948
216 Ga0316577_10002072 3300031733 Bacteria 9800
217 Ga0316577_10013439 3300031733 Bacteria 4474
218 Ga0316577_10022059 3300031733 Bacteria 3534
219 Ga0316577_10160927 3300031733 Bacteria 1266
220 Ga0307412_10097854 3300031911 Bacteria 2068
221 Ga0307411_10075653 3300032005 Bacteria 2299
222 Ga0316583_10000284 3300032133 Bacteria 14149
223 Ga0316583_10000581 3300032133 Bacteria 11084
224 Ga0316583_10014919 3300032133 Bacteria 2796
225 Ga0316583_10190045 3300032133 Bacteria 713
226 Ga0316585_10000227 3300032137 Bacteria 11772
227 Ga0316585_10001260 3300032137 Bacteria 6617
228 Ga0316585_10022216 3300032137 Bacteria 1951
229 Ga0316580_10000210 3300032139 Bacteria 12040
230 Ga0316580_10000404 3300032139 Bacteria 9759
231 Ga0316580_10003636 3300032139 Bacteria 4403
232 Ga0316580_10010304 3300032139 Bacteria 2821
233 Ga0316580_10028474 3300032139 Bacteria 1727
234 Ga0316593_10005651 3300032168 Bacteria 3317
235 Ga0316593_10006267 3300032168 Bacteria 3200
236 Ga0316593_10015437 3300032168 Bacteria 2298
237 Ga0316593_10040046 3300032168 Bacteria 1556
238 Ga0316593_10055769 3300032168 Bacteria 1343
239 Ga0316593_10080597 3300032168 Bacteria 1136
240 Ga0316593_10172461 3300032168 Bacteria 793
241 Ga0316592_1003001 3300033524 Bacteria 2984
242 Ga0316592_1005201 3300033524 Bacteria 2458
243 Ga0316592_1008233 3300033524 Bacteria 2053
244 Ga0316592_1013355 3300033524 Bacteria 1692
245 Ga0316592_1024706 3300033524 Bacteria 1293
246 Ga0316592_1085858 3300033524 Bacteria 718
247 Ga0316586_1002436 3300033527 Bacteria 2317
248 Ga0316586_1005784 3300033527 Bacteria 1753
249 Ga0316586_1029867 3300033527 Bacteria 930
250 Ga0316588_1000062 3300033528 Bacteria 9190
251 Ga0316588_1001775 3300033528 Bacteria 3638
252 Ga0316588_1006951 3300033528 Bacteria 2282
253 Ga0316588_1007295 3300033528 Bacteria 2241
254 Ga0316588_1010900 3300033528 Bacteria 1927
255 Ga0316588_1013122 3300033528 Bacteria 1793
256 Ga0316588_1018823 3300033528 Bacteria 1550
257 Ga0316588_1029064 3300033528 Bacteria 1292
258 Ga0316588_1040220 3300033528 Bacteria 1116
259 Ga0316587_1000044 3300033529 Bacteria 7886
260 Ga0316587_1007158 3300033529 Bacteria 1727
261 Ga0316587_1007881 3300033529 Bacteria 1665
262 Ga0316587_1011010 3300033529 Bacteria 1454
263 Ga0316587_1013423 3300033529 Bacteria 1342
264 Ga0316587_1016306 3300033529 Bacteria 1239
265 Ga0316587_1047376 3300033529 Bacteria 784
266 Ga0316596_1000361 3300033541 Bacteria 7447
267 Ga0316596_1000460 3300033541 Bacteria 6830
268 Ga0316596_1000509 3300033541 Bacteria 6632
269 Ga0316596_1002694 3300033541 Bacteria 3818
270 Ga0316596_1016079 3300033541 Bacteria 1872
271 Ga0316596_1056055 3300033541 Bacteria 1047
272 Ga0373928_0013106 3300035084 Bacteria 1662
273 Ga0373952_0011706 3300035092 Bacteria 1714
274 Ga0373960_0125980 3300035121 Bacteria 854
275 Ga0316574_0000454 3300035398 Bacteria 16449
276 Ga0316574_0002628 3300035398 Bacteria 9061
277 Ga0316574_0021643 3300035398 Bacteria 3820
278 Ga0316574_0034720 3300035398 Bacteria 3076
279 Ga0316574_0055377 3300035398 Bacteria 2479
280 Ga0316574_0132932 3300035398 Bacteria 1601
281 Ga0316574_0257641 3300035398 Bacteria 1114
282 Ga0316574_0680590 3300035398 Bacteria 632
283 Ga0373937_0478855 3300036401 Bacteria 1182
284 Ga0316582_0011060 3300036647 Bacteria 4976
285 Ga0316582_0014082 3300036647 Bacteria 4528
286 Ga0316582_0021070 3300036647 Bacteria 3843
287 Ga0316582_0069312 3300036647 Bacteria 2279
288 Ga0316582_0300208 3300036647 Bacteria 1103
289 Ga0316582_0439889 3300036647 Bacteria 899
290 Ga0316584_0000920 3300036712 Bacteria 16757
291 Ga0316584_0003388 3300036712 Bacteria 10336
292 Ga0316584_0006000 3300036712 Bacteria 8203
293 Ga0316584_0010062 3300036712 Bacteria 6591
294 Ga0316584_0037253 3300036712 Bacteria 3612
295 Ga0316584_0061067 3300036712 Bacteria 2823
296 Ga0316584_0078217 3300036712 Bacteria 2477
297 Ga0316584_0100020 3300036712 Bacteria 2171
298 Ga0316584_0114813 3300036712 Bacteria 2014
299 Ga0316584_0308385 3300036712 Bacteria 1144
300 Ga0316581_0006290 3300037588 Bacteria 3134
301 Ga0316581_0007113 3300037588 Bacteria 2989
302 Ga0316581_0108832 3300037588 Bacteria 853
303 Ga0400483_203625 3300039062 Bacteria 1198
304 Ga0400489_09975 3300039093 Bacteria 1366
305 Ga0439438_000001 3300041405 Bacteria 1263568
306 Ga0439438_011191 3300041405 Bacteria 2804
307 Ga0439438_015618 3300041405 Bacteria 2228
308 Ga0439447_006900 3300041407 Bacteria 3640
309 Ga0439447_014794 3300041407 Bacteria 2178
310 Ga0439466_0000091 3300041411 Bacteria 35463
311 Ga0439432_032573 3300042006 Bacteria 1680
312 Ga0439432_058517 3300042006 Bacteria 1191
313 Ga0439452_000001 3300042010 Bacteria 1725439
314 Ga0450923_097960 3300042125 Bacteria 674
315 Ga0450896_048037 3300042133 Bacteria 676
316 Ga0450907_006976 3300042146 Bacteria 1884
317 Ga0439460_0042210 3300042461 Bacteria 1343
318 Ga0451577_0000002 3300042876 Bacteria 1731375
319 Ga0451577_0000384 3300042876 Bacteria 82022
320 Ga0451577_0037303 3300042876 Bacteria 4375
321 Ga0451577_0155664 3300042876 Bacteria 2057
322 Ga0451577_0320696 3300042876 Bacteria 1405
323 Ga0451577_0602960 3300042876 Bacteria 996
324 Ga0451577_1010634 3300042876 Bacteria 746
325 Ga0451577_1338617 3300042876 Bacteria 636
326 Ga0453683_0000011 3300044673 Bacteria 412765
327 Ga0453683_0019159 3300044673 Bacteria 4384
328 Ga0453683_0284311 3300044673 Bacteria 1057
329 Ga0453684_0000002 3300044712 Bacteria 1731375
330 Ga0453684_0000005 3300044712 Bacteria 1431632
331 Ga0453684_0000040 3300044712 Bacteria 690210
332 Ga0453684_0000341 3300044712 Bacteria 194228
333 Ga0453684_0000511 3300044712 Bacteria 150804
334 Ga0453684_0001222 3300044712 Bacteria 78832
335 Ga0453684_0014784 3300044712 Bacteria 12438
336 Ga0453684_0125783 3300044712 Bacteria 3086
337 Ga0453684_0304918 3300044712 Bacteria 1809
338 Ga0453684_0307043 3300044712 Bacteria 1802
339 Ga0453684_0592851 3300044712 Bacteria 1216
340 Ga0453684_1173088 3300044712 Bacteria 808
341 Ga0453684_1609325 3300044712 Bacteria 666
342 Ga0451576_0000004 3300045051 Bacteria 1312238
343 Ga0451576_0000013 3300045051 Bacteria 665120
