F463799

General Info

Members Datasets Scaffolds Average Seq Length
561 286 1122 410

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100022515|Ga0068855_1000225156
Length 470
Sequence MLKSKGALVLGISLELGTWDLELRPTRLRTKLHDSPHRPRVDFTASSSLPSHKTLQRIVLFPFVASSTQPRIVITGAGIVTALGFGWRANADGFRAGKTAMRPITLFDVSRQRAKSGAQVDVPESVLTKRFLPHQQRRLDRAAKMLLLAADEAWQQSGWAPAENIPLVLGTTSGGMSLGEAYYRQAISTPKKDLGQATRVEGYQSQRQALDLCDAFRFRGPITIIANACASGANSIGHAWDLIRRGHAERVFTGGYDAISQMVFGGFDSLQALSPTVCRPFDAHRDGLALGEGAAMLAIETLDSAKRRNAEILGEIVGYGATTDAHHLTQPHPNGDAALASMTAACSAAKVSPEKINYINAHGTGTPLNDSAEAAAINRWAGAEAKNIPVSSTKSSIGHLLGGAGSVEAVICLMTLREQWLPPMLILQTPEPTCTFPLVRQPTDAKVDYALTNSFGFGGANATLILRRWG

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
152 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
156 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
279 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
280 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
281 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
282 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
283 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
284 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
285 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
286 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0.36
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 1.6
Rhizosphere 92.51
Stem 0
Stem Tuber 0
Unclassified 6.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100022515 3300005563 Bacteria 7552
2 SwRhRL2b_contig_350266 2162886007 Unclassified 1532
3 CNXas_1000004 3300000545 Bacteria 49001
4 JGI25406J46586_10000031 3300003203 Bacteria 68943
5 JGI25406J46586_10012796 3300003203 Bacteria 3627
6 rootH2_10016441 3300003320 Bacteria 43831
7 rootL2_10072798 3300003322 Bacteria 11928
8 Ga0065704_10006997 3300005289 Bacteria 3599
9 Ga0070658_10000017 3300005327 Bacteria 223560
10 Ga0070658_10008811 3300005327 Bacteria 8109
11 Ga0070658_10018128 3300005327 Bacteria 5632
12 Ga0070658_10074486 3300005327 Bacteria 2784
13 Ga0070658_10081548 3300005327 Bacteria 2657
14 Ga0070658_10092902 3300005327 Bacteria 2488
15 Ga0070658_10167446 3300005327 Bacteria 1845
16 Ga0070658_10179832 3300005327 Bacteria 1780
17 Ga0070683_100230111 3300005329 Unclassified 1762
18 Ga0070670_100006170 3300005331 Bacteria 10130
19 Ga0070670_100192817 3300005331 Bacteria 1770
20 Ga0070666_10001132 3300005335 Bacteria 16230
21 Ga0070666_10049895 3300005335 Bacteria 2814
22 Ga0070680_100071992 3300005336 Bacteria 2841
23 Ga0068868_100295861 3300005338 Unclassified 1374
24 Ga0070660_100001386 3300005339 Bacteria 16479
25 Ga0070660_100006810 3300005339 Bacteria 7930
26 Ga0070660_100082734 3300005339 Unclassified 2521
27 Ga0070689_100016039 3300005340 Bacteria 5478
28 Ga0070689_100032077 3300005340 Bacteria 3994
29 Ga0070689_100067372 3300005340 Bacteria 2791
30 Ga0070689_100266046 3300005340 Bacteria 1418
31 Ga0070661_100006180 3300005344 Bacteria 8257
32 Ga0070661_100056717 3300005344 Bacteria 2870
