F463763

General Info

Members Datasets Scaffolds Average Seq Length
560 328 1120 394

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0001622|Ga0500559_0001622_1180_2388
Length 402
Sequence MALTLSLPTASGSLAPYTLRGTVPAKPPAGIQFNRIAYSAAHVVADPLAVADPWLQAAVDWDTTIAYRRHLWSLGLGVAEAMDTAQRGMGLDWPTSLELIRRSLDAAKDVPGALVASGCGTDHLNLDDVKSVDDVIRGYEEQMAAIEKLGGKLIVMASRALARVAKSPADYERVYDRILSQAKQPVVLHWLGEMFDPALAGYWGTSNVDAAMDTAVGIIAAHPDKVDGIKISLLDKDKEIAMRRRLPTTGGVSGTGVRMYTGDDFNYAELIAGDGFGNEPMHGQSDALLGIFDAIAPAASSALGELAQGNVEKFHAILGPTVPLSRHIFAAPTRFYKTGVVFMAWLNGHQKHFTMVGGQQSTRSLQHFAELFRLADAANVLEKPELAVQRMKTLLALHGIDG

Samples

Sample ID Description Type Environment
1 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
86 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
150 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
174 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
179 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
180 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
181 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
182 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
183 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
184 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
185 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
186 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
261 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
262 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
263 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
264 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
268 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
273 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
274 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
275 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
276 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
279 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
282 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
283 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
284 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
285 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
286 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
287 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
288 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
289 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
290 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
291 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
292 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
293 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
294 2643221658 Variovorax sp. Root411 Isolate Unclassified
295 2643221672 Variovorax sp. Root434 Isolate Unclassified
296 2643221683 Variovorax sp. Root473 Isolate Unclassified
297 2738541277 Variovorax sp. GV051 Isolate Unclassified
298 2738543013 Variovorax sp. BT01 Isolate Unclassified
299 2738543019 Variovorax sp. GV040 Isolate Unclassified
300 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
301 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
302 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
303 2818991446 Variovorax sp. 1180 Isolate Unclassified
304 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
305 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
306 2842677519 Variovorax sp. R-72495 Isolate Unclassified
307 2842733646 Variovorax sp. R-72446 Isolate Unclassified
308 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
309 2885198086 Variovorax sp. 679 Isolate Unclassified
310 2885211737 Variovorax sp. 553 Isolate Unclassified
311 2899924645 Variovorax sp. 369 Isolate Unclassified
312 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
313 2904456579 Variovorax sp. 2002 Isolate Unclassified
314 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
315 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
316 2928037797 Variovorax sp. 1126 Isolate Unclassified
317 2928044640 Variovorax sp. 1128 Isolate Unclassified
318 2928051484 Variovorax sp. 1133 Isolate Unclassified
319 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
320 2928070936 Variovorax gossypii 1167 Isolate Unclassified
321 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
322 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
323 2929520902 Variovorax beijingensis 502 Isolate Unclassified
324 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
325 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
326 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
327 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
328 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.07
Metatranscriptomes 0.36
Isolates 8.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.5
Nodule 0.54
Rhizoplane 1.25
Rhizosphere 52.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500559_0001622 3300053136 Bacteria 12513
2 JGI24739J22299_10006205 3300001989 Bacteria 4515
3 JGI25155J39150_1000074 3300002704 Bacteria 62438
4 JGI25156J39149_1000002 3300002705 Bacteria 343501
5 JGI25154J39366_1000010 3300002738 Bacteria 297985
6 JGI25158J39367_1002342 3300002739 Bacteria 3104
7 JGI25157J39369_1000001 3300002741 Bacteria 363277
8 JGI25150J39212_1000560 3300002774 Bacteria 14945
9 JGI25159J45721_1008235 3300002987 Bacteria 2887
10 JGI25151J46595_10003546 3300003187 Bacteria 8575
11 JGI25151J46595_10005506 3300003187 Bacteria 6525
12 JGI25151J46595_10005956 3300003187 Bacteria 6215
13 JGI25153J46596_10021852 3300003215 Bacteria 2375
14 JGI25160J50197_1000192 3300003354 Bacteria 51376
15 JGI25161J50226_1000082 3300003374 Bacteria 78461
16 Ga0006562J51391_1098227 3300003578 Bacteria 2620
17 Ga0006562J51391_1112456 3300003578 Bacteria 1820
