F463799
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 561 | 286 | 1122 | 410 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100022515|Ga0068855_1000225156 |
| Length | 470 |
| Sequence | MLKSKGALVLGISLELGTWDLELRPTRLRTKLHDSPHRPRVDFTASSSLPSHKTLQRIVLFPFVASSTQPRIVITGAGIVTALGFGWRANADGFRAGKTAMRPITLFDVSRQRAKSGAQVDVPESVLTKRFLPHQQRRLDRAAKMLLLAADEAWQQSGWAPAENIPLVLGTTSGGMSLGEAYYRQAISTPKKDLGQATRVEGYQSQRQALDLCDAFRFRGPITIIANACASGANSIGHAWDLIRRGHAERVFTGGYDAISQMVFGGFDSLQALSPTVCRPFDAHRDGLALGEGAAMLAIETLDSAKRRNAEILGEIVGYGATTDAHHLTQPHPNGDAALASMTAACSAAKVSPEKINYINAHGTGTPLNDSAEAAAINRWAGAEAKNIPVSSTKSSIGHLLGGAGSVEAVICLMTLREQWLPPMLILQTPEPTCTFPLVRQPTDAKVDYALTNSFGFGGANATLILRRWG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 86 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 140 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 145 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 152 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 153 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 155 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 156 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 158 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 179 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 180 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 181 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 182 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 183 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 247 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 276 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 277 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 278 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 279 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 280 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 281 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 282 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 283 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 284 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 285 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 286 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.04 |
| Metatranscriptomes | 0.36 |
| Isolates | 1.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.43 |
| Nodule | 0 |
| Rhizoplane | 1.6 |
| Rhizosphere | 92.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068855_100022515 | 3300005563 | Bacteria | 7552 |
| 2 | SwRhRL2b_contig_350266 | 2162886007 | Unclassified | 1532 |
| 3 | CNXas_1000004 | 3300000545 | Bacteria | 49001 |
| 4 | JGI25406J46586_10000031 | 3300003203 | Bacteria | 68943 |
| 5 | JGI25406J46586_10012796 | 3300003203 | Bacteria | 3627 |
| 6 | rootH2_10016441 | 3300003320 | Bacteria | 43831 |
| 7 | rootL2_10072798 | 3300003322 | Bacteria | 11928 |
| 8 | Ga0065704_10006997 | 3300005289 | Bacteria | 3599 |
| 9 | Ga0070658_10000017 | 3300005327 | Bacteria | 223560 |
| 10 | Ga0070658_10008811 | 3300005327 | Bacteria | 8109 |
| 11 | Ga0070658_10018128 | 3300005327 | Bacteria | 5632 |
| 12 | Ga0070658_10074486 | 3300005327 | Bacteria | 2784 |
| 13 | Ga0070658_10081548 | 3300005327 | Bacteria | 2657 |
| 14 | Ga0070658_10092902 | 3300005327 | Bacteria | 2488 |
| 15 | Ga0070658_10167446 | 3300005327 | Bacteria | 1845 |
| 16 | Ga0070658_10179832 | 3300005327 | Bacteria | 1780 |
| 17 | Ga0070683_100230111 | 3300005329 | Unclassified | 1762 |
| 18 | Ga0070670_100006170 | 3300005331 | Bacteria | 10130 |
| 19 | Ga0070670_100192817 | 3300005331 | Bacteria | 1770 |
| 20 | Ga0070666_10001132 | 3300005335 | Bacteria | 16230 |
| 21 | Ga0070666_10049895 | 3300005335 | Bacteria | 2814 |
| 22 | Ga0070680_100071992 | 3300005336 | Bacteria | 2841 |
| 23 | Ga0068868_100295861 | 3300005338 | Unclassified | 1374 |
| 24 | Ga0070660_100001386 | 3300005339 | Bacteria | 16479 |
| 25 | Ga0070660_100006810 | 3300005339 | Bacteria | 7930 |
| 26 | Ga0070660_100082734 | 3300005339 | Unclassified | 2521 |
| 27 | Ga0070689_100016039 | 3300005340 | Bacteria | 5478 |
| 28 | Ga0070689_100032077 | 3300005340 | Bacteria | 3994 |
| 29 | Ga0070689_100067372 | 3300005340 | Bacteria | 2791 |
| 30 | Ga0070689_100266046 | 3300005340 | Bacteria | 1418 |
| 31 | Ga0070661_100006180 | 3300005344 | Bacteria | 8257 |
| 32 | Ga0070661_100056717 | 3300005344 | Bacteria | 2870 |
| 33 | Ga0070668_100052036 | 3300005347 | Bacteria | 3157 |
| 34 | Ga0070669_100039231 | 3300005353 | Unclassified | 3441 |
| 35 | Ga0070675_100014872 | 3300005354 | Bacteria | 6143 |
| 36 | Ga0070671_100015235 | 3300005355 | Bacteria | 6208 |
| 37 | Ga0070671_100034864 | 3300005355 | Bacteria | 4167 |
| 38 | Ga0070671_100074652 | 3300005355 | Bacteria | 2833 |
| 39 | Ga0070671_100131945 | 3300005355 | Bacteria | 2104 |
| 40 | Ga0070671_100204836 | 3300005355 | Bacteria | 1673 |
| 41 | Ga0070674_100012748 | 3300005356 | Bacteria | 5171 |
| 42 | Ga0070673_100006547 | 3300005364 | Bacteria | 7577 |
| 43 | Ga0070673_100260365 | 3300005364 | Unclassified | 1515 |
| 44 | Ga0070688_100006047 | 3300005365 | Bacteria | 6424 |
| 45 | Ga0070659_100000075 | 3300005366 | Bacteria | 77794 |
| 46 | Ga0070659_100005119 | 3300005366 | Bacteria | 9405 |
| 47 | Ga0070659_100013462 | 3300005366 | Bacteria | 6089 |
| 48 | Ga0070667_100033080 | 3300005367 | Unclassified | 4317 |
| 49 | Ga0070667_100054755 | 3300005367 | Bacteria | 3369 |
| 50 | Ga0070709_10033587 | 3300005434 | Bacteria | 3104 |
| 51 | Ga0070714_100057739 | 3300005435 | Bacteria | 3322 |
| 52 | Ga0070713_100004876 | 3300005436 | Bacteria | 9101 |
| 53 | Ga0070713_100077855 | 3300005436 | Bacteria | 2821 |
| 54 | Ga0070694_100025901 | 3300005444 | Bacteria | 3798 |
| 55 | Ga0070708_100013729 | 3300005445 | Bacteria | 6644 |
| 56 | Ga0070708_100026740 | 3300005445 | Bacteria | 4943 |
| 57 | Ga0070708_100045230 | 3300005445 | Bacteria | 3877 |
| 58 | Ga0070708_100056443 | 3300005445 | Bacteria | 3493 |
| 59 | Ga0070708_100161551 | 3300005445 | Bacteria | 2088 |
| 60 | Ga0070663_100134629 | 3300005455 | Bacteria | 1880 |
| 61 | Ga0070678_100008889 | 3300005456 | Bacteria | 6047 |
| 62 | Ga0070681_10017621 | 3300005458 | Bacteria | 7137 |
| 63 | Ga0070681_10123963 | 3300005458 | Bacteria | 2516 |
| 64 | Ga0068867_100009876 | 3300005459 | Bacteria | 6726 |
| 65 | Ga0070685_10056356 | 3300005466 | Unclassified | 2284 |
| 66 | Ga0070706_100000709 | 3300005467 | Bacteria | 37439 |
| 67 | Ga0070706_100006581 | 3300005467 | Bacteria | 10960 |
| 68 | Ga0070706_100016018 | 3300005467 | Bacteria | 6924 |
| 69 | Ga0070706_100088362 | 3300005467 | Bacteria | 2874 |
| 70 | Ga0070706_100197054 | 3300005467 | Bacteria | 1881 |
| 71 | Ga0070706_100233145 | 3300005467 | Bacteria | 1718 |
| 72 | Ga0070706_100289254 | 3300005467 | Bacteria | 1529 |
| 73 | Ga0070707_100004838 | 3300005468 | Bacteria | 12619 |
| 74 | Ga0070707_100042500 | 3300005468 | Bacteria | 4351 |
| 75 | Ga0070707_100072631 | 3300005468 | Bacteria | 3316 |
| 76 | Ga0070707_100074680 | 3300005468 | Bacteria | 3269 |
| 77 | Ga0070707_100127700 | 3300005468 | Bacteria | 2471 |
| 78 | Ga0070707_100129698 | 3300005468 | Bacteria | 2451 |