344 Ga0451576_0000266 3300045051 Bacteria 127813
345 Ga0451576_0000570 3300045051 Bacteria 78726
346 Ga0451576_0002354 3300045051 Bacteria 28515
347 Ga0451576_0005904 3300045051 Bacteria 15195
348 Ga0451576_0007888 3300045051 Bacteria 12611
349 Ga0451576_0035161 3300045051 Bacteria 5317
350 Ga0451576_0063004 3300045051 Bacteria 3865
351 Ga0451576_0095637 3300045051 Bacteria 3090
352 Ga0451576_0203516 3300045051 Bacteria 2067
353 Ga0451576_0218059 3300045051 Bacteria 1992
354 Ga0495627_000116 3300046453 Bacteria 99916
355 Ga0495591_000013 3300046458 Bacteria 268106
356 Ga0495591_006866 3300046458 Bacteria 4939
357 Ga0495650_0000043 3300046471 Bacteria 357197
358 Ga0495650_0000204 3300046471 Bacteria 129303
359 Ga0495605_0047563 3300046474 Bacteria 2103
360 Ga0495605_0122927 3300046474 Bacteria 1175
361 Ga0495585_0064678 3300046492 Bacteria 2005
362 Ga0495596_0005182 3300046500 Bacteria 6203
363 Ga0495607_0024337 3300046501 Bacteria 3776
364 Ga0495606_0003230 3300046507 Bacteria 17523
365 Ga0495616_0056982 3300046513 Bacteria 1928
366 Ga0495632_0110763 3300046519 Bacteria 1289
367 Ga0495632_0268516 3300046519 Bacteria 761
368 Ga0495643_0018621 3300046522 Bacteria 4031
369 Ga0495643_0043741 3300046522 Bacteria 2436
370 Ga0495644_0003775 3300046523 Bacteria 5964
371 Ga0495648_0002178 3300046524 Bacteria 18405
372 Ga0495648_0002659 3300046524 Bacteria 16179
373 Ga0495654_0000041 3300046530 Bacteria 174733
374 Ga0495654_0000149 3300046530 Bacteria 72677
375 Ga0495654_0000167 3300046530 Bacteria 64853
376 Ga0495654_0013787 3300046530 Bacteria 4316
377 Ga0495654_0094716 3300046530 Bacteria 1381
378 Ga0495597_0000396 3300046542 Bacteria 37594
379 Ga0495668_0073242 3300046616 Bacteria 1882
380 Ga0495625_0010850 3300046660 Bacteria 7492
381 Ga0495671_0097401 3300046692 Bacteria 1438
382 Ga0495649_0006137 3300046694 Bacteria 7508
383 Ga0495589_0000001 3300046794 Bacteria 888100
384 Ga0495589_0043413 3300046794 Bacteria 2238
385 Ga0495660_0000012 3300046810 Bacteria 350701
386 Ga0495660_0005689 3300046810 Bacteria 7446
387 Ga0495660_0015058 3300046810 Bacteria 4470
388 Ga0495672_0000002 3300047320 Bacteria 740116
389 Ga0495672_0000034 3300047320 Bacteria 290832
390 Ga0495672_0000043 3300047320 Bacteria 266893
391 Ga0495676_0112856 3300047321 Bacteria 1991
392 Ga0495683_0032208 3300047323 Bacteria 2670
393 Ga0495679_000005 3300047446 Bacteria 455007
394 Ga0495679_003257 3300047446 Bacteria 7874
395 Ga0495673_0000167 3300047469 Bacteria 111793
396 Ga0495681_0064554 3300047470 Bacteria 1676
397 Ga0496100_0130840 3300048903 Bacteria 1767
398 Ga0496101_0000055 3300048904 Bacteria 136176
399 Ga0496102_0005469 3300048905 Bacteria 10773
400 Ga0496102_0120568 3300048905 Bacteria 2449
401 Ga0496104_0001633 3300048907 Bacteria 19357
402 Ga0496104_0358755 3300048907 Bacteria 1370
403 Ga0496105_0001541 3300048908 Bacteria 16319
404 Ga0496113_0044846 3300048916 Unclassified 3277
405 Ga0496116_0000001 3300048919 Bacteria 1501681
406 Ga0496116_0000066 3300048919 Bacteria 264035
407 Ga0496116_0000305 3300048919 Bacteria 82397
408 Ga0496116_0000359 3300048919 Bacteria 71572
409 Ga0496116_0015700 3300048919 Bacteria 5972
410 Ga0496117_0000022 3300048920 Bacteria 439512
411 Ga0496117_0001199 3300048920 Bacteria 38983
412 Ga0496117_0007402 3300048920 Bacteria 10741
413 Ga0496117_0012172 3300048920 Bacteria 7618
414 Ga0496117_0101639 3300048920 Bacteria 1817
415 Ga0496118_0000007 3300048921 Bacteria 650986
416 Ga0496118_0000085 3300048921 Bacteria 179731
417 Ga0496118_0000311 3300048921 Bacteria 84212
418 Ga0496118_0005050 3300048921 Bacteria 15219
419 Ga0496118_0007386 3300048921 Bacteria 11666
420 Ga0496119_0000015 3300048922 Bacteria 312979
421 Ga0496119_0000039 3300048922 Bacteria 208631
422 Ga0496119_0001536 3300048922 Bacteria 27581
423 Ga0496119_0004522 3300048922 Bacteria 13800
424 Ga0496119_0008290 3300048922 Bacteria 9169
425 Ga0496119_0009553 3300048922 Bacteria 8301
426 Ga0496119_0014231 3300048922 Bacteria 6247
427 Ga0496119_0025620 3300048922 Bacteria 4113
428 Ga0496119_0058788 3300048922 Bacteria 2314
429 Ga0496119_0377654 3300048922 Bacteria 680
430 Ga0496120_0000002 3300048923 Bacteria 547999
431 Ga0496120_0000016 3300048923 Bacteria 307608
432 Ga0496120_0000464 3300048923 Bacteria 63910
433 Ga0496120_0000807 3300048923 Bacteria 45013
434 Ga0496120_0000952 3300048923 Bacteria 39508
435 Ga0496120_0001449 3300048923 Bacteria 28369
436 Ga0496120_0003613 3300048923 Bacteria 13877
437 Ga0496120_0006630 3300048923 Bacteria 8829
438 Ga0496120_0104178 3300048923 Bacteria 1493
439 Ga0496121_0002456 3300048924 Bacteria 28303
440 Ga0496122_0000110 3300048925 Bacteria 190142
441 Ga0496122_0003949 3300048925 Bacteria 18950
442 Ga0496122_0081469 3300048925 Bacteria 2252
443 Ga0496122_0296455 3300048925 Bacteria 874
444 Ga0496123_0000081 3300048926 Bacteria 190142
445 Ga0496123_0001180 3300048926 Bacteria 38508
446 Ga0496123_0006575 3300048926 Bacteria 11232
447 Ga0496124_0000196 3300048927 Bacteria 119375
448 Ga0496124_0000530 3300048927 Bacteria 65033
449 Ga0496124_0003500 3300048927 Bacteria 19129
450 Ga0496124_0007658 3300048927 Bacteria 11423
451 Ga0496124_0018734 3300048927 Bacteria 6471
452 Ga0496124_0038011 3300048927 Bacteria 4181
453 Ga0496125_0000033 3300048928 Bacteria 351850
454 Ga0496125_0039427 3300048928 Bacteria 4068
455 Ga0496126_0001066 3300048929 Bacteria 46225
456 Ga0496126_0041702 3300048929 Bacteria 4245
457 Ga0496126_0119365 3300048929 Bacteria 2288
458 Ga0495678_001876 3300049459 Bacteria 15280
459 Ga0495682_0000001 3300049460 Bacteria 1559116
460 Ga0501033_0014074 3300049570 Bacteria 6083
461 Ga0501036_0025421 3300049572 Bacteria 4994
462 Ga0501037_0022313 3300049573 Bacteria 4683
463 Ga0501037_0024389 3300049573 Bacteria 4474
464 Ga0501038_0012167 3300049574 Bacteria 7855
465 Ga0501038_0018364 3300049574 Bacteria 6313
466 Ga0501042_0148011 3300049578 Bacteria 1693
467 Ga0501043_0018715 3300049579 Bacteria 5434
468 Ga0501047_0019587 3300049581 Bacteria 6493
469 Ga0501047_0708272 3300049581 Bacteria 824