18 Ga0055535_1000979 3300003761 Bacteria 18654
19 Ga0055542_1000109 3300003762 Bacteria 111107
20 Ga0055526_1003829 3300003771 Bacteria 9352
21 Ga0055526_1003886 3300003771 Bacteria 9263
22 Ga0055537_1000259 3300003773 Bacteria 38671
23 Ga0055537_1000545 3300003773 Bacteria 21604
24 Ga0055537_1001046 3300003773 Bacteria 12403
25 Ga0055524_1000156 3300003775 Bacteria 79669
26 Ga0055536_1000270 3300003781 Bacteria 39711
27 Ga0055536_1004914 3300003781 Bacteria 6666
28 Ga0055536_1005013 3300003781 Bacteria 6582
29 Ga0055536_1015426 3300003781 Bacteria 2615
30 Ga0055534_1000401 3300003784 Bacteria 26682
31 Ga0055534_1000793 3300003784 Bacteria 14714
32 Ga0055534_1004461 3300003784 Bacteria 4049
33 Ga0055534_1005449 3300003784 Bacteria 3399
34 Ga0055528_1004813 3300003790 Bacteria 6423
35 Ga0055528_1006403 3300003790 Bacteria 5343
36 Ga0055530_10000408 3300003791 Bacteria 38218
37 Ga0055530_10004085 3300003791 Bacteria 7785
38 Ga0055540_1000033 3300003792 Bacteria 172048
39 Ga0055540_1001287 3300003792 Bacteria 15227
40 Ga0055540_1002207 3300003792 Bacteria 10575
41 Ga0055540_1004166 3300003792 Bacteria 6666
42 Ga0055531_10000273 3300003794 Bacteria 53570
43 Ga0055531_10000887 3300003794 Bacteria 24452
44 Ga0055531_10002940 3300003794 Bacteria 11088
45 Ga0055531_10016432 3300003794 Bacteria 3192
46 Ga0055543_1000127 3300004625 Bacteria 63245
47 Ga0065165_1002675 3300005262 Bacteria 14377
48 Ga0065165_1005939 3300005262 Bacteria 6611
49 Ga0065165_1007621 3300005262 Bacteria 5270
50 Ga0070658_10011109 3300005327 Bacteria 7219
51 Ga0070676_10059971 3300005328 Bacteria 2258
52 Ga0070676_10078213 3300005328 Bacteria 2000
53 Ga0070670_100004793 3300005331 Bacteria 11358
54 Ga0070670_100030538 3300005331 Bacteria 4640
55 Ga0070677_10014356 3300005333 Bacteria 2786
56 Ga0068869_100016323 3300005334 Bacteria 5003
57 Ga0068868_100001939 3300005338 Bacteria 14194
58 Ga0068868_100132869 3300005338 Bacteria 2038
59 Ga0070661_100109387 3300005344 Bacteria 2062
60 Ga0070668_100065041 3300005347 Bacteria 2828
61 Ga0070669_100010035 3300005353 Bacteria 6732
62 Ga0070675_100017436 3300005354 Bacteria 5705
63 Ga0070675_100059102 3300005354 Bacteria 3162
64 Ga0070675_100265729 3300005354 Bacteria 1504
65 Ga0070671_100002733 3300005355 Bacteria 13699
66 Ga0070671_100003978 3300005355 Bacteria 11639
67 Ga0070671_100011229 3300005355 Bacteria 7193
68 Ga0070671_100031975 3300005355 Bacteria 4350
69 Ga0070671_100083288 3300005355 Bacteria 2674
70 Ga0070671_100127438 3300005355 Bacteria 2143
71 Ga0070674_100001350 3300005356 Bacteria 12930
72 Ga0070674_100124819 3300005356 Bacteria 1910
73 Ga0070673_100001119 3300005364 Bacteria 15383
74 Ga0070673_100002284 3300005364 Bacteria 11625
75 Ga0070673_100280459 3300005364 Bacteria 1461
76 Ga0070667_100005274 3300005367 Bacteria 10812
77 Ga0070667_100090797 3300005367 Bacteria 2626
78 Ga0070678_100000866 3300005456 Bacteria 15460
79 Ga0070678_100208532 3300005456 Bacteria 1617
80 Ga0070678_100240180 3300005456 Bacteria 1514
81 Ga0068867_100027893 3300005459 Bacteria 4062
82 Ga0068867_100061359 3300005459 Bacteria 2791
83 Ga0068867_100114015 3300005459 Bacteria 2081
84 Ga0068867_100179239 3300005459 Bacteria 1683
85 Ga0070706_100000533 3300005467 Bacteria 44257
86 Ga0070707_100003061 3300005468 Bacteria 15843
87 Ga0070698_100035442 3300005471 Bacteria 5160
88 Ga0068853_100312066 3300005539 Bacteria 1456
89 Ga0070672_100000317 3300005543 Bacteria 27420
90 Ga0070672_100016328 3300005543 Bacteria 5314
91 Ga0068855_100073769 3300005563 Bacteria 3964
92 Ga0068854_100195899 3300005578 Bacteria 1585
93 Ga0068856_100014070 3300005614 Bacteria 7738
94 Ga0068856_100106369 3300005614 Bacteria 2800
95 Ga0068859_100028290 3300005617 Bacteria 5619
96 Ga0068864_100001940 3300005618 Bacteria 16988
97 Ga0068864_100009933 3300005618 Bacteria 7851
98 Ga0068864_100054831 3300005618 Bacteria 3440
99 Ga0068866_10020184 3300005718 Bacteria 3049
100 Ga0068863_100005859 3300005841 Bacteria 12041
101 Ga0068863_100196639 3300005841 Bacteria 1938
102 Ga0068858_100001490 3300005842 Bacteria 24132
103 Ga0068862_100121854 3300005844 Bacteria 2299
104 Ga0075368_10042066 3300006042 Bacteria 1797
105 Ga0075432_10021037 3300006058 Bacteria 2231
106 Ga0075362_10000768 3300006177 Bacteria 9563
107 Ga0075367_10040417 3300006178 Bacteria 2723
108 Ga0075367_10051095 3300006178 Bacteria 2443
109 Ga0075369_10041831 3300006186 Bacteria 1962
110 Ga0075366_10027385 3300006195 Bacteria 3343
111 Ga0075366_10035232 3300006195 Bacteria 2951
112 Ga0075366_10068687 3300006195 Bacteria 2108
113 Ga0097621_100003255 3300006237 Bacteria 11167
114 Ga0097621_100028025 3300006237 Bacteria 4435
115 Ga0097621_100030902 3300006237 Bacteria 4243
116 Ga0075370_10021642 3300006353 Bacteria 3523
117 Ga0075370_10062658 3300006353 Bacteria 2119
118 Ga0075370_10081802 3300006353 Bacteria 1856
119 Ga0068871_100003086 3300006358 Bacteria 11430
120 Ga0068871_100008471 3300006358 Bacteria 7397
121 Ga0068871_100090494 3300006358 Bacteria 2549
122 Ga0097620_100028290 3300006931 Bacteria 5619
123 Ga0099826_10003523 3300006948 Bacteria 10657
124 Ga0105240_10067726 3300009093 Bacteria 4425
125 Ga0105243_10024402 3300009148 Bacteria 4612
126 Ga0105243_10059965 3300009148 Bacteria 3038
127 Ga0105242_10013122 3300009176 Bacteria 6393
128 Ga0105248_10005047 3300009177 Bacteria 14574
129 Ga0105248_10025053 3300009177 Bacteria 6632
130 Ga0105237_10113485 3300009545 Bacteria 2702
131 Ga0105239_10049832 3300010375 Bacteria 4593
132 Ga0157370_10012486 3300013104 Bacteria 8804
133 Ga0157370_10339337 3300013104 Bacteria 1385
134 Ga0157378_10126900 3300013297 Bacteria 2357
135 Ga0163162_10042571 3300013306 Bacteria 4546
136 Ga0157372_10286100 3300013307 Bacteria 1917