| 79 | Ga0070707_100159234 | 3300005468 | Bacteria | 2199 |
| 80 | Ga0070698_100004491 | 3300005471 | Bacteria | 15343 |
| 81 | Ga0070698_100027154 | 3300005471 | Bacteria | 5954 |
| 82 | Ga0070698_100137031 | 3300005471 | Bacteria | 2401 |
| 83 | Ga0070698_100143371 | 3300005471 | Bacteria | 2339 |
| 84 | Ga0070698_100172646 | 3300005471 | Bacteria | 2102 |
| 85 | Ga0070699_100016883 | 3300005518 | Bacteria | 6267 |
| 86 | Ga0070699_100037430 | 3300005518 | Bacteria | 4198 |
| 87 | Ga0070699_100066104 | 3300005518 | Bacteria | 3138 |
| 88 | Ga0070699_100240004 | 3300005518 | Unclassified | 1617 |
| 89 | Ga0070679_100031501 | 3300005530 | Bacteria | 5239 |
| 90 | Ga0070679_100045301 | 3300005530 | Bacteria | 4383 |
| 91 | Ga0070697_100003578 | 3300005536 | Bacteria | 11939 |
| 92 | Ga0070697_100010936 | 3300005536 | Bacteria | 7089 |
| 93 | Ga0070697_100027928 | 3300005536 | Unclassified | 4516 |
| 94 | Ga0070697_100029192 | 3300005536 | Bacteria | 4420 |
| 95 | Ga0070697_100033960 | 3300005536 | Bacteria | 4111 |
| 96 | Ga0070697_100104321 | 3300005536 | Bacteria | 2357 |
| 97 | Ga0070697_100175957 | 3300005536 | Bacteria | 1813 |
| 98 | Ga0068853_100000022 | 3300005539 | Bacteria | 142647 |
| 99 | Ga0068853_100000115 | 3300005539 | Bacteria | 54407 |
| 100 | Ga0068853_100003373 | 3300005539 | Bacteria | 12226 |
| 101 | Ga0070672_100014922 | 3300005543 | Bacteria | 5517 |
| 102 | Ga0070686_100004330 | 3300005544 | Bacteria | 7818 |
| 103 | Ga0070686_100092476 | 3300005544 | Bacteria | 2026 |
| 104 | Ga0070665_100075120 | 3300005548 | Bacteria | 3386 |
| 105 | Ga0070665_100245648 | 3300005548 | Bacteria | 1790 |
| 106 | Ga0070704_100007209 | 3300005549 | Bacteria | 6611 |
| 107 | Ga0068855_100003787 | 3300005563 | Bacteria | 18502 |
| 108 | Ga0068855_100013989 | 3300005563 | Bacteria | 9674 |
| 109 | Ga0068855_100024962 | 3300005563 | Bacteria | 7153 |
| 110 | Ga0068855_100067506 | 3300005563 | Bacteria | 4165 |
| 111 | Ga0068855_100109714 | 3300005563 | Bacteria | 3168 |
| 112 | Ga0068855_100183396 | 3300005563 | Bacteria | 2365 |
| 113 | Ga0068855_100211673 | 3300005563 | Bacteria | 2178 |
| 114 | Ga0068855_100214768 | 3300005563 | Bacteria | 2160 |
| 115 | Ga0068857_100119777 | 3300005577 | Bacteria | 2369 |
| 116 | Ga0068854_100000038 | 3300005578 | Bacteria | 95978 |
| 117 | Ga0068854_100005679 | 3300005578 | Bacteria | 7887 |
| 118 | Ga0068854_100073621 | 3300005578 | Bacteria | 2504 |
| 119 | Ga0068856_100015167 | 3300005614 | Bacteria | 7443 |
| 120 | Ga0068856_100046837 | 3300005614 | Bacteria | 4259 |
| 121 | Ga0068852_100004487 | 3300005616 | Bacteria | 9864 |
| 122 | Ga0068852_100044824 | 3300005616 | Bacteria | 3760 |
| 123 | Ga0068852_100051091 | 3300005616 | Bacteria | 3546 |
| 124 | Ga0068852_100136327 | 3300005616 | Bacteria | 2267 |
| 125 | Ga0068864_100036727 | 3300005618 | Bacteria | 4178 |
| 126 | Ga0068864_100086317 | 3300005618 | Bacteria | 2761 |
| 127 | Ga0068864_100120740 | 3300005618 | Bacteria | 2343 |
| 128 | Ga0068863_100035891 | 3300005841 | Bacteria | 4721 |
| 129 | Ga0068858_100274972 | 3300005842 | Bacteria | 1603 |
| 130 | Ga0068860_100000159 | 3300005843 | Bacteria | 110374 |
| 131 | Ga0081455_10000725 | 3300005937 | Bacteria | 42784 |
| 132 | Ga0081455_10001494 | 3300005937 | Bacteria | 28914 |
| 133 | Ga0081455_10010167 | 3300005937 | Bacteria | 9581 |
| 134 | Ga0081540_1000380 | 3300005983 | Bacteria | 44546 |
| 135 | Ga0081540_1061925 | 3300005983 | Bacteria | 1781 |
| 136 | Ga0081539_10000564 | 3300005985 | Bacteria | 76514 |
| 137 | Ga0081539_10001104 | 3300005985 | Bacteria | 49011 |
| 138 | Ga0070717_10000353 | 3300006028 | Bacteria | 29605 |
| 139 | Ga0070717_10047081 | 3300006028 | Bacteria | 3531 |
| 140 | Ga0070717_10187206 | 3300006028 | Bacteria | 1807 |
| 141 | Ga0070712_100085516 | 3300006175 | Bacteria | 2296 |
| 142 | Ga0070712_100248422 | 3300006175 | Bacteria | 1420 |
| 143 | Ga0075362_10000411 | 3300006177 | Bacteria | 12334 |
| 144 | Ga0075366_10019664 | 3300006195 | Unclassified | 3912 |
| 145 | Ga0097621_100003193 | 3300006237 | Bacteria | 11267 |
| 146 | Ga0097621_100035123 | 3300006237 | Unclassified | 4004 |
| 147 | Ga0068871_100025141 | 3300006358 | Unclassified | 4629 |
| 148 | Ga0068871_100263907 | 3300006358 | Bacteria | 1503 |
| 149 | Ga0075428_100026634 | 3300006844 | Bacteria | 6402 |
| 150 | Ga0075428_100036038 | 3300006844 | Bacteria | 5452 |
| 151 | Ga0068865_100031192 | 3300006881 | Bacteria | 3552 |
| 152 | Ga0075435_100000263 | 3300007076 | Bacteria | 32673 |
| 153 | Ga0075435_100018595 | 3300007076 | Bacteria | 5290 |
| 154 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 155 | Ga0105240_10008663 | 3300009093 | Bacteria | 14523 |
| 156 | Ga0105240_10009398 | 3300009093 | Bacteria | 13844 |
| 157 | Ga0105240_10090430 | 3300009093 | Bacteria | 3741 |
| 158 | Ga0105240_10105281 | 3300009093 | Bacteria | 3425 |
| 159 | Ga0105240_10124160 | 3300009093 | Bacteria | 3105 |
| 160 | Ga0105240_10136095 | 3300009093 | Bacteria | 2942 |
| 161 | Ga0105240_10217214 | 3300009093 | Bacteria | 2230 |
| 162 | Ga0105240_10254885 | 3300009093 | Bacteria | 2027 |
| 163 | Ga0111539_10047245 | 3300009094 | Bacteria | 5146 |
| 164 | Ga0114129_10033795 | 3300009147 | Bacteria | 7224 |
| 165 | Ga0105241_10020006 | 3300009174 | Bacteria | 4943 |
| 166 | Ga0105242_10153726 | 3300009176 | Bacteria | 2008 |
| 167 | Ga0105248_10057882 | 3300009177 | Bacteria | 4351 |
| 168 | Ga0105237_10013617 | 3300009545 | Bacteria | 8522 |
| 169 | Ga0105237_10018010 | 3300009545 | Bacteria | 7317 |
| 170 | Ga0105237_10030692 | 3300009545 | Bacteria | 5457 |
| 171 | Ga0105238_10006718 | 3300009551 | Bacteria | 11481 |
| 172 | Ga0105238_10017937 | 3300009551 | Bacteria | 7197 |
| 173 | Ga0105238_10035065 | 3300009551 | Bacteria | 5103 |
| 174 | Ga0105238_10066785 | 3300009551 | Bacteria | 3597 |
| 175 | Ga0105239_10226302 | 3300010375 | Unclassified | 2098 |
| 176 | Ga0157370_10018964 | 3300013104 | Bacteria | 6917 |
| 177 | Ga0157370_10022540 | 3300013104 | Bacteria | 6266 |
| 178 | Ga0157370_10045365 | 3300013104 | Bacteria | 4217 |
| 179 | Ga0157370_10101914 | 3300013104 | Bacteria | 2689 |
| 180 | Ga0157370_10190435 | 3300013104 | Bacteria | 1904 |
| 181 | Ga0157369_10005530 | 3300013105 | Bacteria | 14670 |
| 182 | Ga0157369_10007454 | 3300013105 | Bacteria | 12601 |
| 183 | Ga0157369_10016107 | 3300013105 | Bacteria | 8412 |
| 184 | Ga0157369_10018413 | 3300013105 | Bacteria | 7831 |
| 185 | Ga0157369_10019879 | 3300013105 | Bacteria | 7513 |
| 186 | Ga0157369_10046325 | 3300013105 | Bacteria | 4726 |
| 187 | Ga0157369_10057375 | 3300013105 | Bacteria | 4201 |
| 188 | Ga0157369_10071014 | 3300013105 | Bacteria | 3739 |
| 189 | Ga0157369_10454159 | 3300013105 | Bacteria | 1327 |
| 190 | Ga0157374_10000028 | 3300013296 | Bacteria | 213725 |
| 191 | Ga0157374_10003877 | 3300013296 | Bacteria | 12559 |
| 192 | Ga0157374_10018766 | 3300013296 | Bacteria | 6111 |
| 193 | Ga0157374_10035443 | 3300013296 | Bacteria | 4565 |
| 194 | Ga0157374_10046221 | 3300013296 | Bacteria | 4030 |