33 Ga0070668_100052036 3300005347 Bacteria 3157
34 Ga0070669_100039231 3300005353 Unclassified 3441
35 Ga0070675_100014872 3300005354 Bacteria 6143
36 Ga0070671_100015235 3300005355 Bacteria 6208
37 Ga0070671_100034864 3300005355 Bacteria 4167
38 Ga0070671_100074652 3300005355 Bacteria 2833
39 Ga0070671_100131945 3300005355 Bacteria 2104
40 Ga0070671_100204836 3300005355 Bacteria 1673
41 Ga0070674_100012748 3300005356 Bacteria 5171
42 Ga0070673_100006547 3300005364 Bacteria 7577
43 Ga0070673_100260365 3300005364 Unclassified 1515
44 Ga0070688_100006047 3300005365 Bacteria 6424
45 Ga0070659_100000075 3300005366 Bacteria 77794
46 Ga0070659_100005119 3300005366 Bacteria 9405
47 Ga0070659_100013462 3300005366 Bacteria 6089
48 Ga0070667_100033080 3300005367 Unclassified 4317
49 Ga0070667_100054755 3300005367 Bacteria 3369
50 Ga0070709_10033587 3300005434 Bacteria 3104
51 Ga0070714_100057739 3300005435 Bacteria 3322
52 Ga0070713_100004876 3300005436 Bacteria 9101
53 Ga0070713_100077855 3300005436 Bacteria 2821
54 Ga0070694_100025901 3300005444 Bacteria 3798
55 Ga0070708_100013729 3300005445 Bacteria 6644
56 Ga0070708_100026740 3300005445 Bacteria 4943
57 Ga0070708_100045230 3300005445 Bacteria 3877
58 Ga0070708_100056443 3300005445 Bacteria 3493
59 Ga0070708_100161551 3300005445 Bacteria 2088
60 Ga0070663_100134629 3300005455 Bacteria 1880
61 Ga0070678_100008889 3300005456 Bacteria 6047
62 Ga0070681_10017621 3300005458 Bacteria 7137
63 Ga0070681_10123963 3300005458 Bacteria 2516
64 Ga0068867_100009876 3300005459 Bacteria 6726
65 Ga0070685_10056356 3300005466 Unclassified 2284
66 Ga0070706_100000709 3300005467 Bacteria 37439
67 Ga0070706_100006581 3300005467 Bacteria 10960
68 Ga0070706_100016018 3300005467 Bacteria 6924
69 Ga0070706_100088362 3300005467 Bacteria 2874
70 Ga0070706_100197054 3300005467 Bacteria 1881
71 Ga0070706_100233145 3300005467 Bacteria 1718
72 Ga0070706_100289254 3300005467 Bacteria 1529
73 Ga0070707_100004838 3300005468 Bacteria 12619
74 Ga0070707_100042500 3300005468 Bacteria 4351
75 Ga0070707_100072631 3300005468 Bacteria 3316
76 Ga0070707_100074680 3300005468 Bacteria 3269
77 Ga0070707_100127700 3300005468 Bacteria 2471
78 Ga0070707_100129698 3300005468 Bacteria 2451
79 Ga0070707_100159234 3300005468 Bacteria 2199
80 Ga0070698_100004491 3300005471 Bacteria 15343
81 Ga0070698_100027154 3300005471 Bacteria 5954
82 Ga0070698_100137031 3300005471 Bacteria 2401
83 Ga0070698_100143371 3300005471 Bacteria 2339
84 Ga0070698_100172646 3300005471 Bacteria 2102
85 Ga0070699_100016883 3300005518 Bacteria 6267
86 Ga0070699_100037430 3300005518 Bacteria 4198
87 Ga0070699_100066104 3300005518 Bacteria 3138
88 Ga0070699_100240004 3300005518 Unclassified 1617
89 Ga0070679_100031501 3300005530 Bacteria 5239
90 Ga0070679_100045301 3300005530 Bacteria 4383
91 Ga0070697_100003578 3300005536 Bacteria 11939
92 Ga0070697_100010936 3300005536 Bacteria 7089
93 Ga0070697_100027928 3300005536 Unclassified 4516
94 Ga0070697_100029192 3300005536 Bacteria 4420