137 Ga0157375_10090616 3300013308 Bacteria 3117
138 Ga0157375_10239558 3300013308 Bacteria 1974
139 Ga0182008_10001922 3300014497 Bacteria 13434
140 Ga0182008_10005888 3300014497 Bacteria 6928
141 Ga0182008_10011801 3300014497 Bacteria 4634
142 Ga0157379_10013935 3300014968 Bacteria 7047
143 Ga0157379_10014706 3300014968 Bacteria 6865
144 Ga0157376_10002902 3300014969 Bacteria 11751
145 Ga0182006_1001283 3300015261 Bacteria 15488
146 Ga0182006_1022764 3300015261 Bacteria 2601
147 Ga0182007_10000457 3300015262 Bacteria 24654
148 Ga0183362_10001 3300015683 Bacteria 2046624
149 Ga0183361_10005 3300016635 Bacteria 413599
150 Ga0163161_10000157 3300017792 Bacteria 62919
151 Ga0209435_100001 3300025206 Bacteria 1424171
152 Ga0209672_101187 3300025228 Bacteria 10602
153 Ga0209258_100048 3300025242 Bacteria 365881
154 Ga0207425_1000258 3300025245 Bacteria 39372
155 Ga0207425_1000931 3300025245 Bacteria 13926
156 Ga0207425_1001584 3300025245 Bacteria 9233
157 Ga0209646_1000001 3300025246 Bacteria 3092932
158 Ga0209026_1000001 3300025250 Bacteria 1228671
159 Ga0209148_1000040 3300025254 Bacteria 473531
160 Ga0209759_1000001 3300025256 Bacteria 2799452
161 Ga0209129_1000561 3300025258 Bacteria 25607
162 Ga0209129_1002624 3300025258 Bacteria 8557
163 Ga0209129_1009383 3300025258 Bacteria 2585
164 Ga0209565_1000175 3300025263 Bacteria 81833
165 Ga0209565_1000326 3300025263 Bacteria 42448
166 Ga0209565_1000338 3300025263 Bacteria 41553
167 Ga0209565_1000945 3300025263 Bacteria 15237
168 Ga0209565_1000965 3300025263 Bacteria 14980
169 Ga0209565_1009380 3300025263 Bacteria 2489
170 Ga0209673_1000099 3300025273 Bacteria 193248
171 Ga0209673_1000839 3300025273 Bacteria 40180
172 Ga0209673_1001436 3300025273 Bacteria 22679
173 Ga0209673_1003204 3300025273 Bacteria 9913
174 Ga0209130_1000041 3300025284 Bacteria 261078
175 Ga0209130_1000820 3300025284 Bacteria 26179
176 Ga0209130_1005723 3300025284 Bacteria 4219
177 Ga0209130_1017827 3300025284 Bacteria 1681
178 Ga0209675_1000054 3300025291 Bacteria 193248
179 Ga0209675_1000482 3300025291 Bacteria 30258
180 Ga0209675_1001405 3300025291 Bacteria 13967
181 Ga0209675_1001970 3300025291 Bacteria 11023
182 Ga0209675_1021845 3300025291 Bacteria 1696
183 Ga0209676_1000004 3300025292 Bacteria 1138360
184 Ga0209676_1000054 3300025292 Bacteria 365890
185 Ga0209676_1000340 3300025292 Bacteria 88869
186 Ga0209676_1001062 3300025292 Bacteria 31455
187 Ga0209676_1006039 3300025292 Bacteria 6103
188 Ga0209025_1000518 3300025294 Bacteria 73450
189 Ga0209025_1001546 3300025294 Bacteria 29313
190 Ga0209025_1001743 3300025294 Bacteria 26113
191 Ga0209025_1015515 3300025294 Bacteria 4584
192 Ga0209025_1026580 3300025294 Bacteria 2899
193 Ga0209025_1037000 3300025294 Bacteria 2174
194 Ga0209025_1051235 3300025294 Bacteria 1642
195 Ga0209564_1000662 3300025295 Bacteria 50934
196 Ga0209564_1000784 3300025295 Bacteria 44001
197 Ga0209564_1001224 3300025295 Bacteria 29005
198 Ga0209564_1014272 3300025295 Bacteria 3315
199 Ga0209758_1000025 3300025297 Bacteria 586687
200 Ga0209758_1004328 3300025297 Bacteria 11924
201 Ga0209050_1000002 3300025298 Bacteria 1792849
202 Ga0209050_1000003 3300025298 Bacteria 1609245
203 Ga0209050_1000270 3300025298 Bacteria 110916
204 Ga0209050_1001154 3300025298 Bacteria 31587
205 Ga0209050_1005930 3300025298 Bacteria 7445
206 Ga0209050_1030972 3300025298 Bacteria 1676
207 Ga0209256_1000001 3300025299 Bacteria 2166974
208 Ga0209256_1001195 3300025299 Bacteria 29085
209 Ga0209256_1001278 3300025299 Bacteria 27283
210 Ga0209256_1017055 3300025299 Bacteria 2435
211 Ga0207426_1000001 3300025302 Bacteria 1341301
212 Ga0207426_1000061 3300025302 Bacteria 362507
213 Ga0207426_1000178 3300025302 Bacteria 159291
214 Ga0207426_1001845 3300025302 Bacteria 15584
215 Ga0209051_1000002 3300025303 Bacteria 1631846
216 Ga0209051_1000003 3300025303 Bacteria 1609245
217 Ga0209051_1000256 3300025303 Bacteria 88869
218 Ga0209051_1000529 3300025303 Bacteria 47407
219 Ga0209051_1000661 3300025303 Bacteria 38725
220 Ga0209051_1003841 3300025303 Bacteria 9616
221 Ga0209051_1009802 3300025303 Bacteria 4905
222 Ga0209257_1000002 3300025304 Bacteria 1767052
223 Ga0209257_1000012 3300025304 Bacteria 1111138
224 Ga0209257_1000018 3300025304 Bacteria 836016
225 Ga0209257_1000361 3300025304 Bacteria 92239
226 Ga0209257_1005386 3300025304 Bacteria 9018
227 Ga0209257_1006888 3300025304 Bacteria 7123
228 Ga0209257_1022414 3300025304 Bacteria 2253
229 Ga0207656_10082882 3300025321 Bacteria 1444
230 Ga0207655_1066491 3300025728 Bacteria 1362
231 Ga0207682_10002471 3300025893 Bacteria 8274
232 Ga0207688_10051094 3300025901 Bacteria 2315
233 Ga0207645_10023649 3300025907 Bacteria 3989
234 Ga0207645_10046723 3300025907 Bacteria 2765
235 Ga0207705_10056289 3300025909 Bacteria 2835
236 Ga0207684_10003382 3300025910 Bacteria 15630
237 Ga0207646_10022994 3300025922 Bacteria 5732
238 Ga0207681_10016055 3300025923 Bacteria 4676
239 Ga0207681_10097711 3300025923 Bacteria 2111
240 Ga0207681_10104984 3300025923 Bacteria 2045
241 Ga0207650_10005456 3300025925 Bacteria 8680
242 Ga0207650_10010097 3300025925 Bacteria 6468
243 Ga0207650_10025178 3300025925 Bacteria 4237
244 Ga0207650_10062452 3300025925 Bacteria 2783
245 Ga0207659_10019299 3300025926 Bacteria 4484
246 Ga0207659_10059019 3300025926 Bacteria 2756
247 Ga0207687_10034092 3300025927 Bacteria 3455
248 Ga0207644_10000440 3300025931 Bacteria 26885
249 Ga0207644_10009714 3300025931 Bacteria 6325
250 Ga0207644_10015614 3300025931 Bacteria 5100
251 Ga0207644_10027408 3300025931 Bacteria 3935
252 Ga0207706_10043517 3300025933 Bacteria 3979
253 Ga0207706_10050498 3300025933 Bacteria 3675
254 Ga0207709_10000883 3300025935 Bacteria 22672
255 Ga0207669_10005245 3300025937 Bacteria 5796