| 195 | Ga0157374_10082808 | 3300013296 | Bacteria | 3047 |
| 196 | Ga0157378_10045848 | 3300013297 | Unclassified | 3886 |
| 197 | Ga0157378_10210810 | 3300013297 | Unclassified | 1842 |
| 198 | Ga0163162_10027367 | 3300013306 | Bacteria | 5638 |
| 199 | Ga0163162_10318227 | 3300013306 | Unclassified | 1688 |
| 200 | Ga0157372_10006072 | 3300013307 | Bacteria | 12830 |
| 201 | Ga0157372_10007912 | 3300013307 | Bacteria | 11301 |
| 202 | Ga0157372_10010637 | 3300013307 | Bacteria | 9791 |
| 203 | Ga0157372_10023716 | 3300013307 | Bacteria | 6655 |
| 204 | Ga0157372_10029299 | 3300013307 | Bacteria | 6010 |
| 205 | Ga0157372_10048421 | 3300013307 | Bacteria | 4725 |
| 206 | Ga0157372_10079053 | 3300013307 | Bacteria | 3718 |
| 207 | Ga0157375_10037791 | 3300013308 | Unclassified | 4629 |
| 208 | Ga0157375_10050251 | 3300013308 | Bacteria | 4089 |
| 209 | Ga0163163_10008481 | 3300014325 | Bacteria | 9133 |
| 210 | Ga0163163_10013037 | 3300014325 | Bacteria | 7589 |
| 211 | Ga0157376_10028530 | 3300014969 | Bacteria | 4437 |
| 212 | Ga0213872_10000478 | 3300021361 | Bacteria | 32337 |
| 213 | Ga0213872_10003129 | 3300021361 | Bacteria | 9302 |
| 214 | Ga0213872_10017606 | 3300021361 | Bacteria | 3300 |
| 215 | Ga0213874_10033656 | 3300021377 | Bacteria | 1495 |
| 216 | Ga0213876_10001500 | 3300021384 | Bacteria | 14476 |
| 217 | Ga0213876_10008676 | 3300021384 | Bacteria | 5498 |
| 218 | Ga0213871_10012013 | 3300021441 | Unclassified | 2000 |
| 219 | Ga0209233_1001450 | 3300025261 | Bacteria | 9359 |
| 220 | Ga0209233_1005386 | 3300025261 | Bacteria | 4247 |
| 221 | Ga0207697_10000511 | 3300025315 | Bacteria | 21912 |
| 222 | Ga0207688_10004499 | 3300025901 | Bacteria | 7592 |
| 223 | Ga0207680_10030795 | 3300025903 | Bacteria | 3031 |
| 224 | Ga0207680_10093824 | 3300025903 | Unclassified | 1915 |
| 225 | Ga0207647_10020074 | 3300025904 | Bacteria | 4485 |
| 226 | Ga0207699_10043297 | 3300025906 | Bacteria | 2614 |
| 227 | Ga0207705_10000020 | 3300025909 | Bacteria | 311745 |
| 228 | Ga0207705_10000562 | 3300025909 | Bacteria | 31130 |
| 229 | Ga0207705_10004135 | 3300025909 | Bacteria | 11004 |
| 230 | Ga0207705_10009526 | 3300025909 | Bacteria | 7068 |
| 231 | Ga0207705_10031218 | 3300025909 | Bacteria | 3801 |
| 232 | Ga0207705_10037451 | 3300025909 | Bacteria | 3471 |
| 233 | Ga0207705_10051999 | 3300025909 | Bacteria | 2949 |
| 234 | Ga0207705_10077121 | 3300025909 | Bacteria | 2424 |
| 235 | Ga0207705_10187126 | 3300025909 | Bacteria | 1564 |
| 236 | Ga0207684_10000650 | 3300025910 | Bacteria | 41194 |
| 237 | Ga0207684_10002149 | 3300025910 | Bacteria | 20198 |
| 238 | Ga0207684_10045510 | 3300025910 | Unclassified | 3721 |
| 239 | Ga0207684_10189629 | 3300025910 | Bacteria | 1773 |
| 240 | Ga0207684_10202763 | 3300025910 | Bacteria | 1711 |
| 241 | Ga0207684_10227514 | 3300025910 | Unclassified | 1609 |
| 242 | Ga0207654_10000505 | 3300025911 | Bacteria | 22302 |
| 243 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 244 | Ga0207695_10000249 | 3300025913 | Bacteria | 140258 |
| 245 | Ga0207695_10003985 | 3300025913 | Bacteria | 20373 |
| 246 | Ga0207695_10079308 | 3300025913 | Bacteria | 3328 |
| 247 | Ga0207695_10313834 | 3300025913 | Bacteria | 1458 |
| 248 | Ga0207671_10006453 | 3300025914 | Bacteria | 10441 |
| 249 | Ga0207693_10065034 | 3300025915 | Unclassified | 2856 |
| 250 | Ga0207693_10166306 | 3300025915 | Bacteria | 1736 |
| 251 | Ga0207693_10272010 | 3300025915 | Bacteria | 1327 |
| 252 | Ga0207657_10003277 | 3300025919 | Bacteria | 17324 |
| 253 | Ga0207657_10003920 | 3300025919 | Bacteria | 15792 |
| 254 | Ga0207657_10012904 | 3300025919 | Bacteria | 8216 |
| 255 | Ga0207657_10085379 | 3300025919 | Unclassified | 2644 |
| 256 | Ga0207649_10029706 | 3300025920 | Bacteria | 3230 |
| 257 | Ga0207649_10040648 | 3300025920 | Bacteria | 2828 |
| 258 | Ga0207652_10001024 | 3300025921 | Bacteria | 25651 |
| 259 | Ga0207652_10043440 | 3300025921 | Bacteria | 3826 |
| 260 | Ga0207652_10340191 | 3300025921 | Bacteria | 1354 |
| 261 | Ga0207646_10001257 | 3300025922 | Bacteria | 31753 |
| 262 | Ga0207646_10002214 | 3300025922 | Bacteria | 23143 |
| 263 | Ga0207646_10027150 | 3300025922 | Bacteria | 5221 |
| 264 | Ga0207646_10049173 | 3300025922 | Bacteria | 3777 |
| 265 | Ga0207646_10150230 | 3300025922 | Bacteria | 2100 |
| 266 | Ga0207646_10194083 | 3300025922 | Bacteria | 1834 |
| 267 | Ga0207681_10023977 | 3300025923 | Unclassified | 3909 |
| 268 | Ga0207694_10003813 | 3300025924 | Bacteria | 11925 |
| 269 | Ga0207694_10098012 | 3300025924 | Bacteria | 2320 |
| 270 | Ga0207650_10025409 | 3300025925 | Bacteria | 4219 |
| 271 | Ga0207650_10029443 | 3300025925 | Unclassified | 3948 |
| 272 | Ga0207650_10048128 | 3300025925 | Unclassified | 3144 |
| 273 | Ga0207650_10160176 | 3300025925 | Bacteria | 1783 |
| 274 | Ga0207659_10013676 | 3300025926 | Bacteria | 5208 |
| 275 | Ga0207700_10060809 | 3300025928 | Bacteria | 2862 |
| 276 | Ga0207664_10048705 | 3300025929 | Unclassified | 3334 |
| 277 | Ga0207644_10067976 | 3300025931 | Unclassified | 2598 |
| 278 | Ga0207690_10024263 | 3300025932 | Bacteria | 3797 |
| 279 | Ga0207690_10157724 | 3300025932 | Bacteria | 1689 |
| 280 | Ga0207686_10106416 | 3300025934 | Bacteria | 1883 |
| 281 | Ga0207670_10051342 | 3300025936 | Bacteria | 2768 |
| 282 | Ga0207669_10054056 | 3300025937 | Unclassified | 2423 |
| 283 | Ga0207704_10049158 | 3300025938 | Unclassified | 2535 |
| 284 | Ga0207665_10077341 | 3300025939 | Bacteria | 2284 |
| 285 | Ga0207665_10195349 | 3300025939 | Bacteria | 1472 |
| 286 | Ga0207691_10002134 | 3300025940 | Bacteria | 19356 |
| 287 | Ga0207661_10198381 | 3300025944 | Unclassified | 1763 |
| 288 | Ga0207679_10026287 | 3300025945 | Bacteria | 4012 |
| 289 | Ga0207667_10012883 | 3300025949 | Bacteria | 9608 |
| 290 | Ga0207667_10015163 | 3300025949 | Bacteria | 8763 |
| 291 | Ga0207667_10015957 | 3300025949 | Bacteria | 8506 |
| 292 | Ga0207667_10017144 | 3300025949 | Bacteria | 8164 |
| 293 | Ga0207667_10087316 | 3300025949 | Bacteria | 3226 |
| 294 | Ga0207667_10175488 | 3300025949 | Bacteria | 2202 |
| 295 | Ga0207667_10178565 | 3300025949 | Bacteria | 2181 |
| 296 | Ga0207668_10015093 | 3300025972 | Bacteria | 4794 |
| 297 | Ga0207640_10000051 | 3300025981 | Bacteria | 95956 |
| 298 | Ga0207658_10088597 | 3300025986 | Bacteria | 2393 |
| 299 | Ga0207703_10242855 | 3300026035 | Bacteria | 1620 |
| 300 | Ga0207639_10000002 | 3300026041 | Bacteria | 903066 |
| 301 | Ga0207639_10000069 | 3300026041 | Bacteria | 96786 |
| 302 | Ga0207639_10003062 | 3300026041 | Bacteria | 11258 |
| 303 | Ga0207678_10003373 | 3300026067 | Bacteria | 14408 |
| 304 | Ga0207678_10016333 | 3300026067 | Bacteria | 6517 |
| 305 | Ga0207678_10072128 | 3300026067 | Bacteria | 2959 |
| 306 | Ga0207678_10123885 | 3300026067 | Bacteria | 2206 |
| 307 | Ga0207702_10010689 | 3300026078 | Bacteria | 7669 |
| 308 | Ga0207641_10113688 | 3300026088 | Bacteria | 2404 |
| 309 | Ga0207648_10006358 | 3300026089 | Bacteria | 11746 |
| 310 | Ga0207676_10077133 | 3300026095 | Bacteria | 2695 |
| 311 | Ga0207674_10006812 | 3300026116 | Bacteria | 13405 |