470 Ga0501067_0054332 3300049583 Bacteria 2219
471 Ga0501070_0118831 3300049586 Bacteria 2184
472 Ga0501070_0153078 3300049586 Bacteria 1902
473 Ga0501073_0002738 3300049589 Bacteria 13213
474 Ga0501074_0000546 3300049590 Bacteria 23222
475 Ga0501074_0026824 3300049590 Bacteria 4176
476 Ga0501080_0010002 3300049742 Bacteria 8670
477 Ga0501080_0054970 3300049742 Bacteria 3707
478 Ga0501083_0076805 3300049744 Bacteria 2216
479 Ga0501280_000192 3300049776 Bacteria 15350
480 Ga0501282_014652 3300049778 Bacteria 851
481 Ga0501035_0034991 3300049822 Bacteria 4563
482 Ga0501044_0036837 3300049823 Bacteria 5116
483 nmdc:mga00v17_34068_c1 3300050491 Bacteria 3022
484 nmdc:mga0k408_29301_c1 3300050493 Bacteria 3132
485 nmdc:mga05p37_959706_c1 3300050507 Bacteria 914
486 nmdc:mga09592_602296_c1 3300050508 Bacteria 941
487 nmdc:mga0qj67_143258_c1 3300050509 Bacteria 1938
488 nmdc:mga0qj67_63356_c1 3300050509 Bacteria 2940
489 nmdc:mga06r32_176471_c1 3300050510 Bacteria 2121
490 nmdc:mga08y16_157277_c1 3300050511 Bacteria 2362
491 nmdc:mga08y16_833125_c1 3300050511 Bacteria 913
492 Ga0500621_000003 3300053126 Bacteria 596975
493 Ga0501084_0213290 3300054114 Bacteria 1629
494 Ga0501082_0044190 3300060353 Bacteria 3843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0680590 Ga0316574_0680590_10_537 175
2 3300044673 Ga0453683_0019159 Ga0453683_0019159_3519_4073 184
3 3300045051 Ga0451576_0000013 Ga0451576_0000013_625421_625975 184
4 3300031239 Ga0265328_10000021 Ga0265328_10000021110 188
5 iso_pu_bacteria 2648501241 2649120940 188
6 iso_pu_bacteria 2651869818 2652977718 188
7 iso_pu_bacteria 2506520007 2506578261 189
8 iso_pu_bacteria 2506520008 2506583399 189
9 iso_pu_bacteria 2508501071 2508852274 189
10 iso_pu_bacteria 2511231025 2511382805 189
11 iso_pu_bacteria 2511231035 2511437656 189
12 iso_pu_bacteria 2526164512 2526212951 189
13 iso_pu_bacteria 2565956521 2566034918 189
14 iso_pu_bacteria 2574179768 2574432398 189
15 iso_pu_bacteria 2585427591 2585829470 189
16 iso_pu_bacteria 2585427592 2585834835 189
17 iso_pu_bacteria 2599185299 2599925542 189
18 iso_pu_bacteria 2608642108 2608669365 189
19 iso_pu_bacteria 2648501693 2650898876 189
20 iso_pu_bacteria 2654587920 2656279010 189
21 iso_pu_bacteria 2667528173 2671109935 189
22 iso_pu_bacteria 2671180115 2671587579 189
23 iso_pu_bacteria 2684622997 2686353260 189
24 iso_pu_bacteria 2687453601 2689444812 189
25 iso_pu_bacteria 2706794495 2707099112 189
26 iso_pu_bacteria 2711768156 2712470026 189
27 iso_pu_bacteria 2772190666 2772438859 189
28 iso_pu_bacteria 2806310673 2807179513 189
29 iso_pu_bacteria 2808606414 2809123683 189
30 iso_pu_bacteria 2844528606 2844533058 189
31 iso_pu_bacteria 2847085930 2847087759 189
32 iso_pu_bacteria 2847797336 2847799960 189
33 iso_pu_bacteria 2852103415 2852104846 189
34 iso_pu_bacteria 2854601825 2854604055 189
35 iso_pu_bacteria 2855195626 2855197302 189
36 iso_pu_bacteria 2858466076 2858468553 189
37 iso_pu_bacteria 2865014394 2865015189 189
38 iso_pu_bacteria 2869551831 2869554219 189
39 iso_pu_bacteria 2871272651 2871272877 189
40 iso_pu_bacteria 2876601092 2876604347 189
41 iso_pu_bacteria 2881609920 2881612606 189
42 iso_pu_bacteria 2888366609 2888368881 189
43 iso_pu_bacteria 2888373701 2888378415 189
44 iso_pu_bacteria 2891633521 2891634892 189
45 iso_pu_bacteria 2891670763 2891670991 189
46 iso_pu_bacteria 2904474040 2904477233 189
47 iso_pu_bacteria 2904504865 2904508629 189
48 iso_pu_bacteria 2908669403 2908669984 189
49 iso_pu_bacteria 2919150387 2919153400 189
50 iso_pu_bacteria 2927143783 2927144026 189
51 iso_pu_bacteria 2932406140 2932408137 189
52 iso_pu_bacteria 2937967321 2937967475 189
53 iso_pu_bacteria 2939577877 2939578594 189
54 iso_pu_bacteria 2939602548 2939603418 189
55 iso_pu_bacteria 2945951305 2945953063 189
56 iso_pu_bacteria 2978975091 2978975582 189
57 iso_pu_bacteria 2984494565 2984496546 189
58 iso_pu_bacteria 2990261002 2990261966 189
59 iso_pu_bacteria 2998344455 2998347580 189
60 iso_pu_bacteria 639633007 639786582 189
61 iso_pu_bacteria 640753048 640937780 189
62 iso_pu_bacteria 8004592986 8004595768 189
63 iso_pu_bacteria 8015394850 8015398302 189
64 iso_pu_bacteria 8016733728 8016736031 189
65 iso_pu_bacteria 8019499862 8019502776 189
66 iso_pu_bacteria 8054844752 8054845713 189
67 iso_pu_bacteria 8054849141 8054853079 189
68 iso_pu_bacteria 8055693939 8055696169 189
69 iso_pu_bacteria 2547132512 2548847307 190
70 iso_pu_bacteria 3000376612 3000378788 190
71 3300005518 Ga0070699_100036733 Ga0070699_1000367333 191
72 3300028666 Ga0265336_10001293 Ga0265336_100012933 191
73 3300029957 Ga0265324_10000001 Ga0265324_10000001322 191
74 3300029957 Ga0265324_10000160 Ga0265324_1000016057 191
75 3300029957 Ga0265324_10099453 Ga0265324_100994531 191
76 3300031235 Ga0265330_10003523 Ga0265330_100035236 191
77 3300031239 Ga0265328_10021150 Ga0265328_100211502 191
78 3300031239 Ga0265328_10199756 Ga0265328_101997561 191
79 3300031241 Ga0265325_10000150 Ga0265325_1000015014 191
80 3300031241 Ga0265325_10004569 Ga0265325_100045695 191
81 3300031250 Ga0265331_10000044 Ga0265331_1000004429 191
82 3300031250 Ga0265331_10003477 Ga0265331_100034777 191
83 3300031251 Ga0265327_10000102 Ga0265327_10000102166 191
84 3300031251 Ga0265327_10000706 Ga0265327_1000070634 191
85 3300031251 Ga0265327_10005149 Ga0265327_100051496 191
86 3300031251 Ga0265327_10026240 Ga0265327_100262404 191
87 3300031344 Ga0265316_10344190 Ga0265316_103441902 191
88 3300031665 Ga0316575_10000017 Ga0316575_1000001718 191
89 3300031711 Ga0265314_10000185 Ga0265314_1000018518 191
90 3300031711 Ga0265314_10040899 Ga0265314_100408991 191
91 3300032133 Ga0316583_10190045 Ga0316583_101900451 191
92 3300035092 Ga0373952_0011706 Ga0373952_0011706_83_685 191
93 3300035121 Ga0373960_0125980 Ga0373960_0125980_198_800 191
94 3300042876 Ga0451577_0000002 Ga0451577_0000002_1130246_1130821 191
95 3300042876 Ga0451577_0037303 Ga0451577_0037303_239_814 191
96 3300042876 Ga0451577_0602960 Ga0451577_0602960_104_679 191
97 3300044673 Ga0453683_0000011 Ga0453683_0000011_184765_185340 191