256 Ga0207691_10001479 3300025940 Bacteria 23445
257 Ga0207691_10008150 3300025940 Bacteria 10057
258 Ga0207691_10057878 3300025940 Bacteria 3526
259 Ga0207691_10087569 3300025940 Bacteria 2794
260 Ga0207711_10002271 3300025941 Bacteria 17262
261 Ga0207711_10003157 3300025941 Bacteria 14362
262 Ga0207711_10007140 3300025941 Bacteria 9362
263 Ga0207711_10189777 3300025941 Bacteria 1872
264 Ga0207679_10040667 3300025945 Bacteria 3330
265 Ga0207667_10058825 3300025949 Bacteria 4029
266 Ga0207667_10097922 3300025949 Bacteria 3027
267 Ga0207658_10001754 3300025986 Bacteria 16311
268 Ga0207658_10067409 3300025986 Bacteria 2695
269 Ga0207658_10177087 3300025986 Bacteria 1762
270 Ga0207677_10025562 3300026023 Bacteria 3686
271 Ga0207677_10106534 3300026023 Bacteria 2077
272 Ga0207703_10088249 3300026035 Bacteria 2602
273 Ga0207708_10042042 3300026075 Bacteria 3484
274 Ga0207702_10046788 3300026078 Bacteria 3643
275 Ga0207641_10005718 3300026088 Bacteria 10565
276 Ga0207641_10278557 3300026088 Bacteria 1572
277 Ga0207641_10316618 3300026088 Bacteria 1478
278 Ga0207648_10042453 3300026089 Bacteria 3992
279 Ga0207648_10085688 3300026089 Bacteria 2748
280 Ga0207676_10006093 3300026095 Bacteria 8509
281 Ga0207676_10056432 3300026095 Bacteria 3088
282 Ga0207676_10107651 3300026095 Bacteria 2325
283 Ga0207676_10150026 3300026095 Bacteria 2007
284 Ga0207674_10019829 3300026116 Bacteria 7276
285 Ga0207675_100088763 3300026118 Bacteria 2904
286 Ga0207683_10001491 3300026121 Bacteria 21111
287 Ga0207683_10031890 3300026121 Bacteria 4576
288 Ga0207683_10087815 3300026121 Bacteria 2765
289 Ga0209970_1000441 3300027614 Bacteria 7088
290 Ga0209282_1000328 3300027666 Bacteria 23523
291 Ga0209813_10028566 3300027866 Bacteria 1628
292 Ga0268266_10362554 3300028379 Bacteria 1364
293 Ga0268265_10033549 3300028380 Bacteria 3733
294 Ga0268265_10070195 3300028380 Bacteria 2723
295 Ga0268264_10241517 3300028381 Bacteria 1673
296 Ga0307517_10000052 3300028786 Bacteria 155904
297 Ga0307517_10109013 3300028786 Bacteria 2121
298 Ga0307517_10182386 3300028786 Bacteria 1352
299 Ga0307515_10000006 3300028794 Bacteria 725810
300 Ga0307515_10000152 3300028794 Bacteria 167305
301 Ga0307515_10000477 3300028794 Bacteria 95378
302 Ga0307515_10007820 3300028794 Bacteria 21030
303 Ga0307515_10052216 3300028794 Bacteria 6069
304 Ga0307512_10088286 3300030522 Bacteria 2178
305 Ga0307512_10117846 3300030522 Bacteria 1719
306 Ga0307512_10126248 3300030522 Bacteria 1623
307 Ga0316182_1194386 3300030745 Bacteria 2236
308 Ga0265327_10001507 3300031251 Bacteria 28832
309 Ga0265327_10019625 3300031251 Bacteria 4147
310 Ga0307513_10000012 3300031456 Bacteria 328865
311 Ga0307513_10000285 3300031456 Bacteria 73356
312 Ga0307513_10022829 3300031456 Bacteria 7341
313 Ga0307513_10036366 3300031456 Bacteria 5494
314 Ga0307513_10040287 3300031456 Bacteria 5167
315 Ga0307513_10113173 3300031456 Bacteria 2702
316 Ga0307509_10000180 3300031507 Bacteria 98647
317 Ga0307408_100001846 3300031548 Bacteria 15426
318 Ga0307408_100227867 3300031548 Bacteria 1524
319 Ga0307508_10001693 3300031616 Bacteria 24447
320 Ga0307514_10098079 3300031649 Bacteria 2113
321 Ga0265342_10043496 3300031712 Bacteria 2710
322 Ga0307516_10002523 3300031730 Bacteria 24368
323 Ga0307516_10010756 3300031730 Bacteria 10022
324 Ga0307516_10103161 3300031730 Bacteria 2666
325 Ga0307405_10000786 3300031731 Bacteria 12424
326 Ga0307405_10076280 3300031731 Bacteria 2174
327 Ga0307405_10184709 3300031731 Bacteria 1500
328 Ga0307413_10027988 3300031824 Bacteria 3132
329 Ga0307406_10001827 3300031901 Bacteria 11607
330 Ga0307406_10005768 3300031901 Bacteria 6782
331 Ga0307407_10072167 3300031903 Bacteria 2058
332 Ga0307412_10095144 3300031911 Bacteria 2093
333 Ga0307416_100033682 3300032002 Bacteria 3887
334 Ga0307414_10196315 3300032004 Bacteria 1637
335 Ga0307414_10302301 3300032004 Bacteria 1354
336 Ga0307411_10004273 3300032005 Bacteria 6810
337 Ga0307411_10171777 3300032005 Bacteria 1635
338 Ga0307510_10003830 3300033180 Bacteria 17622
339 Ga0307510_10063365 3300033180 Bacteria 3766
340 Ga0373937_0440315 3300036401 Bacteria 1237
341 Ga0395900_0248185 3300037418 Bacteria 1782
342 Ga0395898_0331683 3300037466 Bacteria 1451
343 Ga0395905_0008547 3300037471 Bacteria 10096
344 Ga0395905_0020605 3300037471 Bacteria 6243
345 Ga0395905_0250207 3300037471 Bacteria 1655
346 Ga0395901_0057751 3300038443 Bacteria 4036
347 Ga0395901_0358692 3300038443 Bacteria 1503
348 Ga0439436_0000292 3300041404 Bacteria 12116
349 Ga0439436_0002693 3300041404 Bacteria 5362
350 Ga0439439_0011112 3300041406 Bacteria 2162
351 Ga0439466_0026792 3300041411 Bacteria 2001
352 Ga0439465_0000034 3300041413 Bacteria 28027
353 Ga0439431_0003731 3300041997 Bacteria 3365
354 Ga0439442_011163 3300042002 Bacteria 1826
355 Ga0439432_001169 3300042006 Bacteria 9941
356 Ga0439432_003630 3300042006 Bacteria 5708
357 Ga0439449_0001078 3300042007 Bacteria 10742
358 Ga0439449_0004176 3300042007 Bacteria 5581
359 Ga0439449_0009006 3300042007 Bacteria 3786
360 Ga0439449_0011087 3300042007 Bacteria 3397
361 Ga0439457_007283 3300042014 Bacteria 2664
362 Ga0439457_008339 3300042014 Bacteria 2449
363 Ga0439462_0003234 3300042015 Bacteria 3888
364 Ga0439462_0004503 3300042015 Bacteria 3405
365 Ga0439462_0019716 3300042015 Bacteria 1756
366 Ga0450911_000073 3300042115 Bacteria 41447
367 Ga0450923_000859 3300042125 Bacteria 3703
368 Ga0450923_002456 3300042125 Bacteria 2662
369 Ga0450910_003481 3300042147 Bacteria 2089
370 Ga0450908_002155 3300042184 Bacteria 3856
371 Ga0439434_0002881 3300042435 Bacteria 5023
372 Ga0439434_0015644 3300042435 Bacteria 2262
373 Ga0451577_0088531 3300042876 Bacteria 2762
374 Ga0466969_0046693 3300044656 Bacteria 2146