| 312 | Ga0207683_10004826 | 3300026121 | Bacteria | 11610 |
| 313 | Ga0268266_10002216 | 3300028379 | Bacteria | 21236 |
| 314 | Ga0268266_10202007 | 3300028379 | Bacteria | 1819 |
| 315 | Ga0268266_10220243 | 3300028379 | Bacteria | 1744 |
| 316 | Ga0268264_10000363 | 3300028381 | Bacteria | 67275 |
| 317 | Ga0265337_1011546 | 3300028556 | Bacteria | 3038 |
| 318 | Ga0265319_1006133 | 3300028563 | Bacteria | 5618 |
| 319 | Ga0265334_10007737 | 3300028573 | Bacteria | 4604 |
| 320 | Ga0265323_10000049 | 3300028653 | Bacteria | 64975 |
| 321 | Ga0265323_10027656 | 3300028653 | Bacteria | 2129 |
| 322 | Ga0265336_10000667 | 3300028666 | Bacteria | 18624 |
| 323 | Ga0265338_10000420 | 3300028800 | Bacteria | 75959 |
| 324 | Ga0265338_10003150 | 3300028800 | Bacteria | 23538 |
| 325 | Ga0265338_10024388 | 3300028800 | Bacteria | 6179 |
| 326 | Ga0265338_10039737 | 3300028800 | Bacteria | 4432 |
| 327 | Ga0265338_10052396 | 3300028800 | Bacteria | 3661 |
| 328 | Ga0265328_10015755 | 3300031239 | Bacteria | 2956 |
| 329 | Ga0265320_10007008 | 3300031240 | Bacteria | 7024 |
| 330 | Ga0265325_10033064 | 3300031241 | Bacteria | 2758 |
| 331 | Ga0265329_10000594 | 3300031242 | Bacteria | 18723 |
| 332 | Ga0265340_10015100 | 3300031247 | Bacteria | 4019 |
| 333 | Ga0265331_10054503 | 3300031250 | Bacteria | 1904 |
| 334 | Ga0265327_10001754 | 3300031251 | Bacteria | 25646 |
| 335 | Ga0265316_10065150 | 3300031344 | Bacteria | 2822 |
| 336 | Ga0265316_10078336 | 3300031344 | Bacteria | 2537 |
| 337 | Ga0265316_10111926 | 3300031344 | Unclassified | 2067 |
| 338 | Ga0307513_10080560 | 3300031456 | Bacteria | 3358 |
| 339 | Ga0316575_10007083 | 3300031665 | Bacteria | 4057 |
| 340 | Ga0316579_10000223 | 3300031691 | Bacteria | 17183 |
| 341 | Ga0265314_10022627 | 3300031711 | Bacteria | 4813 |
| 342 | Ga0316576_10101021 | 3300031727 | Bacteria | 2156 |
| 343 | Ga0316578_10062240 | 3300031728 | Bacteria | 2200 |
| 344 | Ga0316593_10000461 | 3300032168 | Bacteria | 7469 |
| 345 | Ga0307510_10018128 | 3300033180 | Bacteria | 8289 |
| 346 | Ga0307510_10024597 | 3300033180 | Bacteria | 6956 |
| 347 | Ga0316596_1000420 | 3300033541 | Bacteria | 7070 |
| 348 | Ga0373928_0000279 | 3300035084 | Bacteria | 10095 |
| 349 | Ga0373944_0000216 | 3300035089 | Bacteria | 12394 |
| 350 | Ga0373949_0000474 | 3300035090 | Bacteria | 13735 |
| 351 | Ga0373932_0000005 | 3300035112 | Bacteria | 259528 |
| 352 | Ga0373955_0079416 | 3300035172 | Bacteria | 1851 |
| 353 | Ga0373955_0103048 | 3300035172 | Bacteria | 1641 |
| 354 | Ga0373962_0000483 | 3300035242 | Bacteria | 8820 |
| 355 | Ga0373931_0000016 | 3300035691 | Bacteria | 217932 |
| 356 | Ga0373935_0010110 | 3300035692 | Bacteria | 5653 |
| 357 | Ga0373935_0041838 | 3300035692 | Bacteria | 2880 |
| 358 | Ga0373927_0019734 | 3300035695 | Bacteria | 4420 |
| 359 | Ga0373933_0084114 | 3300035724 | Bacteria | 1955 |
| 360 | Ga0373947_0058156 | 3300035725 | Bacteria | 2342 |
| 361 | Ga0373947_0085481 | 3300035725 | Bacteria | 1959 |
| 362 | Ga0373937_0177617 | 3300036401 | Unclassified | 1999 |
| 363 | Ga0373937_0255119 | 3300036401 | Bacteria | 1653 |
| 364 | Ga0373925_0000514 | 3300037068 | Bacteria | 38847 |
| 365 | Ga0395900_0001406 | 3300037418 | Bacteria | 28805 |
| 366 | Ga0395900_0339133 | 3300037418 | Bacteria | 1479 |
| 367 | Ga0395898_0017405 | 3300037466 | Bacteria | 7343 |
| 368 | Ga0395905_0035278 | 3300037471 | Unclassified | 4697 |
| 369 | Ga0436364_1160864 | 3300037853 | Bacteria | 2522 |
| 370 | Ga0395901_0213998 | 3300038443 | Bacteria | 2016 |
| 371 | Ga0436365_0377191 | 3300039437 | Bacteria | 6873 |
| 372 | Ga0436365_0838450 | 3300039437 | Bacteria | 4713 |
| 373 | Ga0436365_0909065 | 3300039437 | Unclassified | 2522 |
| 374 | Ga0436365_1147197 | 3300039437 | Bacteria | 51071 |
| 375 | Ga0436365_1383407 | 3300039437 | Bacteria | 77328 |
| 376 | Ga0436360_0799469 | 3300039438 | Unclassified | 2179 |
| 377 | Ga0436360_0921181 | 3300039438 | Bacteria | 1758 |
| 378 | Ga0436360_1109878 | 3300039438 | Bacteria | 5191 |
| 379 | Ga0436361_0111757 | 3300039447 | Bacteria | 3253 |
| 380 | Ga0436361_0264843 | 3300039447 | Bacteria | 4323 |
| 381 | Ga0436361_0298522 | 3300039447 | Bacteria | 5001 |
| 382 | Ga0436361_0528354 | 3300039447 | Bacteria | 23049 |
| 383 | Ga0436361_1030048 | 3300039447 | Bacteria | 3844 |
| 384 | Ga0436363_0937124 | 3300039450 | Bacteria | 19951 |
| 385 | Ga0436362_0064032 | 3300039453 | Unclassified | 2069 |
| 386 | Ga0451855_1043235 | 3300041511 | Bacteria | 5429 |
| 387 | Ga0451577_0000033 | 3300042876 | Bacteria | 378714 |
| 388 | Ga0451577_0000047 | 3300042876 | Bacteria | 312768 |
| 389 | Ga0466969_0011903 | 3300044656 | Bacteria | 4599 |
| 390 | Ga0466966_0042268 | 3300044684 | Bacteria | 2927 |
| 391 | Ga0453684_0000109 | 3300044712 | Bacteria | 361015 |
| 392 | Ga0453684_0000611 | 3300044712 | Bacteria | 131332 |
| 393 | Ga0453684_0003475 | 3300044712 | Bacteria | 35376 |
| 394 | Ga0453684_0026393 | 3300044712 | Bacteria | 8394 |
| 395 | Ga0451576_0044480 | 3300045051 | Bacteria | 4681 |
| 396 | Ga0451576_0095872 | 3300045051 | Bacteria | 3086 |
| 397 | Ga0466967_0026996 | 3300045976 | Bacteria | 4768 |
| 398 | Ga0466967_0183007 | 3300045976 | Bacteria | 1977 |
| 399 | Ga0495592_0043835 | 3300046454 | Bacteria | 3345 |
| 400 | Ga0495603_0001453 | 3300046455 | Bacteria | 13780 |
| 401 | Ga0495629_0002888 | 3300046459 | Bacteria | 13124 |
| 402 | Ga0495629_0027641 | 3300046459 | Bacteria | 4028 |
| 403 | Ga0495629_0053162 | 3300046459 | Bacteria | 2834 |
| 404 | Ga0495638_0090375 | 3300046460 | Bacteria | 1846 |
| 405 | Ga0495653_0022608 | 3300046463 | Bacteria | 5085 |
| 406 | Ga0495650_0000006 | 3300046471 | Bacteria | 721347 |
| 407 | Ga0495650_0001575 | 3300046471 | Bacteria | 21452 |
| 408 | Ga0495580_0070355 | 3300046472 | Bacteria | 2444 |
| 409 | Ga0495580_0193243 | 3300046472 | Bacteria | 1403 |
| 410 | Ga0495582_0005157 | 3300046473 | Bacteria | 7312 |
| 411 | Ga0495639_0019355 | 3300046475 | Bacteria | 2971 |
| 412 | Ga0495662_0034989 | 3300046476 | Bacteria | 2424 |
| 413 | Ga0495664_0010765 | 3300046477 | Bacteria | 5141 |
| 414 | Ga0495664_0024030 | 3300046477 | Bacteria | 3540 |
| 415 | Ga0495585_0028516 | 3300046492 | Bacteria | 3184 |
| 416 | Ga0495594_0000142 | 3300046499 | Bacteria | 34212 |
| 417 | Ga0495594_0000247 | 3300046499 | Bacteria | 26230 |
| 418 | Ga0495583_0031763 | 3300046506 | Bacteria | 2556 |
| 419 | Ga0495583_0041523 | 3300046506 | Bacteria | 2154 |
| 420 | Ga0495606_0039875 | 3300046507 | Bacteria | 3159 |
| 421 | Ga0495606_0076625 | 3300046507 | Bacteria | 2090 |
| 422 | Ga0495606_0112393 | 3300046507 | Bacteria | 1641 |
| 423 | Ga0495618_0013075 | 3300046514 | Bacteria | 5045 |
| 424 | Ga0495618_0017873 | 3300046514 | Bacteria | 4352 |
| 425 | Ga0495628_0000354 | 3300046516 | Bacteria | 41766 |
| 426 | Ga0495628_0088214 | 3300046516 | Bacteria | 2404 |
| 427 | Ga0495630_0004948 | 3300046517 | Bacteria | 9370 |
| 428 | Ga0495631_0038516 | 3300046518 | Bacteria | 2125 |
| 429 | Ga0495631_0039407 | 3300046518 | Bacteria | 2097 |