95 Ga0070697_100033960 3300005536 Bacteria 4111
96 Ga0070697_100104321 3300005536 Bacteria 2357
97 Ga0070697_100175957 3300005536 Bacteria 1813
98 Ga0068853_100000022 3300005539 Bacteria 142647
99 Ga0068853_100000115 3300005539 Bacteria 54407
100 Ga0068853_100003373 3300005539 Bacteria 12226
101 Ga0070672_100014922 3300005543 Bacteria 5517
102 Ga0070686_100004330 3300005544 Bacteria 7818
103 Ga0070686_100092476 3300005544 Bacteria 2026
104 Ga0070665_100075120 3300005548 Bacteria 3386
105 Ga0070665_100245648 3300005548 Bacteria 1790
106 Ga0070704_100007209 3300005549 Bacteria 6611
107 Ga0068855_100003787 3300005563 Bacteria 18502
108 Ga0068855_100013989 3300005563 Bacteria 9674
109 Ga0068855_100024962 3300005563 Bacteria 7153
110 Ga0068855_100067506 3300005563 Bacteria 4165
111 Ga0068855_100109714 3300005563 Bacteria 3168
112 Ga0068855_100183396 3300005563 Bacteria 2365
113 Ga0068855_100211673 3300005563 Bacteria 2178
114 Ga0068855_100214768 3300005563 Bacteria 2160
115 Ga0068857_100119777 3300005577 Bacteria 2369
116 Ga0068854_100000038 3300005578 Bacteria 95978
117 Ga0068854_100005679 3300005578 Bacteria 7887
118 Ga0068854_100073621 3300005578 Bacteria 2504
119 Ga0068856_100015167 3300005614 Bacteria 7443
120 Ga0068856_100046837 3300005614 Bacteria 4259
121 Ga0068852_100004487 3300005616 Bacteria 9864
122 Ga0068852_100044824 3300005616 Bacteria 3760
123 Ga0068852_100051091 3300005616 Bacteria 3546
124 Ga0068852_100136327 3300005616 Bacteria 2267
125 Ga0068864_100036727 3300005618 Bacteria 4178
126 Ga0068864_100086317 3300005618 Bacteria 2761
127 Ga0068864_100120740 3300005618 Bacteria 2343
128 Ga0068863_100035891 3300005841 Bacteria 4721
129 Ga0068858_100274972 3300005842 Bacteria 1603
130 Ga0068860_100000159 3300005843 Bacteria 110374
131 Ga0081455_10000725 3300005937 Bacteria 42784
132 Ga0081455_10001494 3300005937 Bacteria 28914
133 Ga0081455_10010167 3300005937 Bacteria 9581
134 Ga0081540_1000380 3300005983 Bacteria 44546
135 Ga0081540_1061925 3300005983 Bacteria 1781
136 Ga0081539_10000564 3300005985 Bacteria 76514
137 Ga0081539_10001104 3300005985 Bacteria 49011
138 Ga0070717_10000353 3300006028 Bacteria 29605
139 Ga0070717_10047081 3300006028 Bacteria 3531
140 Ga0070717_10187206 3300006028 Bacteria 1807
141 Ga0070712_100085516 3300006175 Bacteria 2296
142 Ga0070712_100248422 3300006175 Bacteria 1420
143 Ga0075362_10000411 3300006177 Bacteria 12334
144 Ga0075366_10019664 3300006195 Unclassified 3912
145 Ga0097621_100003193 3300006237 Bacteria 11267
146 Ga0097621_100035123 3300006237 Unclassified 4004
147 Ga0068871_100025141 3300006358 Unclassified 4629
148 Ga0068871_100263907 3300006358 Bacteria 1503
149 Ga0075428_100026634 3300006844 Bacteria 6402
150 Ga0075428_100036038 3300006844 Bacteria 5452
151 Ga0068865_100031192 3300006881 Bacteria 3552
152 Ga0075435_100000263 3300007076 Bacteria 32673
153 Ga0075435_100018595 3300007076 Bacteria 5290
154 Ga0105240_10000001 3300009093 Bacteria 2887840