375 Ga0466960_0073824 3300044901 Bacteria 1703
376 Ga0466959_0052584 3300045049 Bacteria 2982
377 Ga0495627_022495 3300046453 Bacteria 2075
378 Ga0495592_0000542 3300046454 Bacteria 26890
379 Ga0495650_0004494 3300046471 Bacteria 9528
380 Ga0495639_0006826 3300046475 Bacteria 4908
381 Ga0495616_0006376 3300046513 Bacteria 7143
382 Ga0495630_0051456 3300046517 Bacteria 3083
383 Ga0495632_0005062 3300046519 Bacteria 8817
384 Ga0495637_0003434 3300046520 Bacteria 8414
385 Ga0495663_0012530 3300046525 Bacteria 2363
386 Ga0495663_0022777 3300046525 Bacteria 1812
387 Ga0495642_0020158 3300046528 Bacteria 2617
388 Ga0495654_0038518 3300046530 Bacteria 2390
389 Ga0495597_0004543 3300046542 Bacteria 7594
390 Ga0495622_0004852 3300046557 Bacteria 6227
391 Ga0495656_0000330 3300046615 Bacteria 16237
392 Ga0495625_0000896 3300046660 Bacteria 40225
393 Ga0495625_0016738 3300046660 Bacteria 5758
394 Ga0495671_0024667 3300046692 Bacteria 3129
395 Ga0495674_0059089 3300047319 Bacteria 3350
396 Ga0495676_0046311 3300047321 Bacteria 3530
397 Ga0495687_000232 3300047443 Bacteria 77572
398 Ga0495686_0114741 3300047472 Bacteria 1612
399 Ga0495593_0006405 3300047673 Bacteria 6904
400 Ga0496100_0006212 3300048903 Bacteria 6497
401 Ga0496104_0014867 3300048907 Bacteria 7035
402 Ga0496105_0105631 3300048908 Bacteria 2325
403 Ga0496106_0166293 3300048909 Bacteria 1746
404 Ga0496116_0089353 3300048919 Bacteria 1879
405 Ga0496117_0056757 3300048920 Bacteria 2724
406 Ga0496118_0007129 3300048921 Bacteria 11988
407 Ga0496118_0013420 3300048921 Bacteria 7752
408 Ga0496118_0026683 3300048921 Bacteria 4912
409 Ga0496119_0100344 3300048922 Bacteria 1626
410 Ga0496121_0004129 3300048924 Bacteria 19884
411 Ga0496121_0122955 3300048924 Bacteria 1956
412 Ga0496124_0007186 3300048927 Bacteria 11900
413 Ga0496125_0006678 3300048928 Bacteria 12416
414 Ga0496125_0012318 3300048928 Bacteria 8497
415 Ga0496125_0099008 3300048928 Bacteria 2155
416 Ga0496125_0103180 3300048928 Bacteria 2093
417 Ga0496126_0014761 3300048929 Bacteria 7882
418 Ga0501031_0000657 3300049568 Bacteria 20491
419 Ga0501032_0002170 3300049569 Bacteria 15449
420 Ga0501032_0015947 3300049569 Bacteria 5289
421 Ga0501033_0001652 3300049570 Bacteria 19522
422 Ga0501033_0002364 3300049570 Bacteria 16092
423 Ga0501034_0004990 3300049571 Bacteria 14602
424 Ga0501034_0082503 3300049571 Bacteria 3216
425 Ga0501036_0001669 3300049572 Bacteria 17200
426 Ga0501036_0095824 3300049572 Bacteria 2509
427 Ga0501037_0000124 3300049573 Bacteria 71522
428 Ga0501037_0040203 3300049573 Bacteria 3441
429 Ga0501038_0069970 3300049574 Bacteria 2980
430 Ga0501043_0000003 3300049579 Bacteria 318844
431 Ga0501043_0000597 3300049579 Bacteria 31961
432 Ga0501043_0004134 3300049579 Bacteria 11860
433 Ga0501046_0000034 3300049580 Bacteria 173742
434 Ga0501046_0010185 3300049580 Bacteria 8089
435 Ga0501047_0000042 3300049581 Bacteria 176603
436 Ga0501047_0001038 3300049581 Bacteria 27775
437 Ga0501048_0002356 3300049582 Bacteria 14420
438 Ga0501068_0006559 3300049584 Bacteria 6419
439 Ga0501069_0000003 3300049585 Bacteria 210301
440 Ga0501070_0000477 3300049586 Bacteria 36435
441 Ga0501070_0049393 3300049586 Bacteria 3493
442 Ga0501070_0107729 3300049586 Bacteria 2303
443 Ga0501071_0001232 3300049587 Bacteria 14484
444 Ga0501073_0012494 3300049589 Bacteria 6195
445 Ga0501074_0000007 3300049590 Bacteria 111136
446 Ga0501249_016079 3300049679 Bacteria 1605
447 Ga0501225_0005230 3300049705 Bacteria 3819
448 Ga0501080_0001339 3300049742 Bacteria 20548
449 Ga0501080_0150067 3300049742 Bacteria 2155
450 Ga0501083_0000024 3300049744 Bacteria 123029
451 Ga0501262_000213 3300049759 Bacteria 7205
452 Ga0501035_0001537 3300049822 Bacteria 23475
453 Ga0501035_0021541 3300049822 Bacteria 5926
454 Ga0501035_0029845 3300049822 Bacteria 4973
455 Ga0501044_0000016 3300049823 Bacteria 231626
456 Ga0501044_0024356 3300049823 Bacteria 6428
457 Ga0501044_0106346 3300049823 Bacteria 2818
458 Ga0501045_0001216 3300049824 Bacteria 17144
459 nmdc:mga03683_13631_c1 3300050489 Bacteria 2996
460 nmdc:mga03683_54364_c1 3300050489 Bacteria 1679
461 nmdc:mga0yw44_90516_c1 3300050492 Bacteria 1933
462 nmdc:mga0k408_116102_c1 3300050493 Bacteria 1584
463 nmdc:mga0k408_1519_c1 3300050493 Bacteria 12529
464 nmdc:mga0k408_32063_c1 3300050493 Bacteria 3002
465 nmdc:mga0k408_47115_c1 3300050493 Bacteria 2491
466 nmdc:mga0k408_83502_c1 3300050493 Bacteria 1872
467 nmdc:mga06z11_50865_c1 3300050494 Bacteria 2119
468 nmdc:mga06z11_58201_c1 3300050494 Bacteria 2004
469 nmdc:mga06z11_9491_c1 3300050494 Bacteria 4102
470 nmdc:mga04h51_34003_c1 3300050495 Bacteria 1626
471 nmdc:mga07m45_28085_c1 3300050496 Bacteria 3105
472 nmdc:mga07m45_474_c1 3300050496 Bacteria 16977
473 nmdc:mga07m45_57304_c1 3300050496 Bacteria 2203
474 nmdc:mga07m45_6003_c1 3300050496 Bacteria 6110
475 nmdc:mga07m45_637_c1 3300050496 Bacteria 14921
476 nmdc:mga07m45_7020_c1 3300050496 Bacteria 5729
477 nmdc:mga07m45_80268_c1 3300050496 Bacteria 1863
478 Ga0500610_0001354 3300053079 Bacteria 8288
479 Ga0500610_0003143 3300053079 Bacteria 6272
480 Ga0500643_005499 3300053087 Bacteria 5452
481 Ga0500644_0004271 3300053088 Bacteria 3570
482 Ga0500651_0000087 3300053093 Bacteria 59423
483 Ga0500651_0029129 3300053093 Bacteria 3470
484 Ga0500651_0029751 3300053093 Bacteria 3436
485 Ga0500566_0131534 3300053094 Bacteria 1338
486 Ga0500571_000526 3300053110 Bacteria 15753
487 Ga0500593_000393 3300053117 Bacteria 17401
488 Ga0500593_000853 3300053117 Bacteria 11347
489 Ga0500607_003994 3300053121 Bacteria 10397
490 Ga0500628_000981 3300053129 Bacteria 5012
491 Ga0500642_0055231 3300053130 Bacteria 1766
492 Ga0500652_000510 3300053131 Bacteria 13683
493 Ga0500655_000134 3300053133 Bacteria 18512