| 430 | Ga0495632_0079849 | 3300046519 | Bacteria | 1561 |
| 431 | Ga0495643_0000111 | 3300046522 | Bacteria | 135372 |
| 432 | Ga0495644_0000009 | 3300046523 | Bacteria | 107125 |
| 433 | Ga0495648_0033861 | 3300046524 | Bacteria | 3332 |
| 434 | Ga0495648_0072756 | 3300046524 | Bacteria | 1988 |
| 435 | Ga0495648_0124316 | 3300046524 | Bacteria | 1381 |
| 436 | Ga0495666_0015596 | 3300046526 | Bacteria | 3782 |
| 437 | Ga0495642_0030428 | 3300046528 | Bacteria | 2159 |
| 438 | Ga0495652_0006133 | 3300046529 | Bacteria | 11235 |
| 439 | Ga0495652_0039128 | 3300046529 | Bacteria | 4102 |
| 440 | Ga0495640_0019813 | 3300046533 | Bacteria | 4961 |
| 441 | Ga0495586_0009379 | 3300046535 | Bacteria | 5207 |
| 442 | Ga0495586_0012324 | 3300046535 | Bacteria | 4536 |
| 443 | Ga0495587_0047810 | 3300046536 | Bacteria | 2536 |
| 444 | Ga0495587_0088535 | 3300046536 | Bacteria | 1790 |
| 445 | Ga0495609_0012083 | 3300046538 | Bacteria | 4098 |
| 446 | Ga0495609_0034125 | 3300046538 | Bacteria | 2308 |
| 447 | Ga0495645_0003468 | 3300046543 | Bacteria | 10698 |
| 448 | Ga0495645_0009752 | 3300046543 | Bacteria | 6719 |
| 449 | Ga0495645_0010758 | 3300046543 | Bacteria | 6428 |
| 450 | Ga0495622_0025456 | 3300046557 | Bacteria | 2763 |
| 451 | Ga0495633_0015429 | 3300046558 | Bacteria | 3963 |
| 452 | Ga0495668_0117085 | 3300046616 | Bacteria | 1457 |
| 453 | Ga0495625_0000547 | 3300046660 | Bacteria | 55124 |
| 454 | Ga0495625_0013877 | 3300046660 | Bacteria | 6453 |
| 455 | Ga0495625_0029349 | 3300046660 | Bacteria | 4115 |
| 456 | Ga0495625_0039124 | 3300046660 | Bacteria | 3465 |
| 457 | Ga0495625_0050077 | 3300046660 | Bacteria | 2999 |
| 458 | Ga0495625_0112317 | 3300046660 | Bacteria | 1862 |
| 459 | Ga0495599_0011001 | 3300046678 | Bacteria | 5552 |
| 460 | Ga0495599_0054187 | 3300046678 | Bacteria | 2512 |
| 461 | Ga0495669_0005087 | 3300046684 | Bacteria | 5473 |
| 462 | Ga0495613_0007254 | 3300046689 | Bacteria | 8250 |
| 463 | Ga0495613_0074592 | 3300046689 | Bacteria | 2470 |
| 464 | Ga0495670_0038916 | 3300046691 | Bacteria | 2371 |
| 465 | Ga0495649_0035236 | 3300046694 | Bacteria | 2753 |
| 466 | Ga0495600_0038988 | 3300046809 | Bacteria | 3093 |
| 467 | Ga0495581_0023494 | 3300047315 | Bacteria | 3572 |
| 468 | Ga0495604_0014438 | 3300047317 | Bacteria | 6300 |
| 469 | Ga0495604_0017563 | 3300047317 | Bacteria | 5729 |
| 470 | Ga0495636_0001717 | 3300047318 | Bacteria | 8356 |
| 471 | Ga0495636_0058685 | 3300047318 | Bacteria | 1623 |
| 472 | Ga0495674_0027833 | 3300047319 | Bacteria | 5162 |
| 473 | Ga0495672_0000481 | 3300047320 | Bacteria | 47172 |
| 474 | Ga0495687_018867 | 3300047443 | Bacteria | 3398 |
| 475 | Ga0495673_0031739 | 3300047469 | Bacteria | 2471 |
| 476 | Ga0495673_0032177 | 3300047469 | Bacteria | 2449 |
| 477 | Ga0495686_0000252 | 3300047472 | Bacteria | 96182 |
| 478 | Ga0495686_0002559 | 3300047472 | Bacteria | 16982 |
| 479 | Ga0495686_0004933 | 3300047472 | Bacteria | 10744 |
| 480 | Ga0495686_0009416 | 3300047472 | Bacteria | 7037 |
| 481 | Ga0495686_0057198 | 3300047472 | Bacteria | 2435 |
| 482 | Ga0495614_0067661 | 3300048089 | Bacteria | 1537 |
| 483 | Ga0496100_0063960 | 3300048903 | Bacteria | 2433 |
| 484 | Ga0496101_0016650 | 3300048904 | Bacteria | 4973 |
| 485 | Ga0496104_0000072 | 3300048907 | Bacteria | 106074 |
| 486 | Ga0496104_0039062 | 3300048907 | Bacteria | 4443 |
| 487 | Ga0496107_0047373 | 3300048910 | Bacteria | 3096 |
| 488 | Ga0496112_0323751 | 3300048915 | Bacteria | 1486 |
| 489 | Ga0496114_0019888 | 3300048917 | Bacteria | 5445 |
| 490 | Ga0496114_0033341 | 3300048917 | Bacteria | 4243 |
| 491 | Ga0496115_0000751 | 3300048918 | Bacteria | 23861 |
| 492 | Ga0496117_0001359 | 3300048920 | Bacteria | 35660 |
| 493 | Ga0496123_0040403 | 3300048926 | Bacteria | 3249 |
| 494 | Ga0496126_0000018 | 3300048929 | Bacteria | 581170 |
| 495 | Ga0496126_0000085 | 3300048929 | Bacteria | 216528 |
| 496 | Ga0496126_0004143 | 3300048929 | Bacteria | 17528 |
| 497 | Ga0496126_0005400 | 3300048929 | Bacteria | 14593 |
| 498 | Ga0496126_0007079 | 3300048929 | Bacteria | 12353 |
| 499 | Ga0496126_0162452 | 3300048929 | Bacteria | 1908 |
| 500 | Ga0495682_0029954 | 3300049460 | Bacteria | 2015 |
| 501 | Ga0501031_0003475 | 3300049568 | Bacteria | 10114 |
| 502 | Ga0501031_0023766 | 3300049568 | Bacteria | 3995 |
| 503 | Ga0501031_0140078 | 3300049568 | Bacteria | 1581 |
| 504 | Ga0501032_0001467 | 3300049569 | Bacteria | 18774 |
| 505 | Ga0501032_0001834 | 3300049569 | Bacteria | 16802 |
| 506 | Ga0501033_0006599 | 3300049570 | Bacteria | 9078 |
| 507 | Ga0501033_0025734 | 3300049570 | Bacteria | 4433 |
| 508 | Ga0501034_0004684 | 3300049571 | Bacteria | 15148 |
| 509 | Ga0501034_0006950 | 3300049571 | Bacteria | 12095 |
| 510 | Ga0501036_0001824 | 3300049572 | Bacteria | 16528 |
| 511 | Ga0501036_0014403 | 3300049572 | Bacteria | 6584 |
| 512 | Ga0501037_0001210 | 3300049573 | Bacteria | 19087 |
| 513 | Ga0501037_0002249 | 3300049573 | Bacteria | 13956 |
| 514 | Ga0501037_0031208 | 3300049573 | Bacteria | 3935 |
| 515 | Ga0501037_0072103 | 3300049573 | Bacteria | 2512 |
| 516 | Ga0501038_0000686 | 3300049574 | Bacteria | 30094 |
| 517 | Ga0501038_0003372 | 3300049574 | Bacteria | 14898 |
| 518 | Ga0501038_0004106 | 3300049574 | Bacteria | 13542 |
| 519 | Ga0501039_0017213 | 3300049575 | Bacteria | 5544 |
| 520 | Ga0501043_0000537 | 3300049579 | Bacteria | 34156 |
| 521 | Ga0501046_0000106 | 3300049580 | Bacteria | 89243 |
| 522 | Ga0501046_0030096 | 3300049580 | Bacteria | 4409 |
| 523 | Ga0501047_0003390 | 3300049581 | Bacteria | 15080 |
| 524 | Ga0501047_0081513 | 3300049581 | Bacteria | 3110 |
| 525 | Ga0501048_0185884 | 3300049582 | Bacteria | 1473 |
| 526 | Ga0501067_0004821 | 3300049583 | Bacteria | 7482 |
| 527 | Ga0501069_0037416 | 3300049585 | Bacteria | 2678 |
| 528 | Ga0501070_0015424 | 3300049586 | Bacteria | 6428 |
| 529 | Ga0501070_0246172 | 3300049586 | Bacteria | 1463 |
| 530 | Ga0501073_0019825 | 3300049589 | Bacteria | 4853 |
| 531 | Ga0501073_0040932 | 3300049589 | Bacteria | 3276 |
| 532 | Ga0501073_0060168 | 3300049589 | Bacteria | 2651 |
| 533 | Ga0501080_0011841 | 3300049742 | Bacteria | 7993 |
| 534 | Ga0501080_0166807 | 3300049742 | Bacteria | 2032 |
| 535 | Ga0501083_0139444 | 3300049744 | Bacteria | 1588 |
| 536 | Ga0501035_0006786 | 3300049822 | Bacteria | 10698 |
| 537 | Ga0501035_0023702 | 3300049822 | Bacteria | 5631 |
| 538 | Ga0501035_0102693 | 3300049822 | Unclassified | 2508 |
| 539 | Ga0501044_0001138 | 3300049823 | Bacteria | 31569 |
| 540 | Ga0501044_0017911 | 3300049823 | Bacteria | 7596 |
| 541 | Ga0501044_0031801 | 3300049823 | Bacteria | 5550 |
| 542 | Ga0501045_0002577 | 3300049824 | Bacteria | 12364 |
| 543 | nmdc:mga0n895_173_c1 | 3300050512 | Bacteria | 39986 |
| 544 | nmdc:mga0rr50_2_c1 | 3300050513 | Bacteria | 373938 |
| 545 | nmdc:mga08x19_140434_c1 | 3300050514 | Bacteria | 1631 |
| 546 | nmdc:mga08x19_15382_c1 | 3300050514 | Bacteria | 4655 |
| 547 | nmdc:mga08x19_863_c1 | 3300050514 | Bacteria | 19232 |
| 548 | Ga0495601_0095783 | 3300053077 | Bacteria | 1914 |