155 Ga0105240_10008663 3300009093 Bacteria 14523
156 Ga0105240_10009398 3300009093 Bacteria 13844
157 Ga0105240_10090430 3300009093 Bacteria 3741
158 Ga0105240_10105281 3300009093 Bacteria 3425
159 Ga0105240_10124160 3300009093 Bacteria 3105
160 Ga0105240_10136095 3300009093 Bacteria 2942
161 Ga0105240_10217214 3300009093 Bacteria 2230
162 Ga0105240_10254885 3300009093 Bacteria 2027
163 Ga0111539_10047245 3300009094 Bacteria 5146
164 Ga0114129_10033795 3300009147 Bacteria 7224
165 Ga0105241_10020006 3300009174 Bacteria 4943
166 Ga0105242_10153726 3300009176 Bacteria 2008
167 Ga0105248_10057882 3300009177 Bacteria 4351
168 Ga0105237_10013617 3300009545 Bacteria 8522
169 Ga0105237_10018010 3300009545 Bacteria 7317
170 Ga0105237_10030692 3300009545 Bacteria 5457
171 Ga0105238_10006718 3300009551 Bacteria 11481
172 Ga0105238_10017937 3300009551 Bacteria 7197
173 Ga0105238_10035065 3300009551 Bacteria 5103
174 Ga0105238_10066785 3300009551 Bacteria 3597
175 Ga0105239_10226302 3300010375 Unclassified 2098
176 Ga0157370_10018964 3300013104 Bacteria 6917
177 Ga0157370_10022540 3300013104 Bacteria 6266
178 Ga0157370_10045365 3300013104 Bacteria 4217
179 Ga0157370_10101914 3300013104 Bacteria 2689
180 Ga0157370_10190435 3300013104 Bacteria 1904
181 Ga0157369_10005530 3300013105 Bacteria 14670
182 Ga0157369_10007454 3300013105 Bacteria 12601
183 Ga0157369_10016107 3300013105 Bacteria 8412
184 Ga0157369_10018413 3300013105 Bacteria 7831
185 Ga0157369_10019879 3300013105 Bacteria 7513
186 Ga0157369_10046325 3300013105 Bacteria 4726
187 Ga0157369_10057375 3300013105 Bacteria 4201
188 Ga0157369_10071014 3300013105 Bacteria 3739
189 Ga0157369_10454159 3300013105 Bacteria 1327
190 Ga0157374_10000028 3300013296 Bacteria 213725
191 Ga0157374_10003877 3300013296 Bacteria 12559
192 Ga0157374_10018766 3300013296 Bacteria 6111
193 Ga0157374_10035443 3300013296 Bacteria 4565
194 Ga0157374_10046221 3300013296 Bacteria 4030
195 Ga0157374_10082808 3300013296 Bacteria 3047
196 Ga0157378_10045848 3300013297 Unclassified 3886
197 Ga0157378_10210810 3300013297 Unclassified 1842
198 Ga0163162_10027367 3300013306 Bacteria 5638
199 Ga0163162_10318227 3300013306 Unclassified 1688
200 Ga0157372_10006072 3300013307 Bacteria 12830
201 Ga0157372_10007912 3300013307 Bacteria 11301
202 Ga0157372_10010637 3300013307 Bacteria 9791
203 Ga0157372_10023716 3300013307 Bacteria 6655
204 Ga0157372_10029299 3300013307 Bacteria 6010
205 Ga0157372_10048421 3300013307 Bacteria 4725
206 Ga0157372_10079053 3300013307 Bacteria 3718
207 Ga0157375_10037791 3300013308 Unclassified 4629
208 Ga0157375_10050251 3300013308 Bacteria 4089
209 Ga0163163_10008481 3300014325 Bacteria 9133
210 Ga0163163_10013037 3300014325 Bacteria 7589
211 Ga0157376_10028530 3300014969 Bacteria 4437
212 Ga0213872_10000478 3300021361 Bacteria 32337
213 Ga0213872_10003129 3300021361 Bacteria 9302
214 Ga0213872_10017606 3300021361 Bacteria 3300
215 Ga0213874_10033656 3300021377 Bacteria 1495
216 Ga0213876_10001500 3300021384 Bacteria 14476