98 3300044712 Ga0453684_0000002 Ga0453684_0000002_600555_601130 191
99 3300044712 Ga0453684_0000040 Ga0453684_0000040_150088_150663 191
100 3300044712 Ga0453684_0014784 Ga0453684_0014784_10485_11060 191
101 3300044712 Ga0453684_0307043 Ga0453684_0307043_737_1372 191
102 3300044712 Ga0453684_0592851 Ga0453684_0592851_122_697 191
103 3300044712 Ga0453684_1173088 Ga0453684_1173088_190_768 191
104 3300045051 Ga0451576_0000004 Ga0451576_0000004_227195_227770 191
105 3300045051 Ga0451576_0005904 Ga0451576_0005904_12653_13228 191
106 3300045051 Ga0451576_0007888 Ga0451576_0007888_1968_2543 191
107 3300048916 Ga0496113_0044846 Ga0496113_0044846_2178_2759 191
108 3300050493 nmdc:mga0k408_29301_c1 nmdc:mga0k408_29301_c1_1907_2485 191
109 3300013307 Ga0157372_10111483 Ga0157372_101114832 192
110 3300031239 Ga0265328_10033750 Ga0265328_100337502 192
111 3300031250 Ga0265331_10005818 Ga0265331_100058189 192
112 3300031251 Ga0265327_10000583 Ga0265327_1000058353 192
113 3300031251 Ga0265327_10004647 Ga0265327_100046474 192
114 3300036401 Ga0373937_0478855 Ga0373937_0478855_547_1128 192
115 3300049776 Ga0501280_000192 Ga0501280_000192_5309_5887 192
116 3300049778 Ga0501282_014652 Ga0501282_014652_193_771 192
117 3300002771 JGI25163J39215_1000150 JGI25163J39215_100015024 193
118 3300002772 JGI25164J39214_1000002 JGI25164J39214_1000002143 193
119 3300003751 Ga0055538_1000015 Ga0055538_1000015128 193
120 3300003752 Ga0055539_1000009 Ga0055539_1000009219 193
121 3300003756 Ga0055533_1000012 Ga0055533_1000012142 193
122 3300003759 Ga0055525_1000014 Ga0055525_1000014219 193
123 3300003841 Ga0055541_1000006 Ga0055541_1000006142 193
124 3300003856 Ga0058692_1000066 Ga0058692_100006634 193
125 3300003856 Ga0058692_1000072 Ga0058692_100007272 193
126 3300005289 Ga0065704_10000959 Ga0065704_1000095913 193
127 3300005328 Ga0070676_10101840 Ga0070676_101018402 193
128 3300005339 Ga0070660_100681644 Ga0070660_1006816442 193
129 3300005347 Ga0070668_100008502 Ga0070668_10000850210 193
130 3300005353 Ga0070669_100025230 Ga0070669_1000252303 193
131 3300005356 Ga0070674_100035871 Ga0070674_1000358712 193
132 3300005406 Ga0070703_10112111 Ga0070703_101121112 193
133 3300005457 Ga0070662_100078587 Ga0070662_1000785872 193
134 3300005543 Ga0070672_100045098 Ga0070672_1000450982 193
135 3300005577 Ga0068857_100669723 Ga0068857_1006697232 193
136 3300005719 Ga0068861_100599871 Ga0068861_1005998712 193
137 3300005844 Ga0068862_100046646 Ga0068862_1000466463 193
138 3300006051 Ga0075364_10109799 Ga0075364_101097993 193
139 3300006844 Ga0075428_100264649 Ga0075428_1002646492 193
140 3300006846 Ga0075430_100694813 Ga0075430_1006948131 193
141 3300006847 Ga0075431_100055162 Ga0075431_1000551624 193
142 3300006880 Ga0075429_100101975 Ga0075429_1001019752 193
143 3300006880 Ga0075429_100228159 Ga0075429_1002281592 193
144 3300006946 Ga0079104_1000292 Ga0079104_100029253 193
145 3300006946 Ga0079104_1002042 Ga0079104_10020423 193
146 3300009011 Ga0105251_10000002 Ga0105251_10000002290 193
147 3300009011 Ga0105251_10000462 Ga0105251_1000046213 193
148 3300009011 Ga0105251_10000668 Ga0105251_1000066837 193
149 3300009011 Ga0105251_10000978 Ga0105251_100009783 193
150 3300009011 Ga0105251_10010712 Ga0105251_100107123 193
151 3300009011 Ga0105251_10012905 Ga0105251_100129053 193
152 3300009011 Ga0105251_10064519 Ga0105251_100645192 193
153 3300009011 Ga0105251_10132017 Ga0105251_101320172 193
154 3300009036 Ga0105244_10000645 Ga0105244_100006458 193
155 3300009036 Ga0105244_10000960 Ga0105244_1000096012 193
156 3300009036 Ga0105244_10001340 Ga0105244_1000134013 193
157 3300009036 Ga0105244_10001722 Ga0105244_100017224 193
158 3300009036 Ga0105244_10002160 Ga0105244_100021603 193
159 3300009036 Ga0105244_10003297 Ga0105244_100032973 193
160 3300009036 Ga0105244_10031854 Ga0105244_100318543 193
161 3300009092 Ga0105250_10000002 Ga0105250_1000000247 193
162 3300009092 Ga0105250_10000619 Ga0105250_1000061928 193
163 3300009092 Ga0105250_10000837 Ga0105250_1000083716 193
164 3300009092 Ga0105250_10004014 Ga0105250_100040143 193
165 3300009092 Ga0105250_10008934 Ga0105250_100089343 193
166 3300009094 Ga0111539_10008302 Ga0111539_100083023 193
167 3300009094 Ga0111539_10278802 Ga0111539_102788022 193
168 3300009101 Ga0105247_10000129 Ga0105247_1000012923 193
169 3300009147 Ga0114129_10430974 Ga0114129_104309743 193
170 3300009174 Ga0105241_10000002 Ga0105241_10000002473 193
171 3300011119 Ga0105246_10091157 Ga0105246_100911573 193
172 3300011119 Ga0105246_10469960 Ga0105246_104699602 193
173 3300013100 Ga0157373_10000405 Ga0157373_1000040518 193
174 3300013100 Ga0157373_10003517 Ga0157373_100035178 193
175 3300013100 Ga0157373_10009834 Ga0157373_100098342 193
176 3300013100 Ga0157373_10028548 Ga0157373_100285485 193
177 3300013100 Ga0157373_10122358 Ga0157373_101223583 193
178 3300013102 Ga0157371_10000008 Ga0157371_10000008151 193
179 3300013102 Ga0157371_10005712 Ga0157371_100057128 193
180 3300013102 Ga0157371_10007075 Ga0157371_100070757 193
181 3300013102 Ga0157371_10015776 Ga0157371_100157766 193
182 3300013104 Ga0157370_10000064 Ga0157370_1000006450 193
183 3300013104 Ga0157370_10003634 Ga0157370_1000363414 193
184 3300013105 Ga0157369_10177615 Ga0157369_101776151 193
185 3300013306 Ga0163162_10040950 Ga0163162_100409505 193
186 3300013306 Ga0163162_10105162 Ga0163162_101051621 193
187 3300013306 Ga0163162_10119886 Ga0163162_101198862 193
188 3300013306 Ga0163162_10990729 Ga0163162_109907291 193
189 3300013307 Ga0157372_10016000 Ga0157372_100160003 193
190 3300013307 Ga0157372_10057410 Ga0157372_100574103 193
191 3300013307 Ga0157372_10150255 Ga0157372_101502553 193
192 3300013307 Ga0157372_10150703 Ga0157372_101507033 193
193 3300013307 Ga0157372_10208820 Ga0157372_102088202 193
194 3300013307 Ga0157372_10208997 Ga0157372_102089972 193
195 3300014326 Ga0157380_10308383 Ga0157380_103083832 193
196 3300014497 Ga0182008_10001733 Ga0182008_100017333 193
197 3300017792 Ga0163161_10000001 Ga0163161_100000011024 193
198 3300017792 Ga0163161_10036661 Ga0163161_100366612 193