| 549 | Ga0500651_0000039 | 3300053093 | Bacteria | 96498 |
| 550 | Ga0500595_000025 | 3300053119 | Bacteria | 142073 |
| 551 | Ga0500616_0000734 | 3300053153 | Bacteria | 37933 |
| 552 | Ga0500616_0004843 | 3300053153 | Bacteria | 9398 |
| 553 | 2844855626 | 2844852863 | Bacteria | 3849151 |
| 554 | 2857729978 | 2857729791 | Bacteria | 4040535 |
| 555 | 2862996036 | 2862993130 | Bacteria | 3860849 |
| 556 | 2884218851 | 2884215851 | Bacteria | 4554841 |
| 557 | 2928123200 | 2928121344 | Bacteria | 3972376 |
| 558 | 2939661218 | 2939660829 | Bacteria | 3784848 |
| 559 | 8004214333 | 8004212874 | Bacteria | 2861420 |
| 560 | 8056039493 | 8056037122 | Bacteria | 3854319 |
| 561 | 8057348857 | 8057345674 | Bacteria | 4160394 |
| 562 | Ga0068855_100022515 | |||
| 563 | SwRhRL2b_contig_350266 | |||
| 564 | CNXas_1000004 | |||
| 565 | JGI25406J46586_10000031 | |||
| 566 | JGI25406J46586_10012796 | |||
| 567 | rootH2_10016441 | |||
| 568 | rootL2_10072798 | |||
| 569 | Ga0065704_10006997 | |||
| 570 | Ga0070658_10000017 | |||
| 571 | Ga0070658_10008811 | |||
| 572 | Ga0070658_10018128 | |||
| 573 | Ga0070658_10074486 | |||
| 574 | Ga0070658_10081548 | |||
| 575 | Ga0070658_10092902 | |||
| 576 | Ga0070658_10167446 | |||
| 577 | Ga0070658_10179832 | |||
| 578 | Ga0070683_100230111 | |||
| 579 | Ga0070670_100006170 | |||
| 580 | Ga0070670_100192817 | |||
| 581 | Ga0070666_10001132 | |||
| 582 | Ga0070666_10049895 | |||
| 583 | Ga0070680_100071992 | |||
| 584 | Ga0068868_100295861 | |||
| 585 | Ga0070660_100001386 | |||
| 586 | Ga0070660_100006810 | |||
| 587 | Ga0070660_100082734 | |||
| 588 | Ga0070689_100016039 | |||
| 589 | Ga0070689_100032077 | |||
| 590 | Ga0070689_100067372 | |||
| 591 | Ga0070689_100266046 | |||
| 592 | Ga0070661_100006180 | |||
| 593 | Ga0070661_100056717 | |||
| 594 | Ga0070668_100052036 | |||
| 595 | Ga0070669_100039231 | |||
| 596 | Ga0070675_100014872 | |||
| 597 | Ga0070671_100015235 | |||
| 598 | Ga0070671_100034864 | |||
| 599 | Ga0070671_100074652 | |||
| 600 | Ga0070671_100131945 | |||
| 601 | Ga0070671_100204836 | |||
| 602 | Ga0070674_100012748 | |||
| 603 | Ga0070673_100006547 | |||
| 604 | Ga0070673_100260365 | |||
| 605 | Ga0070688_100006047 | |||
| 606 | Ga0070659_100000075 | |||
| 607 | Ga0070659_100005119 | |||
| 608 | Ga0070659_100013462 | |||
| 609 | Ga0070667_100033080 | |||
| 610 | Ga0070667_100054755 | |||
| 611 | Ga0070709_10033587 | |||
| 612 | Ga0070714_100057739 | |||
| 613 | Ga0070713_100004876 | |||
| 614 | Ga0070713_100077855 | |||
| 615 | Ga0070694_100025901 | |||
| 616 | Ga0070708_100013729 | |||
| 617 | Ga0070708_100026740 | |||
| 618 | Ga0070708_100045230 | |||
| 619 | Ga0070708_100056443 | |||
| 620 | Ga0070708_100161551 | |||
| 621 | Ga0070663_100134629 | |||
| 622 | Ga0070678_100008889 | |||
| 623 | Ga0070681_10017621 | |||
| 624 | Ga0070681_10123963 | |||
| 625 | Ga0068867_100009876 | |||
| 626 | Ga0070685_10056356 | |||
| 627 | Ga0070706_100000709 | |||
| 628 | Ga0070706_100006581 | |||
| 629 | Ga0070706_100016018 | |||
| 630 | Ga0070706_100088362 | |||
| 631 | Ga0070706_100197054 | |||
| 632 | Ga0070706_100233145 | |||
| 633 | Ga0070706_100289254 | |||
| 634 | Ga0070707_100004838 | |||
| 635 | Ga0070707_100042500 | |||
| 636 | Ga0070707_100072631 | |||
| 637 | Ga0070707_100074680 | |||
| 638 | Ga0070707_100127700 | |||
| 639 | Ga0070707_100129698 | |||
| 640 | Ga0070707_100159234 | |||
| 641 | Ga0070698_100004491 | |||
| 642 | Ga0070698_100027154 | |||
| 643 | Ga0070698_100137031 | |||
| 644 | Ga0070698_100143371 | |||
| 645 | Ga0070698_100172646 | |||
| 646 | Ga0070699_100016883 | |||
| 647 | Ga0070699_100037430 | |||
| 648 | Ga0070699_100066104 | |||
| 649 | Ga0070699_100240004 | |||
| 650 | Ga0070679_100031501 | |||
| 651 | Ga0070679_100045301 | |||
| 652 | Ga0070697_100003578 | |||
| 653 | Ga0070697_100010936 | |||
| 654 | Ga0070697_100027928 | |||
| 655 | Ga0070697_100029192 | |||
| 656 | Ga0070697_100033960 | |||
| 657 | Ga0070697_100104321 | |||
| 658 | Ga0070697_100175957 | |||
| 659 | Ga0068853_100000022 | |||
| 660 | Ga0068853_100000115 | |||
| 661 | Ga0068853_100003373 | |||
| 662 | Ga0070672_100014922 | |||
| 663 | Ga0070686_100004330 | |||
| 664 | Ga0070686_100092476 | |||
| 665 | Ga0070665_100075120 | |||
| 666 | Ga0070665_100245648 | |||
| 667 | Ga0070704_100007209 | |||
| 668 | Ga0068855_100003787 | |||
| 669 | Ga0068855_100013989 | |||
| 670 | Ga0068855_100024962 | |||
| 671 | Ga0068855_100067506 | |||
| 672 | Ga0068855_100109714 | |||
| 673 | Ga0068855_100183396 | |||
| 674 | Ga0068855_100211673 | |||
| 675 | Ga0068855_100214768 | |||
| 676 | Ga0068857_100119777 | |||
| 677 | Ga0068854_100000038 | |||
| 678 | Ga0068854_100005679 | |||
| 679 | Ga0068854_100073621 | |||
| 680 | Ga0068856_100015167 | |||
| 681 | Ga0068856_100046837 | |||
| 682 | Ga0068852_100004487 | |||
| 683 | Ga0068852_100044824 | |||
| 684 | Ga0068852_100051091 | |||
| 685 | Ga0068852_100136327 | |||
| 686 | Ga0068864_100036727 | |||
| 687 | Ga0068864_100086317 | |||
| 688 | Ga0068864_100120740 | |||
| 689 | Ga0068863_100035891 | |||
| 690 | Ga0068858_100274972 | |||
| 691 | Ga0068860_100000159 | |||
| 692 | Ga0081455_10000725 | |||
| 693 | Ga0081455_10001494 | |||
| 694 | Ga0081455_10010167 | |||
| 695 | Ga0081540_1000380 | |||
| 696 | Ga0081540_1061925 | |||
| 697 | Ga0081539_10000564 | |||
| 698 | Ga0081539_10001104 | |||
| 699 | Ga0070717_10000353 | |||
| 700 | Ga0070717_10047081 | |||
| 701 | Ga0070717_10187206 | |||
| 702 | Ga0070712_100085516 | |||
| 703 | Ga0070712_100248422 | |||
| 704 | Ga0075362_10000411 | |||
| 705 | Ga0075366_10019664 | |||
| 706 | Ga0097621_100003193 | |||
| 707 | Ga0097621_100035123 | |||
| 708 | Ga0068871_100025141 | |||
| 709 | Ga0068871_100263907 | |||
| 710 | Ga0075428_100026634 | |||
| 711 | Ga0075428_100036038 | |||
| 712 | Ga0068865_100031192 | |||
| 713 | Ga0075435_100000263 | |||
| 714 | Ga0075435_100018595 | |||
| 715 | Ga0105240_10000001 | |||
| 716 | Ga0105240_10008663 | |||
| 717 | Ga0105240_10009398 | |||
| 718 | Ga0105240_10090430 | |||
| 719 | Ga0105240_10105281 | |||
| 720 | Ga0105240_10124160 | |||
| 721 | Ga0105240_10136095 | |||
| 722 | Ga0105240_10217214 | |||
| 723 | Ga0105240_10254885 | |||
| 724 | Ga0111539_10047245 | |||
| 725 | Ga0114129_10033795 | |||
| 726 | Ga0105241_10020006 | |||
| 727 | Ga0105242_10153726 | |||
| 728 | Ga0105248_10057882 | |||
| 729 | Ga0105237_10013617 | |||
| 730 | Ga0105237_10018010 | |||
| 731 | Ga0105237_10030692 | |||
| 732 | Ga0105238_10006718 | |||
| 733 | Ga0105238_10017937 | |||
| 734 | Ga0105238_10035065 | |||
| 735 | Ga0105238_10066785 | |||
| 736 | Ga0105239_10226302 | |||
| 737 | Ga0157370_10018964 | |||
| 738 | Ga0157370_10022540 | |||
| 739 | Ga0157370_10045365 | |||
| 740 | Ga0157370_10101914 | |||
| 741 | Ga0157370_10190435 | |||
| 742 | Ga0157369_10005530 | |||
| 743 | Ga0157369_10007454 | |||
| 744 | Ga0157369_10016107 | |||
| 745 | Ga0157369_10018413 | |||
| 746 | Ga0157369_10019879 | |||
| 747 | Ga0157369_10046325 | |||
| 748 | Ga0157369_10057375 | |||
| 749 | Ga0157369_10071014 | |||