217 Ga0213876_10008676 3300021384 Bacteria 5498
218 Ga0213871_10012013 3300021441 Unclassified 2000
219 Ga0209233_1001450 3300025261 Bacteria 9359
220 Ga0209233_1005386 3300025261 Bacteria 4247
221 Ga0207697_10000511 3300025315 Bacteria 21912
222 Ga0207688_10004499 3300025901 Bacteria 7592
223 Ga0207680_10030795 3300025903 Bacteria 3031
224 Ga0207680_10093824 3300025903 Unclassified 1915
225 Ga0207647_10020074 3300025904 Bacteria 4485
226 Ga0207699_10043297 3300025906 Bacteria 2614
227 Ga0207705_10000020 3300025909 Bacteria 311745
228 Ga0207705_10000562 3300025909 Bacteria 31130
229 Ga0207705_10004135 3300025909 Bacteria 11004
230 Ga0207705_10009526 3300025909 Bacteria 7068
231 Ga0207705_10031218 3300025909 Bacteria 3801
232 Ga0207705_10037451 3300025909 Bacteria 3471
233 Ga0207705_10051999 3300025909 Bacteria 2949
234 Ga0207705_10077121 3300025909 Bacteria 2424
235 Ga0207705_10187126 3300025909 Bacteria 1564
236 Ga0207684_10000650 3300025910 Bacteria 41194
237 Ga0207684_10002149 3300025910 Bacteria 20198
238 Ga0207684_10045510 3300025910 Unclassified 3721
239 Ga0207684_10189629 3300025910 Bacteria 1773
240 Ga0207684_10202763 3300025910 Bacteria 1711
241 Ga0207684_10227514 3300025910 Unclassified 1609
242 Ga0207654_10000505 3300025911 Bacteria 22302
243 Ga0207695_10000001 3300025913 Bacteria 2888630
244 Ga0207695_10000249 3300025913 Bacteria 140258
245 Ga0207695_10003985 3300025913 Bacteria 20373
246 Ga0207695_10079308 3300025913 Bacteria 3328
247 Ga0207695_10313834 3300025913 Bacteria 1458
248 Ga0207671_10006453 3300025914 Bacteria 10441
249 Ga0207693_10065034 3300025915 Unclassified 2856
250 Ga0207693_10166306 3300025915 Bacteria 1736
251 Ga0207693_10272010 3300025915 Bacteria 1327
252 Ga0207657_10003277 3300025919 Bacteria 17324
253 Ga0207657_10003920 3300025919 Bacteria 15792
254 Ga0207657_10012904 3300025919 Bacteria 8216
255 Ga0207657_10085379 3300025919 Unclassified 2644
256 Ga0207649_10029706 3300025920 Bacteria 3230
257 Ga0207649_10040648 3300025920 Bacteria 2828
258 Ga0207652_10001024 3300025921 Bacteria 25651
259 Ga0207652_10043440 3300025921 Bacteria 3826
260 Ga0207652_10340191 3300025921 Bacteria 1354
261 Ga0207646_10001257 3300025922 Bacteria 31753
262 Ga0207646_10002214 3300025922 Bacteria 23143
263 Ga0207646_10027150 3300025922 Bacteria 5221
264 Ga0207646_10049173 3300025922 Bacteria 3777
265 Ga0207646_10150230 3300025922 Bacteria 2100
266 Ga0207646_10194083 3300025922 Bacteria 1834
267 Ga0207681_10023977 3300025923 Unclassified 3909
268 Ga0207694_10003813 3300025924 Bacteria 11925
269 Ga0207694_10098012 3300025924 Bacteria 2320
270 Ga0207650_10025409 3300025925 Bacteria 4219
271 Ga0207650_10029443 3300025925 Unclassified 3948
272 Ga0207650_10048128 3300025925 Unclassified 3144
273 Ga0207650_10160176 3300025925 Bacteria 1783
274 Ga0207659_10013676 3300025926 Bacteria 5208
275 Ga0207700_10060809 3300025928 Bacteria 2862
276 Ga0207664_10048705 3300025929 Unclassified 3334
277 Ga0207644_10067976 3300025931 Unclassified 2598