199 3300025207 Ga0209760_100051 Ga0209760_10005147 193
200 3300025207 Ga0209760_103221 Ga0209760_1032212 193
201 3300025224 Ga0209784_100001 Ga0209784_1000012027 193
202 3300025225 Ga0209566_100001 Ga0209566_1000012027 193
203 3300025226 Ga0209674_100002 Ga0209674_1000022027 193
204 3300025230 Ga0209563_100002 Ga0209563_100002562 193
205 3300025231 Ga0207427_100020 Ga0207427_100020214 193
206 3300025233 Ga0209437_100001 Ga0209437_100001562 193
207 3300025233 Ga0209437_100109 Ga0209437_1001099 193
208 3300025233 Ga0209437_100111 Ga0209437_1001119 193
209 3300025253 Ga0209677_100002 Ga0209677_100002562 193
210 3300025261 Ga0209233_1007860 Ga0209233_10078604 193
211 3300025711 Ga0207696_1000001 Ga0207696_10000011097 193
212 3300025711 Ga0207696_1000086 Ga0207696_1000086180 193
213 3300025711 Ga0207696_1000292 Ga0207696_10002923 193
214 3300025711 Ga0207696_1001252 Ga0207696_10012528 193
215 3300025711 Ga0207696_1005788 Ga0207696_10057884 193
216 3300025728 Ga0207655_1000037 Ga0207655_1000037272 193
217 3300025728 Ga0207655_1000069 Ga0207655_100006939 193
218 3300025728 Ga0207655_1000413 Ga0207655_100041320 193
219 3300025728 Ga0207655_1000853 Ga0207655_10008534 193
220 3300025728 Ga0207655_1001583 Ga0207655_10015837 193
221 3300025728 Ga0207655_1002281 Ga0207655_100228115 193
222 3300025728 Ga0207655_1005502 Ga0207655_10055025 193
223 3300025728 Ga0207655_1049009 Ga0207655_10490091 193
224 3300025728 Ga0207655_1064699 Ga0207655_10646992 193
225 3300025728 Ga0207655_1120464 Ga0207655_11204642 193
226 3300025735 Ga0207713_1000001 Ga0207713_10000011004 193
227 3300025735 Ga0207713_1000008 Ga0207713_100000856 193
228 3300025735 Ga0207713_1000016 Ga0207713_100001657 193
229 3300025735 Ga0207713_1000916 Ga0207713_100091632 193
230 3300025735 Ga0207713_1014127 Ga0207713_10141273 193
231 3300025735 Ga0207713_1023907 Ga0207713_10239074 193
232 3300025735 Ga0207713_1049323 Ga0207713_10493232 193
233 3300025735 Ga0207713_1052024 Ga0207713_10520243 193
234 3300025735 Ga0207713_1070731 Ga0207713_10707312 193
235 3300025899 Ga0207642_10186930 Ga0207642_101869302 193
236 3300025900 Ga0207710_10000113 Ga0207710_1000011361 193
237 3300025907 Ga0207645_10000895 Ga0207645_100008953 193
238 3300025908 Ga0207643_10003637 Ga0207643_100036378 193
239 3300025911 Ga0207654_10000005 Ga0207654_10000005472 193
240 3300025917 Ga0207660_10231082 Ga0207660_102310822 193
241 3300025933 Ga0207706_10001580 Ga0207706_1000158024 193
242 3300025937 Ga0207669_10963682 Ga0207669_109636821 193
243 3300025940 Ga0207691_10008966 Ga0207691_1000896610 193
244 3300025972 Ga0207668_10126613 Ga0207668_101266132 193
245 3300025972 Ga0207668_10252524 Ga0207668_102525242 193
246 3300026089 Ga0207648_10001051 Ga0207648_100010515 193
247 3300026116 Ga0207674_10687315 Ga0207674_106873152 193
248 3300026118 Ga0207675_100011630 Ga0207675_1000116304 193
249 3300027111 Ga0209281_1000003 Ga0209281_1000003232 193
250 3300027111 Ga0209281_1000181 Ga0209281_1000181114 193
251 3300027312 Ga0209371_1000005 Ga0209371_100000540 193
252 3300027312 Ga0209371_1000124 Ga0209371_100012467 193
253 3300027312 Ga0209371_1000183 Ga0209371_100018359 193
254 3300027312 Ga0209371_1000212 Ga0209371_100021243 193
255 3300027312 Ga0209371_1001786 Ga0209371_100178611 193
256 3300027312 Ga0209371_1002558 Ga0209371_10025582 193
257 3300027312 Ga0209371_1003308 Ga0209371_10033086 193
258 3300027312 Ga0209371_1004008 Ga0209371_10040086 193
259 3300027312 Ga0209371_1006965 Ga0209371_10069655 193
260 3300027552 Ga0209982_1008688 Ga0209982_10086882 193
261 3300027614 Ga0209970_1002977 Ga0209970_10029772 193
262 3300027665 Ga0209983_1002519 Ga0209983_10025192 193
263 3300027682 Ga0209971_1000377 Ga0209971_100037710 193
264 3300027876 Ga0209974_10011562 Ga0209974_100115622 193
265 3300027907 Ga0207428_10085280 Ga0207428_100852802 193
266 3300027907 Ga0207428_10767260 Ga0207428_107672601 193
267 3300028380 Ga0268265_10267766 Ga0268265_102677661 193
268 3300030500 Ga0268256_1000006 Ga0268256_10000061015 193
269 3300030500 Ga0268256_1000155 Ga0268256_100015537 193
270 3300030500 Ga0268256_1000186 Ga0268256_10001868 193
271 3300030500 Ga0268256_1001014 Ga0268256_10010145 193
272 3300030500 Ga0268256_1001115 Ga0268256_100111511 193
273 3300030500 Ga0268256_1001689 Ga0268256_100168910 193
274 3300030500 Ga0268256_1003739 Ga0268256_10037394 193
275 3300030500 Ga0268256_1007099 Ga0268256_10070993 193
276 3300030500 Ga0268256_1014882 Ga0268256_10148823 193
277 3300031238 Ga0265332_10000016 Ga0265332_10000016135 193
278 3300031238 Ga0265332_10001660 Ga0265332_100016601 193
279 3300031344 Ga0265316_10101082 Ga0265316_101010822 193
280 3300031616 Ga0307508_10002254 Ga0307508_1000225410 193
281 3300031665 Ga0316575_10003969 Ga0316575_100039695 193
282 3300031665 Ga0316575_10017854 Ga0316575_100178543 193
283 3300031665 Ga0316575_10150683 Ga0316575_101506831 193
284 3300031691 Ga0316579_10000486 Ga0316579_100004867 193
285 3300031691 Ga0316579_10000793 Ga0316579_100007938 193
286 3300031691 Ga0316579_10088223 Ga0316579_100882231 193
287 3300031691 Ga0316579_10140425 Ga0316579_101404251 193
288 3300031727 Ga0316576_10000048 Ga0316576_1000004825 193
289 3300031727 Ga0316576_10001109 Ga0316576_100011096 193
290 3300031727 Ga0316576_10002746 Ga0316576_100027467 193
291 3300031727 Ga0316576_10008482 Ga0316576_100084824 193
292 3300031727 Ga0316576_10021236 Ga0316576_100212364 193
293 3300031727 Ga0316576_10028393 Ga0316576_100283932 193
294 3300031727 Ga0316576_10038117 Ga0316576_100381172 193
295 3300031727 Ga0316576_10085243 Ga0316576_100852433 193
296 3300031727 Ga0316576_10093097 Ga0316576_100930973 193
297 3300031727 Ga0316576_10143057 Ga0316576_101430573 193
298 3300031727 Ga0316576_10271713 Ga0316576_102717132 193
299 3300031728 Ga0316578_10002436 Ga0316578_100024365 193
300 3300031728 Ga0316578_10004122 Ga0316578_100041223 193
301 3300031728 Ga0316578_10004817 Ga0316578_100048174 193
302 3300031728 Ga0316578_10011206 Ga0316578_100112063 193
303 3300031728 Ga0316578_10013571 Ga0316578_100135712 193