494 Ga0500658_0000178 3300053134 Bacteria 30470
495 Ga0500658_0000425 3300053134 Bacteria 18299
496 Ga0500559_0004675 3300053136 Bacteria 6447
497 Ga0500559_0032164 3300053136 Bacteria 2253
498 Ga0500568_0000296 3300053139 Bacteria 40370
499 Ga0500586_026868 3300053145 Bacteria 1867
500 Ga0500616_0015300 3300053153 Bacteria 4389
501 Ga0500622_0000106 3300053156 Bacteria 85750
502 Ga0500622_0048177 3300053156 Bacteria 2200
503 Ga0500627_0001043 3300053158 Bacteria 7548
504 Ga0500634_0005923 3300053161 Bacteria 5864
505 Ga0500634_0082648 3300053161 Bacteria 1651
506 Ga0500638_017325 3300053162 Bacteria 3343
507 Ga0500625_059711 3300053729 Bacteria 1735
508 Ga0500645_000426 3300053730 Bacteria 29176
509 Ga0500645_000739 3300053730 Bacteria 20078
510 Ga0500587_001122 3300053739 Bacteria 3683
511 Ga0500661_001865 3300055283 Bacteria 3984
512 Ga0501082_0177124 3300060353 Bacteria 1854
513 2511244341 2511231002 Bacteria 5042903
514 2513228802 2513020051 Bacteria 6053213
515 2587758484 2585428062 Bacteria 6842168
516 2588292199 2588253510 Bacteria 6901809
517 2599624750 2599185214 Bacteria 8209958
518 2599672762 2599185226 Bacteria 8233575
519 2599682788 2599185227 Bacteria 8246414
520 2599694371 2599185229 Bacteria 8216126
521 2643971836 2643221592 Bacteria 6608788
522 2644139325 2643221625 Bacteria 6512927
523 2644162600 2643221628 Bacteria 5745828
524 2644274935 2643221648 Bacteria 6521465
525 2644304436 2643221654 Bacteria 5273570
526 2644325107 2643221658 Bacteria 6064537
527 2644400165 2643221672 Bacteria 6322190
528 2644467674 2643221683 Bacteria 5749203
529 2738718837 2738541277 Bacteria 7458140
530 2739248568 2738543013 Bacteria 5618633
531 2739280855 2738543019 Bacteria 7459457
532 2808973828 2808606384 Bacteria 8474373
533 2809008730 2808606390 Bacteria 8476311
534 2809015764 2808606391 Bacteria 8308166
535 2819596715 2818991446 Bacteria 7757362
536 2831265815 2831265667 Bacteria 7184833
537 2838060731 2838054893 Bacteria 7451788
538 2842681325 2842677519 Bacteria 5615038
539 2842734743 2842733646 Bacteria 5716726
540 2885195616 2885192300 Bacteria 5882526
541 2885203415 2885198086 Bacteria 7212419
542 2885217235 2885211737 Bacteria 7212420
543 2899930500 2899924645 Bacteria 7487985
544 2904450065 2904449895 Bacteria 6927402
545 2904457119 2904456579 Bacteria 6819253
546 2904479927 2904479285 Bacteria 5073931
547 2919465008 2919462493 Bacteria 5817112
548 2928039614 2928037797 Bacteria 7273642
549 2928044781 2928044640 Bacteria 7271509
550 2928052582 2928051484 Bacteria 7773759
551 2928064757 2928064002 Bacteria 7419480
552 2928074781 2928070936 Bacteria 8062541
553 2928088946 2928084124 Bacteria 7159212
554 2928120829 2928115317 Bacteria 6477646
555 2929525347 2929520902 Bacteria 6765052
556 2945910980 2945909444 Bacteria 7065066
557 2945948723 2945945610 Bacteria 5951079
558 2945972848 2945972063 Bacteria 6086495
559 2945986785 2945984333 Bacteria 7358892
560 2954772867 2954767861 Bacteria 5535784
561 Ga0500559_0001622
562 JGI24739J22299_10006205
563 JGI25155J39150_1000074
564 JGI25156J39149_1000002
565 JGI25154J39366_1000010
566 JGI25158J39367_1002342
567 JGI25157J39369_1000001
568 JGI25150J39212_1000560
569 JGI25159J45721_1008235
570 JGI25151J46595_10003546
571 JGI25151J46595_10005506
572 JGI25151J46595_10005956
573 JGI25153J46596_10021852
574 JGI25160J50197_1000192
575 JGI25161J50226_1000082
576 Ga0006562J51391_1098227
577 Ga0006562J51391_1112456
578 Ga0055535_1000979
579 Ga0055542_1000109
580 Ga0055526_1003829
581 Ga0055526_1003886
582 Ga0055537_1000259
583 Ga0055537_1000545
584 Ga0055537_1001046
585 Ga0055524_1000156
586 Ga0055536_1000270
587 Ga0055536_1004914
588 Ga0055536_1005013
589 Ga0055536_1015426
590 Ga0055534_1000401
591 Ga0055534_1000793
592 Ga0055534_1004461
593 Ga0055534_1005449
594 Ga0055528_1004813
595 Ga0055528_1006403
596 Ga0055530_10000408
597 Ga0055530_10004085
598 Ga0055540_1000033
599 Ga0055540_1001287
600 Ga0055540_1002207
601 Ga0055540_1004166
602 Ga0055531_10000273
603 Ga0055531_10000887
604 Ga0055531_10002940
605 Ga0055531_10016432
606 Ga0055543_1000127
607 Ga0065165_1002675
608 Ga0065165_1005939
609 Ga0065165_1007621
610 Ga0070658_10011109
611 Ga0070676_10059971
612 Ga0070676_10078213
613 Ga0070670_100004793
614 Ga0070670_100030538
615 Ga0070677_10014356
616 Ga0068869_100016323
617 Ga0068868_100001939
618 Ga0068868_100132869
619 Ga0070661_100109387
620 Ga0070668_100065041
621 Ga0070669_100010035
622 Ga0070675_100017436
623 Ga0070675_100059102
624 Ga0070675_100265729
625 Ga0070671_100002733
626 Ga0070671_100003978
627 Ga0070671_100011229
628 Ga0070671_100031975
629 Ga0070671_100083288
630 Ga0070671_100127438
631 Ga0070674_100001350
632 Ga0070674_100124819
633 Ga0070673_100001119
634 Ga0070673_100002284
635 Ga0070673_100280459
636 Ga0070667_100005274
637 Ga0070667_100090797
638 Ga0070678_100000866
639 Ga0070678_100208532
640 Ga0070678_100240180
641 Ga0068867_100027893
642 Ga0068867_100061359
643 Ga0068867_100114015
644 Ga0068867_100179239
645 Ga0070706_100000533
646 Ga0070707_100003061
647 Ga0070698_100035442
648 Ga0068853_100312066
649 Ga0070672_100000317
650 Ga0070672_100016328
651 Ga0068855_100073769
652 Ga0068854_100195899
653 Ga0068856_100014070
654 Ga0068856_100106369
655 Ga0068859_100028290
656 Ga0068864_100001940
657 Ga0068864_100009933
658 Ga0068864_100054831
659 Ga0068866_10020184
660 Ga0068863_100005859
661 Ga0068863_100196639
662 Ga0068858_100001490
663 Ga0068862_100121854
664 Ga0075368_10042066
665 Ga0075432_10021037
666 Ga0075362_10000768
667 Ga0075367_10040417
668 Ga0075367_10051095
669 Ga0075369_10041831
670 Ga0075366_10027385
671 Ga0075366_10035232
672 Ga0075366_10068687
673 Ga0097621_100003255
674 Ga0097621_100028025
675 Ga0097621_100030902