| 750 | Ga0157369_10454159 | |||
| 751 | Ga0157374_10000028 | |||
| 752 | Ga0157374_10003877 | |||
| 753 | Ga0157374_10018766 | |||
| 754 | Ga0157374_10035443 | |||
| 755 | Ga0157374_10046221 | |||
| 756 | Ga0157374_10082808 | |||
| 757 | Ga0157378_10045848 | |||
| 758 | Ga0157378_10210810 | |||
| 759 | Ga0163162_10027367 | |||
| 760 | Ga0163162_10318227 | |||
| 761 | Ga0157372_10006072 | |||
| 762 | Ga0157372_10007912 | |||
| 763 | Ga0157372_10010637 | |||
| 764 | Ga0157372_10023716 | |||
| 765 | Ga0157372_10029299 | |||
| 766 | Ga0157372_10048421 | |||
| 767 | Ga0157372_10079053 | |||
| 768 | Ga0157375_10037791 | |||
| 769 | Ga0157375_10050251 | |||
| 770 | Ga0163163_10008481 | |||
| 771 | Ga0163163_10013037 | |||
| 772 | Ga0157376_10028530 | |||
| 773 | Ga0213872_10000478 | |||
| 774 | Ga0213872_10003129 | |||
| 775 | Ga0213872_10017606 | |||
| 776 | Ga0213874_10033656 | |||
| 777 | Ga0213876_10001500 | |||
| 778 | Ga0213876_10008676 | |||
| 779 | Ga0213871_10012013 | |||
| 780 | Ga0209233_1001450 | |||
| 781 | Ga0209233_1005386 | |||
| 782 | Ga0207697_10000511 | |||
| 783 | Ga0207688_10004499 | |||
| 784 | Ga0207680_10030795 | |||
| 785 | Ga0207680_10093824 | |||
| 786 | Ga0207647_10020074 | |||
| 787 | Ga0207699_10043297 | |||
| 788 | Ga0207705_10000020 | |||
| 789 | Ga0207705_10000562 | |||
| 790 | Ga0207705_10004135 | |||
| 791 | Ga0207705_10009526 | |||
| 792 | Ga0207705_10031218 | |||
| 793 | Ga0207705_10037451 | |||
| 794 | Ga0207705_10051999 | |||
| 795 | Ga0207705_10077121 | |||
| 796 | Ga0207705_10187126 | |||
| 797 | Ga0207684_10000650 | |||
| 798 | Ga0207684_10002149 | |||
| 799 | Ga0207684_10045510 | |||
| 800 | Ga0207684_10189629 | |||
| 801 | Ga0207684_10202763 | |||
| 802 | Ga0207684_10227514 | |||
| 803 | Ga0207654_10000505 | |||
| 804 | Ga0207695_10000001 | |||
| 805 | Ga0207695_10000249 | |||
| 806 | Ga0207695_10003985 | |||
| 807 | Ga0207695_10079308 | |||
| 808 | Ga0207695_10313834 | |||
| 809 | Ga0207671_10006453 | |||
| 810 | Ga0207693_10065034 | |||
| 811 | Ga0207693_10166306 | |||
| 812 | Ga0207693_10272010 | |||
| 813 | Ga0207657_10003277 | |||
| 814 | Ga0207657_10003920 | |||
| 815 | Ga0207657_10012904 | |||
| 816 | Ga0207657_10085379 | |||
| 817 | Ga0207649_10029706 | |||
| 818 | Ga0207649_10040648 | |||
| 819 | Ga0207652_10001024 | |||
| 820 | Ga0207652_10043440 | |||
| 821 | Ga0207652_10340191 | |||
| 822 | Ga0207646_10001257 | |||
| 823 | Ga0207646_10002214 | |||
| 824 | Ga0207646_10027150 | |||
| 825 | Ga0207646_10049173 | |||
| 826 | Ga0207646_10150230 | |||
| 827 | Ga0207646_10194083 | |||
| 828 | Ga0207681_10023977 | |||
| 829 | Ga0207694_10003813 | |||
| 830 | Ga0207694_10098012 | |||
| 831 | Ga0207650_10025409 | |||
| 832 | Ga0207650_10029443 | |||
| 833 | Ga0207650_10048128 | |||
| 834 | Ga0207650_10160176 | |||
| 835 | Ga0207659_10013676 | |||
| 836 | Ga0207700_10060809 | |||
| 837 | Ga0207664_10048705 | |||
| 838 | Ga0207644_10067976 | |||
| 839 | Ga0207690_10024263 | |||
| 840 | Ga0207690_10157724 | |||
| 841 | Ga0207686_10106416 | |||
| 842 | Ga0207670_10051342 | |||
| 843 | Ga0207669_10054056 | |||
| 844 | Ga0207704_10049158 | |||
| 845 | Ga0207665_10077341 | |||
| 846 | Ga0207665_10195349 | |||
| 847 | Ga0207691_10002134 | |||
| 848 | Ga0207661_10198381 | |||
| 849 | Ga0207679_10026287 | |||
| 850 | Ga0207667_10012883 | |||
| 851 | Ga0207667_10015163 | |||
| 852 | Ga0207667_10015957 | |||
| 853 | Ga0207667_10017144 | |||
| 854 | Ga0207667_10087316 | |||
| 855 | Ga0207667_10175488 | |||
| 856 | Ga0207667_10178565 | |||
| 857 | Ga0207668_10015093 | |||
| 858 | Ga0207640_10000051 | |||
| 859 | Ga0207658_10088597 | |||
| 860 | Ga0207703_10242855 | |||
| 861 | Ga0207639_10000002 | |||
| 862 | Ga0207639_10000069 | |||
| 863 | Ga0207639_10003062 | |||
| 864 | Ga0207678_10003373 | |||
| 865 | Ga0207678_10016333 | |||
| 866 | Ga0207678_10072128 | |||
| 867 | Ga0207678_10123885 | |||
| 868 | Ga0207702_10010689 | |||
| 869 | Ga0207641_10113688 | |||
| 870 | Ga0207648_10006358 | |||
| 871 | Ga0207676_10077133 | |||
| 872 | Ga0207674_10006812 | |||
| 873 | Ga0207683_10004826 | |||
| 874 | Ga0268266_10002216 | |||
| 875 | Ga0268266_10202007 | |||
| 876 | Ga0268266_10220243 | |||
| 877 | Ga0268264_10000363 | |||
| 878 | Ga0265337_1011546 | |||
| 879 | Ga0265319_1006133 | |||
| 880 | Ga0265334_10007737 | |||
| 881 | Ga0265323_10000049 | |||
| 882 | Ga0265323_10027656 | |||
| 883 | Ga0265336_10000667 | |||
| 884 | Ga0265338_10000420 | |||
| 885 | Ga0265338_10003150 | |||
| 886 | Ga0265338_10024388 | |||
| 887 | Ga0265338_10039737 | |||
| 888 | Ga0265338_10052396 | |||
| 889 | Ga0265328_10015755 | |||
| 890 | Ga0265320_10007008 | |||
| 891 | Ga0265325_10033064 | |||
| 892 | Ga0265329_10000594 | |||
| 893 | Ga0265340_10015100 | |||
| 894 | Ga0265331_10054503 | |||
| 895 | Ga0265327_10001754 | |||
| 896 | Ga0265316_10065150 | |||
| 897 | Ga0265316_10078336 | |||
| 898 | Ga0265316_10111926 | |||
| 899 | Ga0307513_10080560 | |||
| 900 | Ga0316575_10007083 | |||
| 901 | Ga0316579_10000223 | |||
| 902 | Ga0265314_10022627 | |||
| 903 | Ga0316576_10101021 | |||
| 904 | Ga0316578_10062240 | |||
| 905 | Ga0316593_10000461 | |||
| 906 | Ga0307510_10018128 | |||
| 907 | Ga0307510_10024597 | |||
| 908 | Ga0316596_1000420 | |||
| 909 | Ga0373928_0000279 | |||
| 910 | Ga0373944_0000216 | |||
| 911 | Ga0373949_0000474 | |||
| 912 | Ga0373932_0000005 | |||
| 913 | Ga0373955_0079416 | |||
| 914 | Ga0373955_0103048 | |||
| 915 | Ga0373962_0000483 | |||
| 916 | Ga0373931_0000016 | |||
| 917 | Ga0373935_0010110 | |||
| 918 | Ga0373935_0041838 | |||
| 919 | Ga0373927_0019734 | |||
| 920 | Ga0373933_0084114 | |||
| 921 | Ga0373947_0058156 | |||
| 922 | Ga0373947_0085481 | |||
| 923 | Ga0373937_0177617 | |||
| 924 | Ga0373937_0255119 | |||
| 925 | Ga0373925_0000514 | |||
| 926 | Ga0395900_0001406 | |||
| 927 | Ga0395900_0339133 | |||
| 928 | Ga0395898_0017405 | |||
| 929 | Ga0395905_0035278 | |||
| 930 | Ga0436364_1160864 | |||
| 931 | Ga0395901_0213998 | |||
| 932 | Ga0436365_0377191 | |||
| 933 | Ga0436365_0838450 | |||
| 934 | Ga0436365_0909065 | |||
| 935 | Ga0436365_1147197 | |||
| 936 | Ga0436365_1383407 | |||
| 937 | Ga0436360_0799469 | |||
| 938 | Ga0436360_0921181 | |||
| 939 | Ga0436360_1109878 | |||
| 940 | Ga0436361_0111757 | |||
| 941 | Ga0436361_0264843 | |||
| 942 | Ga0436361_0298522 | |||
| 943 | Ga0436361_0528354 | |||
| 944 | Ga0436361_1030048 | |||
| 945 | Ga0436363_0937124 | |||
| 946 | Ga0436362_0064032 | |||
| 947 | Ga0451855_1043235 | |||
| 948 | Ga0451577_0000033 | |||
| 949 | Ga0451577_0000047 | |||
| 950 | Ga0466969_0011903 | |||
| 951 | Ga0466966_0042268 | |||
| 952 | Ga0453684_0000109 | |||
| 953 | Ga0453684_0000611 | |||
| 954 | Ga0453684_0003475 | |||
| 955 | Ga0453684_0026393 | |||
| 956 | Ga0451576_0044480 | |||
| 957 | Ga0451576_0095872 | |||
| 958 | Ga0466967_0026996 | |||
| 959 | Ga0466967_0183007 | |||
| 960 | Ga0495592_0043835 | |||
| 961 | Ga0495603_0001453 | |||
| 962 | Ga0495629_0002888 | |||
| 963 | Ga0495629_0027641 | |||
| 964 | Ga0495629_0053162 | |||
| 965 | Ga0495638_0090375 | |||