304 3300031728 Ga0316578_10018521 Ga0316578_100185212 193
305 3300031728 Ga0316578_10079611 Ga0316578_100796112 193
306 3300031733 Ga0316577_10002072 Ga0316577_100020726 193
307 3300031733 Ga0316577_10013439 Ga0316577_100134392 193
308 3300031733 Ga0316577_10022059 Ga0316577_100220593 193
309 3300031733 Ga0316577_10160927 Ga0316577_101609271 193
310 3300031911 Ga0307412_10097854 Ga0307412_100978543 193
311 3300032005 Ga0307411_10075653 Ga0307411_100756533 193
312 3300032133 Ga0316583_10000284 Ga0316583_100002847 193
313 3300032133 Ga0316583_10000581 Ga0316583_100005815 193
314 3300032133 Ga0316583_10014919 Ga0316583_100149192 193
315 3300032137 Ga0316585_10000227 Ga0316585_100002277 193
316 3300032137 Ga0316585_10001260 Ga0316585_100012605 193
317 3300032137 Ga0316585_10022216 Ga0316585_100222162 193
318 3300032139 Ga0316580_10000210 Ga0316580_100002107 193
319 3300032139 Ga0316580_10000404 Ga0316580_100004043 193
320 3300032139 Ga0316580_10003636 Ga0316580_100036364 193
321 3300032139 Ga0316580_10010304 Ga0316580_100103043 193
322 3300032139 Ga0316580_10028474 Ga0316580_100284741 193
323 3300032168 Ga0316593_10005651 Ga0316593_100056511 193
324 3300032168 Ga0316593_10006267 Ga0316593_100062671 193
325 3300032168 Ga0316593_10015437 Ga0316593_100154371 193
326 3300032168 Ga0316593_10040046 Ga0316593_100400464 193
327 3300032168 Ga0316593_10055769 Ga0316593_100557691 193
328 3300032168 Ga0316593_10080597 Ga0316593_100805972 193
329 3300032168 Ga0316593_10172461 Ga0316593_101724611 193
330 3300033524 Ga0316592_1003001 Ga0316592_10030011 193
331 3300033524 Ga0316592_1005201 Ga0316592_10052013 193
332 3300033524 Ga0316592_1008233 Ga0316592_10082333 193
333 3300033524 Ga0316592_1013355 Ga0316592_10133551 193
334 3300033524 Ga0316592_1024706 Ga0316592_10247062 193
335 3300033524 Ga0316592_1085858 Ga0316592_10858581 193
336 3300033527 Ga0316586_1002436 Ga0316586_10024361 193
337 3300033527 Ga0316586_1005784 Ga0316586_10057843 193
338 3300033527 Ga0316586_1029867 Ga0316586_10298671 193
339 3300033528 Ga0316588_1000062 Ga0316588_10000627 193
340 3300033528 Ga0316588_1001775 Ga0316588_10017754 193
341 3300033528 Ga0316588_1006951 Ga0316588_10069513 193
342 3300033528 Ga0316588_1007295 Ga0316588_10072953 193
343 3300033528 Ga0316588_1010900 Ga0316588_10109001 193
344 3300033528 Ga0316588_1013122 Ga0316588_10131222 193
345 3300033528 Ga0316588_1018823 Ga0316588_10188232 193
346 3300033528 Ga0316588_1029064 Ga0316588_10290641 193
347 3300033528 Ga0316588_1040220 Ga0316588_10402202 193
348 3300033529 Ga0316587_1000044 Ga0316587_10000447 193
349 3300033529 Ga0316587_1007158 Ga0316587_10071583 193
350 3300033529 Ga0316587_1007881 Ga0316587_10078812 193
351 3300033529 Ga0316587_1011010 Ga0316587_10110101 193
352 3300033529 Ga0316587_1013423 Ga0316587_10134232 193
353 3300033529 Ga0316587_1016306 Ga0316587_10163062 193
354 3300033529 Ga0316587_1047376 Ga0316587_10473761 193
355 3300033541 Ga0316596_1000361 Ga0316596_10003611 193
356 3300033541 Ga0316596_1000460 Ga0316596_10004607 193
357 3300033541 Ga0316596_1000509 Ga0316596_10005097 193
358 3300033541 Ga0316596_1002694 Ga0316596_10026944 193
359 3300033541 Ga0316596_1016079 Ga0316596_10160792 193
360 3300033541 Ga0316596_1056055 Ga0316596_10560552 193
361 3300035084 Ga0373928_0013106 Ga0373928_0013106_452_1036 193
362 3300035398 Ga0316574_0000454 Ga0316574_0000454_1900_2481 193
363 3300035398 Ga0316574_0002628 Ga0316574_0002628_5222_5839 193
364 3300035398 Ga0316574_0021643 Ga0316574_0021643_2878_3459 193
365 3300035398 Ga0316574_0034720 Ga0316574_0034720_1069_1650 193
366 3300035398 Ga0316574_0055377 Ga0316574_0055377_904_1485 193
367 3300035398 Ga0316574_0132932 Ga0316574_0132932_434_1015 193
368 3300035398 Ga0316574_0257641 Ga0316574_0257641_210_791 193
369 3300036647 Ga0316582_0011060 Ga0316582_0011060_1744_2325 193
370 3300036647 Ga0316582_0014082 Ga0316582_0014082_2502_3119 193
371 3300036647 Ga0316582_0021070 Ga0316582_0021070_2818_3399 193
372 3300036647 Ga0316582_0069312 Ga0316582_0069312_1325_1906 193
373 3300036647 Ga0316582_0300208 Ga0316582_0300208_175_756 193
374 3300036647 Ga0316582_0439889 Ga0316582_0439889_90_671 193
375 3300036712 Ga0316584_0000920 Ga0316584_0000920_14023_14604 193
376 3300036712 Ga0316584_0003388 Ga0316584_0003388_472_1053 193
377 3300036712 Ga0316584_0006000 Ga0316584_0006000_6305_6922 193
378 3300036712 Ga0316584_0010062 Ga0316584_0010062_1162_1743 193
379 3300036712 Ga0316584_0037253 Ga0316584_0037253_659_1240 193
380 3300036712 Ga0316584_0061067 Ga0316584_0061067_1617_2198 193
381 3300036712 Ga0316584_0078217 Ga0316584_0078217_127_708 193
382 3300036712 Ga0316584_0100020 Ga0316584_0100020_1482_2063 193
383 3300036712 Ga0316584_0114813 Ga0316584_0114813_15_596 193
384 3300036712 Ga0316584_0308385 Ga0316584_0308385_49_630 193
385 3300037588 Ga0316581_0006290 Ga0316581_0006290_460_1041 193
386 3300037588 Ga0316581_0007113 Ga0316581_0007113_862_1443 193
387 3300037588 Ga0316581_0108832 Ga0316581_0108832_117_698 193
388 3300039062 Ga0400483_203625 Ga0400483_203625_440_1027 193
389 3300039093 Ga0400489_09975 Ga0400489_09975_329_910 193
390 3300041405 Ga0439438_000001 Ga0439438_000001_752483_753064 193
391 3300041405 Ga0439438_011191 Ga0439438_011191_780_1361 193
392 3300041405 Ga0439438_015618 Ga0439438_015618_1143_1724 193
393 3300041407 Ga0439447_006900 Ga0439447_006900_2636_3217 193
394 3300041407 Ga0439447_014794 Ga0439447_014794_980_1561 193
395 3300041411 Ga0439466_0000091 Ga0439466_0000091_7206_7787 193
396 3300042006 Ga0439432_032573 Ga0439432_032573_176_757 193
397 3300042006 Ga0439432_058517 Ga0439432_058517_483_1064 193
398 3300042010 Ga0439452_000001 Ga0439452_000001_724050_724631 193
399 3300042125 Ga0450923_097960 Ga0450923_097960_78_659 193
400 3300042133 Ga0450896_048037 Ga0450896_048037_40_621 193
401 3300042146 Ga0450907_006976 Ga0450907_006976_402_983 193
402 3300042461 Ga0439460_0042210 Ga0439460_0042210_69_650 193
403 3300042876 Ga0451577_0000384 Ga0451577_0000384_69821_70405 193
404 3300042876 Ga0451577_0155664 Ga0451577_0155664_627_1211 193