676 Ga0075370_10021642
677 Ga0075370_10062658
678 Ga0075370_10081802
679 Ga0068871_100003086
680 Ga0068871_100008471
681 Ga0068871_100090494
682 Ga0097620_100028290
683 Ga0099826_10003523
684 Ga0105240_10067726
685 Ga0105243_10024402
686 Ga0105243_10059965
687 Ga0105242_10013122
688 Ga0105248_10005047
689 Ga0105248_10025053
690 Ga0105237_10113485
691 Ga0105239_10049832
692 Ga0157370_10012486
693 Ga0157370_10339337
694 Ga0157378_10126900
695 Ga0163162_10042571
696 Ga0157372_10286100
697 Ga0157375_10090616
698 Ga0157375_10239558
699 Ga0182008_10001922
700 Ga0182008_10005888
701 Ga0182008_10011801
702 Ga0157379_10013935
703 Ga0157379_10014706
704 Ga0157376_10002902
705 Ga0182006_1001283
706 Ga0182006_1022764
707 Ga0182007_10000457
708 Ga0183362_10001
709 Ga0183361_10005
710 Ga0163161_10000157
711 Ga0209435_100001
712 Ga0209672_101187
713 Ga0209258_100048
714 Ga0207425_1000258
715 Ga0207425_1000931
716 Ga0207425_1001584
717 Ga0209646_1000001
718 Ga0209026_1000001
719 Ga0209148_1000040
720 Ga0209759_1000001
721 Ga0209129_1000561
722 Ga0209129_1002624
723 Ga0209129_1009383
724 Ga0209565_1000175
725 Ga0209565_1000326
726 Ga0209565_1000338
727 Ga0209565_1000945
728 Ga0209565_1000965
729 Ga0209565_1009380
730 Ga0209673_1000099
731 Ga0209673_1000839
732 Ga0209673_1001436
733 Ga0209673_1003204
734 Ga0209130_1000041
735 Ga0209130_1000820
736 Ga0209130_1005723
737 Ga0209130_1017827
738 Ga0209675_1000054
739 Ga0209675_1000482
740 Ga0209675_1001405
741 Ga0209675_1001970
742 Ga0209675_1021845
743 Ga0209676_1000004
744 Ga0209676_1000054
745 Ga0209676_1000340
746 Ga0209676_1001062
747 Ga0209676_1006039
748 Ga0209025_1000518
749 Ga0209025_1001546
750 Ga0209025_1001743
751 Ga0209025_1015515
752 Ga0209025_1026580
753 Ga0209025_1037000
754 Ga0209025_1051235
755 Ga0209564_1000662
756 Ga0209564_1000784
757 Ga0209564_1001224
758 Ga0209564_1014272
759 Ga0209758_1000025
760 Ga0209758_1004328
761 Ga0209050_1000002
762 Ga0209050_1000003
763 Ga0209050_1000270
764 Ga0209050_1001154
765 Ga0209050_1005930
766 Ga0209050_1030972
767 Ga0209256_1000001
768 Ga0209256_1001195
769 Ga0209256_1001278
770 Ga0209256_1017055
771 Ga0207426_1000001
772 Ga0207426_1000061
773 Ga0207426_1000178
774 Ga0207426_1001845
775 Ga0209051_1000002
776 Ga0209051_1000003
777 Ga0209051_1000256
778 Ga0209051_1000529
779 Ga0209051_1000661
780 Ga0209051_1003841
781 Ga0209051_1009802
782 Ga0209257_1000002
783 Ga0209257_1000012
784 Ga0209257_1000018
785 Ga0209257_1000361
786 Ga0209257_1005386
787 Ga0209257_1006888
788 Ga0209257_1022414
789 Ga0207656_10082882
790 Ga0207655_1066491
791 Ga0207682_10002471
792 Ga0207688_10051094
793 Ga0207645_10023649
794 Ga0207645_10046723
795 Ga0207705_10056289
796 Ga0207684_10003382
797 Ga0207646_10022994
798 Ga0207681_10016055
799 Ga0207681_10097711
800 Ga0207681_10104984
801 Ga0207650_10005456
802 Ga0207650_10010097
803 Ga0207650_10025178
804 Ga0207650_10062452
805 Ga0207659_10019299
806 Ga0207659_10059019
807 Ga0207687_10034092
808 Ga0207644_10000440
809 Ga0207644_10009714
810 Ga0207644_10015614
811 Ga0207644_10027408
812 Ga0207706_10043517
813 Ga0207706_10050498
814 Ga0207709_10000883
815 Ga0207669_10005245
816 Ga0207691_10001479
817 Ga0207691_10008150
818 Ga0207691_10057878
819 Ga0207691_10087569
820 Ga0207711_10002271
821 Ga0207711_10003157
822 Ga0207711_10007140
823 Ga0207711_10189777
824 Ga0207679_10040667
825 Ga0207667_10058825
826 Ga0207667_10097922
827 Ga0207658_10001754
828 Ga0207658_10067409
829 Ga0207658_10177087
830 Ga0207677_10025562
831 Ga0207677_10106534
832 Ga0207703_10088249
833 Ga0207708_10042042
834 Ga0207702_10046788
835 Ga0207641_10005718
836 Ga0207641_10278557
837 Ga0207641_10316618
838 Ga0207648_10042453
839 Ga0207648_10085688
840 Ga0207676_10006093
841 Ga0207676_10056432
842 Ga0207676_10107651
843 Ga0207676_10150026
844 Ga0207674_10019829
845 Ga0207675_100088763
846 Ga0207683_10001491
847 Ga0207683_10031890
848 Ga0207683_10087815
849 Ga0209970_1000441
850 Ga0209282_1000328
851 Ga0209813_10028566
852 Ga0268266_10362554
853 Ga0268265_10033549
854 Ga0268265_10070195
855 Ga0268264_10241517
856 Ga0307517_10000052
857 Ga0307517_10109013
858 Ga0307517_10182386
859 Ga0307515_10000006
860 Ga0307515_10000152
861 Ga0307515_10000477
862 Ga0307515_10007820
863 Ga0307515_10052216
864 Ga0307512_10088286
865 Ga0307512_10117846
866 Ga0307512_10126248
867 Ga0316182_1194386
868 Ga0265327_10001507
869 Ga0265327_10019625
870 Ga0307513_10000012
871 Ga0307513_10000285
872 Ga0307513_10022829
873 Ga0307513_10036366
874 Ga0307513_10040287
875 Ga0307513_10113173
876 Ga0307509_10000180
877 Ga0307408_100001846
878 Ga0307408_100227867
879 Ga0307508_10001693
880 Ga0307514_10098079
881 Ga0265342_10043496
882 Ga0307516_10002523
883 Ga0307516_10010756
884 Ga0307516_10103161
885 Ga0307405_10000786
886 Ga0307405_10076280
887 Ga0307405_10184709
888 Ga0307413_10027988
889 Ga0307406_10001827
890 Ga0307406_10005768
891 Ga0307407_10072167
892 Ga0307412_10095144
893 Ga0307416_100033682
894 Ga0307414_10196315
895 Ga0307414_10302301
896 Ga0307411_10004273
897 Ga0307411_10171777
898 Ga0307510_10003830
899 Ga0307510_10063365
900 Ga0373937_0440315
901 Ga0395900_0248185
902 Ga0395898_0331683
903 Ga0395905_0008547
904 Ga0395905_0020605
905 Ga0395905_0250207
906 Ga0395901_0057751
907 Ga0395901_0358692
908 Ga0439436_0000292
909 Ga0439436_0002693
910 Ga0439439_0011112
911 Ga0439466_0026792
912 Ga0439465_0000034
913 Ga0439431_0003731
914 Ga0439442_011163
915 Ga0439432_001169
916 Ga0439432_003630
917 Ga0439449_0001078
918 Ga0439449_0004176
919 Ga0439449_0009006
920 Ga0439449_0011087
921 Ga0439457_007283
922 Ga0439457_008339
923 Ga0439462_0003234
924 Ga0439462_0004503
925 Ga0439462_0019716
926 Ga0450911_000073
927 Ga0450923_000859
928 Ga0450923_002456