278 Ga0207690_10024263 3300025932 Bacteria 3797
279 Ga0207690_10157724 3300025932 Bacteria 1689
280 Ga0207686_10106416 3300025934 Bacteria 1883
281 Ga0207670_10051342 3300025936 Bacteria 2768
282 Ga0207669_10054056 3300025937 Unclassified 2423
283 Ga0207704_10049158 3300025938 Unclassified 2535
284 Ga0207665_10077341 3300025939 Bacteria 2284
285 Ga0207665_10195349 3300025939 Bacteria 1472
286 Ga0207691_10002134 3300025940 Bacteria 19356
287 Ga0207661_10198381 3300025944 Unclassified 1763
288 Ga0207679_10026287 3300025945 Bacteria 4012
289 Ga0207667_10012883 3300025949 Bacteria 9608
290 Ga0207667_10015163 3300025949 Bacteria 8763
291 Ga0207667_10015957 3300025949 Bacteria 8506
292 Ga0207667_10017144 3300025949 Bacteria 8164
293 Ga0207667_10087316 3300025949 Bacteria 3226
294 Ga0207667_10175488 3300025949 Bacteria 2202
295 Ga0207667_10178565 3300025949 Bacteria 2181
296 Ga0207668_10015093 3300025972 Bacteria 4794
297 Ga0207640_10000051 3300025981 Bacteria 95956
298 Ga0207658_10088597 3300025986 Bacteria 2393
299 Ga0207703_10242855 3300026035 Bacteria 1620
300 Ga0207639_10000002 3300026041 Bacteria 903066
301 Ga0207639_10000069 3300026041 Bacteria 96786
302 Ga0207639_10003062 3300026041 Bacteria 11258
303 Ga0207678_10003373 3300026067 Bacteria 14408
304 Ga0207678_10016333 3300026067 Bacteria 6517
305 Ga0207678_10072128 3300026067 Bacteria 2959
306 Ga0207678_10123885 3300026067 Bacteria 2206
307 Ga0207702_10010689 3300026078 Bacteria 7669
308 Ga0207641_10113688 3300026088 Bacteria 2404
309 Ga0207648_10006358 3300026089 Bacteria 11746
310 Ga0207676_10077133 3300026095 Bacteria 2695
311 Ga0207674_10006812 3300026116 Bacteria 13405
312 Ga0207683_10004826 3300026121 Bacteria 11610
313 Ga0268266_10002216 3300028379 Bacteria 21236
314 Ga0268266_10202007 3300028379 Bacteria 1819
315 Ga0268266_10220243 3300028379 Bacteria 1744
316 Ga0268264_10000363 3300028381 Bacteria 67275
317 Ga0265337_1011546 3300028556 Bacteria 3038
318 Ga0265319_1006133 3300028563 Bacteria 5618
319 Ga0265334_10007737 3300028573 Bacteria 4604
320 Ga0265323_10000049 3300028653 Bacteria 64975
321 Ga0265323_10027656 3300028653 Bacteria 2129
322 Ga0265336_10000667 3300028666 Bacteria 18624
323 Ga0265338_10000420 3300028800 Bacteria 75959
324 Ga0265338_10003150 3300028800 Bacteria 23538
325 Ga0265338_10024388 3300028800 Bacteria 6179
326 Ga0265338_10039737 3300028800 Bacteria 4432
327 Ga0265338_10052396 3300028800 Bacteria 3661
328 Ga0265328_10015755 3300031239 Bacteria 2956
329 Ga0265320_10007008 3300031240 Bacteria 7024
330 Ga0265325_10033064 3300031241 Bacteria 2758
331 Ga0265329_10000594 3300031242 Bacteria 18723
332 Ga0265340_10015100 3300031247 Bacteria 4019
333 Ga0265331_10054503 3300031250 Bacteria 1904
334 Ga0265327_10001754 3300031251 Bacteria 25646
335 Ga0265316_10065150 3300031344 Bacteria 2822
336 Ga0265316_10078336 3300031344 Bacteria 2537
337 Ga0265316_10111926 3300031344 Unclassified 2067
338 Ga0307513_10080560 3300031456 Bacteria 3358