405 3300042876 Ga0451577_0320696 Ga0451577_0320696_295_879 193
406 3300042876 Ga0451577_1010634 Ga0451577_1010634_56_640 193
407 3300042876 Ga0451577_1338617 Ga0451577_1338617_24_608 193
408 3300044673 Ga0453683_0284311 Ga0453683_0284311_199_783 193
409 3300044712 Ga0453684_0000005 Ga0453684_0000005_893504_894088 193
410 3300044712 Ga0453684_0000341 Ga0453684_0000341_71790_72374 193
411 3300044712 Ga0453684_0000511 Ga0453684_0000511_11345_11929 193
412 3300044712 Ga0453684_0001222 Ga0453684_0001222_872_1456 193
413 3300044712 Ga0453684_0125783 Ga0453684_0125783_924_1508 193
414 3300044712 Ga0453684_0304918 Ga0453684_0304918_894_1478 193
415 3300044712 Ga0453684_1609325 Ga0453684_1609325_63_647 193
416 3300045051 Ga0451576_0000266 Ga0451576_0000266_59008_59592 193
417 3300045051 Ga0451576_0000570 Ga0451576_0000570_60460_61041 193
418 3300045051 Ga0451576_0002354 Ga0451576_0002354_21131_21715 193
419 3300045051 Ga0451576_0035161 Ga0451576_0035161_1912_2496 193
420 3300045051 Ga0451576_0063004 Ga0451576_0063004_3187_3771 193
421 3300045051 Ga0451576_0095637 Ga0451576_0095637_1571_2155 193
422 3300045051 Ga0451576_0203516 Ga0451576_0203516_36_620 193
423 3300045051 Ga0451576_0218059 Ga0451576_0218059_1162_1746 193
424 3300046453 Ga0495627_000116 Ga0495627_000116_72615_73196 193
425 3300046458 Ga0495591_000013 Ga0495591_000013_118468_119049 193
426 3300046458 Ga0495591_006866 Ga0495591_006866_2364_2945 193
427 3300046471 Ga0495650_0000043 Ga0495650_0000043_255119_255700 193
428 3300046471 Ga0495650_0000204 Ga0495650_0000204_126458_127039 193
429 3300046474 Ga0495605_0047563 Ga0495605_0047563_15_596 193
430 3300046474 Ga0495605_0122927 Ga0495605_0122927_580_1161 193
431 3300046492 Ga0495585_0064678 Ga0495585_0064678_1047_1628 193
432 3300046500 Ga0495596_0005182 Ga0495596_0005182_4222_4803 193
433 3300046501 Ga0495607_0024337 Ga0495607_0024337_2040_2621 193
434 3300046507 Ga0495606_0003230 Ga0495606_0003230_3646_4227 193
435 3300046513 Ga0495616_0056982 Ga0495616_0056982_914_1495 193
436 3300046519 Ga0495632_0110763 Ga0495632_0110763_221_802 193
437 3300046519 Ga0495632_0268516 Ga0495632_0268516_20_601 193
438 3300046522 Ga0495643_0018621 Ga0495643_0018621_3151_3732 193
439 3300046522 Ga0495643_0043741 Ga0495643_0043741_1508_2089 193
440 3300046523 Ga0495644_0003775 Ga0495644_0003775_1610_2191 193
441 3300046524 Ga0495648_0002178 Ga0495648_0002178_15120_15701 193
442 3300046524 Ga0495648_0002659 Ga0495648_0002659_5966_6547 193
443 3300046530 Ga0495654_0000041 Ga0495654_0000041_122295_122876 193
444 3300046530 Ga0495654_0000149 Ga0495654_0000149_13023_13604 193
445 3300046530 Ga0495654_0000167 Ga0495654_0000167_33725_34306 193
446 3300046530 Ga0495654_0013787 Ga0495654_0013787_1950_2531 193
447 3300046530 Ga0495654_0094716 Ga0495654_0094716_110_691 193
448 3300046542 Ga0495597_0000396 Ga0495597_0000396_17090_17671 193
449 3300046616 Ga0495668_0073242 Ga0495668_0073242_651_1232 193
450 3300046660 Ga0495625_0010850 Ga0495625_0010850_6648_7229 193
451 3300046692 Ga0495671_0097401 Ga0495671_0097401_326_907 193
452 3300046694 Ga0495649_0006137 Ga0495649_0006137_6130_6711 193
453 3300046794 Ga0495589_0000001 Ga0495589_0000001_865844_866425 193
454 3300046794 Ga0495589_0043413 Ga0495589_0043413_512_1093 193
455 3300046810 Ga0495660_0000012 Ga0495660_0000012_164576_165157 193
456 3300046810 Ga0495660_0005689 Ga0495660_0005689_1742_2323 193
457 3300046810 Ga0495660_0015058 Ga0495660_0015058_802_1383 193
458 3300047320 Ga0495672_0000002 Ga0495672_0000002_577791_578372 193
459 3300047320 Ga0495672_0000034 Ga0495672_0000034_117308_117889 193
460 3300047320 Ga0495672_0000043 Ga0495672_0000043_31640_32221 193
461 3300047321 Ga0495676_0112856 Ga0495676_0112856_726_1307 193
462 3300047323 Ga0495683_0032208 Ga0495683_0032208_1554_2135 193
463 3300047446 Ga0495679_000005 Ga0495679_000005_151722_152303 193
464 3300047446 Ga0495679_003257 Ga0495679_003257_1368_1949 193
465 3300047469 Ga0495673_0000167 Ga0495673_0000167_81645_82226 193
466 3300047470 Ga0495681_0064554 Ga0495681_0064554_783_1364 193
467 3300048903 Ga0496100_0130840 Ga0496100_0130840_1068_1649 193
468 3300048904 Ga0496101_0000055 Ga0496101_0000055_42137_42718 193
469 3300048905 Ga0496102_0005469 Ga0496102_0005469_1676_2257 193
470 3300048905 Ga0496102_0120568 Ga0496102_0120568_67_648 193
471 3300048907 Ga0496104_0001633 Ga0496104_0001633_2818_3399 193
472 3300048907 Ga0496104_0358755 Ga0496104_0358755_400_981 193
473 3300048908 Ga0496105_0001541 Ga0496105_0001541_13509_14090 193
474 3300048919 Ga0496116_0000001 Ga0496116_0000001_498600_499181 193
475 3300048919 Ga0496116_0000066 Ga0496116_0000066_181313_181894 193
476 3300048919 Ga0496116_0000305 Ga0496116_0000305_12770_13351 193
477 3300048919 Ga0496116_0000359 Ga0496116_0000359_63989_64570 193
478 3300048919 Ga0496116_0015700 Ga0496116_0015700_4903_5484 193
479 3300048920 Ga0496117_0000022 Ga0496117_0000022_435932_436513 193
480 3300048920 Ga0496117_0001199 Ga0496117_0001199_5064_5645 193
481 3300048920 Ga0496117_0007402 Ga0496117_0007402_8183_8764 193
482 3300048920 Ga0496117_0012172 Ga0496117_0012172_2564_3145 193
483 3300048920 Ga0496117_0101639 Ga0496117_0101639_565_1146 193
484 3300048921 Ga0496118_0000007 Ga0496118_0000007_139885_140466 193
485 3300048921 Ga0496118_0000085 Ga0496118_0000085_71608_72189 193
486 3300048921 Ga0496118_0000311 Ga0496118_0000311_21575_22156 193
487 3300048921 Ga0496118_0005050 Ga0496118_0005050_12901_13482 193
488 3300048921 Ga0496118_0007386 Ga0496118_0007386_6450_7031 193
489 3300048922 Ga0496119_0000015 Ga0496119_0000015_243411_243992 193
490 3300048922 Ga0496119_0000039 Ga0496119_0000039_195302_195883 193
491 3300048922 Ga0496119_0001536 Ga0496119_0001536_7168_7749 193
492 3300048922 Ga0496119_0004522 Ga0496119_0004522_9596_10177 193
493 3300048922 Ga0496119_0008290 Ga0496119_0008290_8260_8841 193
494 3300048922 Ga0496119_0009553 Ga0496119_0009553_6275_6856 193
495 3300048922 Ga0496119_0014231 Ga0496119_0014231_4455_5036 193
496 3300048922 Ga0496119_0025620 Ga0496119_0025620_2483_3064 193