929 Ga0450910_003481
930 Ga0450908_002155
931 Ga0439434_0002881
932 Ga0439434_0015644
933 Ga0451577_0088531
934 Ga0466969_0046693
935 Ga0466960_0073824
936 Ga0466959_0052584
937 Ga0495627_022495
938 Ga0495592_0000542
939 Ga0495650_0004494
940 Ga0495639_0006826
941 Ga0495616_0006376
942 Ga0495630_0051456
943 Ga0495632_0005062
944 Ga0495637_0003434
945 Ga0495663_0012530
946 Ga0495663_0022777
947 Ga0495642_0020158
948 Ga0495654_0038518
949 Ga0495597_0004543
950 Ga0495622_0004852
951 Ga0495656_0000330
952 Ga0495625_0000896
953 Ga0495625_0016738
954 Ga0495671_0024667
955 Ga0495674_0059089
956 Ga0495676_0046311
957 Ga0495687_000232
958 Ga0495686_0114741
959 Ga0495593_0006405
960 Ga0496100_0006212
961 Ga0496104_0014867
962 Ga0496105_0105631
963 Ga0496106_0166293
964 Ga0496116_0089353
965 Ga0496117_0056757
966 Ga0496118_0007129
967 Ga0496118_0013420
968 Ga0496118_0026683
969 Ga0496119_0100344
970 Ga0496121_0004129
971 Ga0496121_0122955
972 Ga0496124_0007186
973 Ga0496125_0006678
974 Ga0496125_0012318
975 Ga0496125_0099008
976 Ga0496125_0103180
977 Ga0496126_0014761
978 Ga0501031_0000657
979 Ga0501032_0002170
980 Ga0501032_0015947
981 Ga0501033_0001652
982 Ga0501033_0002364
983 Ga0501034_0004990
984 Ga0501034_0082503
985 Ga0501036_0001669
986 Ga0501036_0095824
987 Ga0501037_0000124
988 Ga0501037_0040203
989 Ga0501038_0069970
990 Ga0501043_0000003
991 Ga0501043_0000597
992 Ga0501043_0004134
993 Ga0501046_0000034
994 Ga0501046_0010185
995 Ga0501047_0000042
996 Ga0501047_0001038
997 Ga0501048_0002356
998 Ga0501068_0006559
999 Ga0501069_0000003
1000 Ga0501070_0000477
1001 Ga0501070_0049393
1002 Ga0501070_0107729
1003 Ga0501071_0001232
1004 Ga0501073_0012494
1005 Ga0501074_0000007
1006 Ga0501249_016079
1007 Ga0501225_0005230
1008 Ga0501080_0001339
1009 Ga0501080_0150067
1010 Ga0501083_0000024
1011 Ga0501262_000213
1012 Ga0501035_0001537
1013 Ga0501035_0021541
1014 Ga0501035_0029845
1015 Ga0501044_0000016
1016 Ga0501044_0024356
1017 Ga0501044_0106346
1018 Ga0501045_0001216
1019 nmdc:mga03683_13631_c1
1020 nmdc:mga03683_54364_c1
1021 nmdc:mga0yw44_90516_c1
1022 nmdc:mga0k408_116102_c1
1023 nmdc:mga0k408_1519_c1
1024 nmdc:mga0k408_32063_c1
1025 nmdc:mga0k408_47115_c1
1026 nmdc:mga0k408_83502_c1
1027 nmdc:mga06z11_50865_c1
1028 nmdc:mga06z11_58201_c1
1029 nmdc:mga06z11_9491_c1
1030 nmdc:mga04h51_34003_c1
1031 nmdc:mga07m45_28085_c1
1032 nmdc:mga07m45_474_c1
1033 nmdc:mga07m45_57304_c1
1034 nmdc:mga07m45_6003_c1
1035 nmdc:mga07m45_637_c1
1036 nmdc:mga07m45_7020_c1
1037 nmdc:mga07m45_80268_c1
1038 Ga0500610_0001354
1039 Ga0500610_0003143
1040 Ga0500643_005499
1041 Ga0500644_0004271
1042 Ga0500651_0000087
1043 Ga0500651_0029129
1044 Ga0500651_0029751
1045 Ga0500566_0131534
1046 Ga0500571_000526
1047 Ga0500593_000393
1048 Ga0500593_000853
1049 Ga0500607_003994
1050 Ga0500628_000981
1051 Ga0500642_0055231
1052 Ga0500652_000510
1053 Ga0500655_000134
1054 Ga0500658_0000178
1055 Ga0500658_0000425
1056 Ga0500559_0004675
1057 Ga0500559_0032164
1058 Ga0500568_0000296
1059 Ga0500586_026868
1060 Ga0500616_0015300
1061 Ga0500622_0000106
1062 Ga0500622_0048177
1063 Ga0500627_0001043
1064 Ga0500634_0005923
1065 Ga0500634_0082648
1066 Ga0500638_017325
1067 Ga0500625_059711
1068 Ga0500645_000426
1069 Ga0500645_000739
1070 Ga0500587_001122
1071 Ga0500661_001865
1072 Ga0501082_0177124
1073 2511244341
1074 2513228802
1075 2587758484
1076 2588292199
1077 2599624750
1078 2599672762
1079 2599682788
1080 2599694371
1081 2643971836
1082 2644139325
1083 2644162600
1084 2644274935
1085 2644304436
1086 2644325107
1087 2644400165
1088 2644467674
1089 2738718837
1090 2739248568
1091 2739280855
1092 2808973828
1093 2809008730
1094 2809015764
1095 2819596715
1096 2831265815
1097 2838060731
1098 2842681325
1099 2842734743
1100 2885195616
1101 2885203415
1102 2885217235
1103 2899930500
1104 2904450065
1105 2904457119
1106 2904479927
1107 2919465008
1108 2928039614
1109 2928044781
1110 2928052582
1111 2928064757
1112 2928074781
1113 2928088946
1114 2928120829
1115 2929525347
1116 2945910980
1117 2945948723
1118 2945972848
1119 2945986785
1120 2954772867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06187

DUF993

Protein of unknown function (DUF993)

5

400

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dnh-assembly1.cif.gz_A crystal structure of hypothetical protein smc04132 from sinorhizobium meliloti 1021 0.9424 3 393
4dnh-assembly1.cif.gz_A crystal structure of hypothetical protein smc04132 from sinorhizobium meliloti 1021 0.9377 3 393
1xl9-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase dapa-2 (ba3935) from bacillus anthracis. 0.8658 35 367
3a5f-assembly1.cif.gz_A high-resolution structure of dhdps from clostridium botulinum in complex with pyruvate 0.8619 35 373
5f1u-assembly1.cif.gz_D biomimetic design results in a potent allosteric inhibitor of dihydrodipicolinate synthase from campylobacter jejuni 0.8537 35 368
ID Description Score Start End Superfamily
4dnhA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9375 3 387 3.20.20.70
4dnhA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9302 3 387 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.862 35 373 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8483 35 373 3.20.20.70
1xl9D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8446 35 367 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A527IS59-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9945 131 262
AF-A0A530GJ63-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9896 139 266
AF-A0A536X9S7-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9855 188 300
AF-A0A4Q2KQH3-F1-model_v4 deleted 0.977 155 302
AF-A0A536X9S7-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9769 188 300

Map