| 966 | Ga0495653_0022608 | |||
| 967 | Ga0495650_0000006 | |||
| 968 | Ga0495650_0001575 | |||
| 969 | Ga0495580_0070355 | |||
| 970 | Ga0495580_0193243 | |||
| 971 | Ga0495582_0005157 | |||
| 972 | Ga0495639_0019355 | |||
| 973 | Ga0495662_0034989 | |||
| 974 | Ga0495664_0010765 | |||
| 975 | Ga0495664_0024030 | |||
| 976 | Ga0495585_0028516 | |||
| 977 | Ga0495594_0000142 | |||
| 978 | Ga0495594_0000247 | |||
| 979 | Ga0495583_0031763 | |||
| 980 | Ga0495583_0041523 | |||
| 981 | Ga0495606_0039875 | |||
| 982 | Ga0495606_0076625 | |||
| 983 | Ga0495606_0112393 | |||
| 984 | Ga0495618_0013075 | |||
| 985 | Ga0495618_0017873 | |||
| 986 | Ga0495628_0000354 | |||
| 987 | Ga0495628_0088214 | |||
| 988 | Ga0495630_0004948 | |||
| 989 | Ga0495631_0038516 | |||
| 990 | Ga0495631_0039407 | |||
| 991 | Ga0495632_0079849 | |||
| 992 | Ga0495643_0000111 | |||
| 993 | Ga0495644_0000009 | |||
| 994 | Ga0495648_0033861 | |||
| 995 | Ga0495648_0072756 | |||
| 996 | Ga0495648_0124316 | |||
| 997 | Ga0495666_0015596 | |||
| 998 | Ga0495642_0030428 | |||
| 999 | Ga0495652_0006133 | |||
| 1000 | Ga0495652_0039128 | |||
| 1001 | Ga0495640_0019813 | |||
| 1002 | Ga0495586_0009379 | |||
| 1003 | Ga0495586_0012324 | |||
| 1004 | Ga0495587_0047810 | |||
| 1005 | Ga0495587_0088535 | |||
| 1006 | Ga0495609_0012083 | |||
| 1007 | Ga0495609_0034125 | |||
| 1008 | Ga0495645_0003468 | |||
| 1009 | Ga0495645_0009752 | |||
| 1010 | Ga0495645_0010758 | |||
| 1011 | Ga0495622_0025456 | |||
| 1012 | Ga0495633_0015429 | |||
| 1013 | Ga0495668_0117085 | |||
| 1014 | Ga0495625_0000547 | |||
| 1015 | Ga0495625_0013877 | |||
| 1016 | Ga0495625_0029349 | |||
| 1017 | Ga0495625_0039124 | |||
| 1018 | Ga0495625_0050077 | |||
| 1019 | Ga0495625_0112317 | |||
| 1020 | Ga0495599_0011001 | |||
| 1021 | Ga0495599_0054187 | |||
| 1022 | Ga0495669_0005087 | |||
| 1023 | Ga0495613_0007254 | |||
| 1024 | Ga0495613_0074592 | |||
| 1025 | Ga0495670_0038916 | |||
| 1026 | Ga0495649_0035236 | |||
| 1027 | Ga0495600_0038988 | |||
| 1028 | Ga0495581_0023494 | |||
| 1029 | Ga0495604_0014438 | |||
| 1030 | Ga0495604_0017563 | |||
| 1031 | Ga0495636_0001717 | |||
| 1032 | Ga0495636_0058685 | |||
| 1033 | Ga0495674_0027833 | |||
| 1034 | Ga0495672_0000481 | |||
| 1035 | Ga0495687_018867 | |||
| 1036 | Ga0495673_0031739 | |||
| 1037 | Ga0495673_0032177 | |||
| 1038 | Ga0495686_0000252 | |||
| 1039 | Ga0495686_0002559 | |||
| 1040 | Ga0495686_0004933 | |||
| 1041 | Ga0495686_0009416 | |||
| 1042 | Ga0495686_0057198 | |||
| 1043 | Ga0495614_0067661 | |||
| 1044 | Ga0496100_0063960 | |||
| 1045 | Ga0496101_0016650 | |||
| 1046 | Ga0496104_0000072 | |||
| 1047 | Ga0496104_0039062 | |||
| 1048 | Ga0496107_0047373 | |||
| 1049 | Ga0496112_0323751 | |||
| 1050 | Ga0496114_0019888 | |||
| 1051 | Ga0496114_0033341 | |||
| 1052 | Ga0496115_0000751 | |||
| 1053 | Ga0496117_0001359 | |||
| 1054 | Ga0496123_0040403 | |||
| 1055 | Ga0496126_0000018 | |||
| 1056 | Ga0496126_0000085 | |||
| 1057 | Ga0496126_0004143 | |||
| 1058 | Ga0496126_0005400 | |||
| 1059 | Ga0496126_0007079 | |||
| 1060 | Ga0496126_0162452 | |||
| 1061 | Ga0495682_0029954 | |||
| 1062 | Ga0501031_0003475 | |||
| 1063 | Ga0501031_0023766 | |||
| 1064 | Ga0501031_0140078 | |||
| 1065 | Ga0501032_0001467 | |||
| 1066 | Ga0501032_0001834 | |||
| 1067 | Ga0501033_0006599 | |||
| 1068 | Ga0501033_0025734 | |||
| 1069 | Ga0501034_0004684 | |||
| 1070 | Ga0501034_0006950 | |||
| 1071 | Ga0501036_0001824 | |||
| 1072 | Ga0501036_0014403 | |||
| 1073 | Ga0501037_0001210 | |||
| 1074 | Ga0501037_0002249 | |||
| 1075 | Ga0501037_0031208 | |||
| 1076 | Ga0501037_0072103 | |||
| 1077 | Ga0501038_0000686 | |||
| 1078 | Ga0501038_0003372 | |||
| 1079 | Ga0501038_0004106 | |||
| 1080 | Ga0501039_0017213 | |||
| 1081 | Ga0501043_0000537 | |||
| 1082 | Ga0501046_0000106 | |||
| 1083 | Ga0501046_0030096 | |||
| 1084 | Ga0501047_0003390 | |||
| 1085 | Ga0501047_0081513 | |||
| 1086 | Ga0501048_0185884 | |||
| 1087 | Ga0501067_0004821 | |||
| 1088 | Ga0501069_0037416 | |||
| 1089 | Ga0501070_0015424 | |||
| 1090 | Ga0501070_0246172 | |||
| 1091 | Ga0501073_0019825 | |||
| 1092 | Ga0501073_0040932 | |||
| 1093 | Ga0501073_0060168 | |||
| 1094 | Ga0501080_0011841 | |||
| 1095 | Ga0501080_0166807 | |||
| 1096 | Ga0501083_0139444 | |||
| 1097 | Ga0501035_0006786 | |||
| 1098 | Ga0501035_0023702 | |||
| 1099 | Ga0501035_0102693 | |||
| 1100 | Ga0501044_0001138 | |||
| 1101 | Ga0501044_0017911 | |||
| 1102 | Ga0501044_0031801 | |||
| 1103 | Ga0501045_0002577 | |||
| 1104 | nmdc:mga0n895_173_c1 | |||
| 1105 | nmdc:mga0rr50_2_c1 | |||
| 1106 | nmdc:mga08x19_140434_c1 | |||
| 1107 | nmdc:mga08x19_15382_c1 | |||
| 1108 | nmdc:mga08x19_863_c1 | |||
| 1109 | Ga0495601_0095783 | |||
| 1110 | Ga0500651_0000039 | |||
| 1111 | Ga0500595_000025 | |||
| 1112 | Ga0500616_0000734 | |||
| 1113 | Ga0500616_0004843 | |||
| 1114 | 2844855626 | |||
| 1115 | 2857729978 | |||
| 1116 | 2862996036 | |||
| 1117 | 2884218851 | |||
| 1118 | 2928123200 | |||
| 1119 | 2939661218 | |||
| 1120 | 8004214333 | |||
| 1121 | 8056039493 | |||
| 1122 | 8057348857 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ls6-assembly1.cif.gz_B | crystal structure of beta-ketoacyl-acp synthase ii (fabf) i108f mutant from bacillus subtilis | 0.9502 | 12 | 408 |
| 6olt-assembly1.cif.gz_A | crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabf, and c12-crypto acyl carrier protein, acpp | 0.95 | 13 | 407 |
| 3g0y-assembly1.cif.gz_A | structure of e. coli fabf(c163q) in complex with dihydroplatensimycin | 0.9493 | 14 | 407 |
| 4ls5-assembly1.cif.gz_B | crystal structure of beta-ketoacyl-acp synthase ii (fabf) from bacillus subtilis | 0.9487 | 12 | 408 |
| 1e5m-assembly1.cif.gz_A-2 | beta ketoacyl acyl carrier protein synthase ii (kasii) from synechocystis sp. | 0.9484 | 14 | 408 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQD9_267_416_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9702 | 259 | 407 | 3.40.47.10 |
| af_I1N0K0_264_378_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9688 | 257 | 366 | 3.40.47.10 |
| af_Q0E328_1_239_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.967 | 190 | 406 | 3.40.47.10 |
| 1tqyG02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9636 | 259 | 407 | 3.40.47.10 |
| af_P9WQD9_267_416_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9577 | 259 | 407 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9LGG8-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase II | 0.9954 | 207 | 409 |
GO:0004315
GO:0006633 |
| AF-A0A3B9LGG8-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase II | 0.9905 | 207 | 409 |
GO:0004315
GO:0006633 |
| AF-A0A2V5M7Z2-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase family protein | 0.9889 | 88 | 409 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A2V6H2M4-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase II | 0.9858 | 248 | 409 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A2V5M7Z2-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase family protein | 0.9858 | 88 | 409 |
GO:0004315
GO:0005829 GO:0006633 |