497 3300048922 Ga0496119_0058788 Ga0496119_0058788_1243_1824 193
498 3300048922 Ga0496119_0377654 Ga0496119_0377654_18_599 193
499 3300048923 Ga0496120_0000002 Ga0496120_0000002_534670_535251 193
500 3300048923 Ga0496120_0000016 Ga0496120_0000016_294280_294861 193
501 3300048923 Ga0496120_0000464 Ga0496120_0000464_35280_35861 193
502 3300048923 Ga0496120_0000807 Ga0496120_0000807_4661_5242 193
503 3300048923 Ga0496120_0000952 Ga0496120_0000952_24841_25422 193
504 3300048923 Ga0496120_0001449 Ga0496120_0001449_7364_7945 193
505 3300048923 Ga0496120_0003613 Ga0496120_0003613_2667_3248 193
506 3300048923 Ga0496120_0006630 Ga0496120_0006630_6507_7088 193
507 3300048923 Ga0496120_0104178 Ga0496120_0104178_532_1113 193
508 3300048924 Ga0496121_0002456 Ga0496121_0002456_4715_5296 193
509 3300048925 Ga0496122_0000110 Ga0496122_0000110_179133_179714 193
510 3300048925 Ga0496122_0003949 Ga0496122_0003949_9356_9937 193
511 3300048925 Ga0496122_0081469 Ga0496122_0081469_1577_2158 193
512 3300048925 Ga0496122_0296455 Ga0496122_0296455_95_676 193
513 3300048926 Ga0496123_0000081 Ga0496123_0000081_10429_11010 193
514 3300048926 Ga0496123_0001180 Ga0496123_0001180_2665_3246 193
515 3300048926 Ga0496123_0006575 Ga0496123_0006575_3273_3854 193
516 3300048927 Ga0496124_0000196 Ga0496124_0000196_8427_9008 193
517 3300048927 Ga0496124_0000530 Ga0496124_0000530_20531_21112 193
518 3300048927 Ga0496124_0003500 Ga0496124_0003500_564_1145 193
519 3300048927 Ga0496124_0007658 Ga0496124_0007658_6535_7116 193
520 3300048927 Ga0496124_0018734 Ga0496124_0018734_2712_3293 193
521 3300048927 Ga0496124_0038011 Ga0496124_0038011_3122_3703 193
522 3300048928 Ga0496125_0000033 Ga0496125_0000033_88520_89101 193
523 3300048928 Ga0496125_0039427 Ga0496125_0039427_1066_1647 193
524 3300048929 Ga0496126_0001066 Ga0496126_0001066_25223_25804 193
525 3300048929 Ga0496126_0041702 Ga0496126_0041702_3279_3860 193
526 3300048929 Ga0496126_0119365 Ga0496126_0119365_1401_1982 193
527 3300049459 Ga0495678_001876 Ga0495678_001876_12263_12844 193
528 3300049460 Ga0495682_0000001 Ga0495682_0000001_1256097_1256678 193
529 3300049570 Ga0501033_0014074 Ga0501033_0014074_1633_2214 193
530 3300049572 Ga0501036_0025421 Ga0501036_0025421_950_1531 193
531 3300049573 Ga0501037_0022313 Ga0501037_0022313_88_669 193
532 3300049573 Ga0501037_0024389 Ga0501037_0024389_1770_2351 193
533 3300049574 Ga0501038_0012167 Ga0501038_0012167_3432_4013 193
534 3300049574 Ga0501038_0018364 Ga0501038_0018364_4645_5226 193
535 3300049578 Ga0501042_0148011 Ga0501042_0148011_528_1109 193
536 3300049579 Ga0501043_0018715 Ga0501043_0018715_1602_2183 193
537 3300049581 Ga0501047_0019587 Ga0501047_0019587_2309_2890 193
538 3300049581 Ga0501047_0708272 Ga0501047_0708272_48_629 193
539 3300049583 Ga0501067_0054332 Ga0501067_0054332_156_737 193
540 3300049586 Ga0501070_0118831 Ga0501070_0118831_246_827 193
541 3300049586 Ga0501070_0153078 Ga0501070_0153078_540_1121 193
542 3300049589 Ga0501073_0002738 Ga0501073_0002738_2264_2845 193
543 3300049590 Ga0501074_0000546 Ga0501074_0000546_10609_11190 193
544 3300049590 Ga0501074_0026824 Ga0501074_0026824_719_1300 193
545 3300049742 Ga0501080_0010002 Ga0501080_0010002_5747_6328 193
546 3300049742 Ga0501080_0054970 Ga0501080_0054970_1054_1635 193
547 3300049744 Ga0501083_0076805 Ga0501083_0076805_289_870 193
548 3300049822 Ga0501035_0034991 Ga0501035_0034991_1013_1594 193
549 3300049823 Ga0501044_0036837 Ga0501044_0036837_1417_1998 193
550 3300050491 nmdc:mga00v17_34068_c1 nmdc:mga00v17_34068_c1_362_943 193
551 3300050507 nmdc:mga05p37_959706_c1 nmdc:mga05p37_959706_c1_28_609 193
552 3300050508 nmdc:mga09592_602296_c1 nmdc:mga09592_602296_c1_279_860 193
553 3300050509 nmdc:mga0qj67_143258_c1 nmdc:mga0qj67_143258_c1_1244_1825 193
554 3300050509 nmdc:mga0qj67_63356_c1 nmdc:mga0qj67_63356_c1_2147_2728 193
555 3300050510 nmdc:mga06r32_176471_c1 nmdc:mga06r32_176471_c1_1031_1612 193
556 3300050511 nmdc:mga08y16_157277_c1 nmdc:mga08y16_157277_c1_777_1358 193
557 3300050511 nmdc:mga08y16_833125_c1 nmdc:mga08y16_833125_c1_66_647 193
558 3300053126 Ga0500621_000003 Ga0500621_000003_181023_181604 193
559 3300054114 Ga0501084_0213290 Ga0501084_0213290_897_1478 193
560 3300060353 Ga0501082_0044190 Ga0501082_0044190_3250_3831 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02508

Rnf-Nqr

Rnf-Nqr subunit, membrane protein

24

210

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zc6-assembly1.cif.gz_A na+ - translocating ferredoxin: nad+ reductase (rnf) of c. tetanomorphum 0.8187 15 190
8ahx-assembly1.cif.gz_A cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.7648 4 190
7zc6-assembly1.cif.gz_A na+ - translocating ferredoxin: nad+ reductase (rnf) of c. tetanomorphum 0.7558 15 190
8ahx-assembly1.cif.gz_A cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.7536 4 190
8acy-assembly1.cif.gz_D x-ray structure of na+-nqr from vibrio cholerae at 3.5 a resolution 0.7406 15 189
ID Description Score Start End Superfamily
af_P0A766_4_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8218 4 190 1.10.1760.20
af_P0A766_4_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8135 4 190 1.10.1760.20
af_P77179_4_200_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7939 15 180 1.10.1760.20
af_P77179_4_200_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6852 15 180 1.10.1760.20
af_P75916_8_143_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.4296 22 148 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A7R8ZZF5-F1-model_v4 Uncharacterized protein 0.9815 36 146 GO:0005886
GO:0012505
AF-A0A090QXG8-F1-model_v4 Electron transport complex protein RnfA 0.9707 29 168 GO:0005886
AF-X1MT07-F1-model_v4 Electron transport complex subunit RsxA 0.9533 46 146 GO:0005886
GO:0012505
AF-A0A7R8ZZF5-F1-model_v4 Uncharacterized protein 0.9476 36 146 GO:0005886
GO:0012505
AF-A0A3B8WA00-F1-model_v4 Electron transport complex subunit RsxA 0.9344 29 113 GO:0005886
GO:0012505

Feature Viewer

pLDDT pTM Quality
74.92 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map