339 Ga0316575_10007083 3300031665 Bacteria 4057
340 Ga0316579_10000223 3300031691 Bacteria 17183
341 Ga0265314_10022627 3300031711 Bacteria 4813
342 Ga0316576_10101021 3300031727 Bacteria 2156
343 Ga0316578_10062240 3300031728 Bacteria 2200
344 Ga0316593_10000461 3300032168 Bacteria 7469
345 Ga0307510_10018128 3300033180 Bacteria 8289
346 Ga0307510_10024597 3300033180 Bacteria 6956
347 Ga0316596_1000420 3300033541 Bacteria 7070
348 Ga0373928_0000279 3300035084 Bacteria 10095
349 Ga0373944_0000216 3300035089 Bacteria 12394
350 Ga0373949_0000474 3300035090 Bacteria 13735
351 Ga0373932_0000005 3300035112 Bacteria 259528
352 Ga0373955_0079416 3300035172 Bacteria 1851
353 Ga0373955_0103048 3300035172 Bacteria 1641
354 Ga0373962_0000483 3300035242 Bacteria 8820
355 Ga0373931_0000016 3300035691 Bacteria 217932
356 Ga0373935_0010110 3300035692 Bacteria 5653
357 Ga0373935_0041838 3300035692 Bacteria 2880
358 Ga0373927_0019734 3300035695 Bacteria 4420
359 Ga0373933_0084114 3300035724 Bacteria 1955
360 Ga0373947_0058156 3300035725 Bacteria 2342
361 Ga0373947_0085481 3300035725 Bacteria 1959
362 Ga0373937_0177617 3300036401 Unclassified 1999
363 Ga0373937_0255119 3300036401 Bacteria 1653
364 Ga0373925_0000514 3300037068 Bacteria 38847
365 Ga0395900_0001406 3300037418 Bacteria 28805
366 Ga0395900_0339133 3300037418 Bacteria 1479
367 Ga0395898_0017405 3300037466 Bacteria 7343
368 Ga0395905_0035278 3300037471 Unclassified 4697
369 Ga0436364_1160864 3300037853 Bacteria 2522
370 Ga0395901_0213998 3300038443 Bacteria 2016
371 Ga0436365_0377191 3300039437 Bacteria 6873
372 Ga0436365_0838450 3300039437 Bacteria 4713
373 Ga0436365_0909065 3300039437 Unclassified 2522
374 Ga0436365_1147197 3300039437 Bacteria 51071
375 Ga0436365_1383407 3300039437 Bacteria 77328
376 Ga0436360_0799469 3300039438 Unclassified 2179
377 Ga0436360_0921181 3300039438 Bacteria 1758
378 Ga0436360_1109878 3300039438 Bacteria 5191
379 Ga0436361_0111757 3300039447 Bacteria 3253
380 Ga0436361_0264843 3300039447 Bacteria 4323
381 Ga0436361_0298522 3300039447 Bacteria 5001
382 Ga0436361_0528354 3300039447 Bacteria 23049
383 Ga0436361_1030048 3300039447 Bacteria 3844
384 Ga0436363_0937124 3300039450 Bacteria 19951
385 Ga0436362_0064032 3300039453 Unclassified 2069
386 Ga0451855_1043235 3300041511 Bacteria 5429
387 Ga0451577_0000033 3300042876 Bacteria 378714
388 Ga0451577_0000047 3300042876 Bacteria 312768
389 Ga0466969_0011903 3300044656 Bacteria 4599
390 Ga0466966_0042268 3300044684 Bacteria 2927
391 Ga0453684_0000109 3300044712 Bacteria 361015
392 Ga0453684_0000611 3300044712 Bacteria 131332
393 Ga0453684_0003475 3300044712 Bacteria 35376
394 Ga0453684_0026393 3300044712 Bacteria 8394
395 Ga0451576_0044480 3300045051 Bacteria 4681
396 Ga0451576_0095872 3300045051 Bacteria 3086
397 Ga0466967_0026996 3300045976 Bacteria 4768
398 Ga0466967_0183007 3300045976 Bacteria 1977
399 Ga0495592_0043835 3300046454 Bacteria 3345
400 Ga0495603_0001453 3300046455 Bacteria 13780
401 Ga0495629_0002888 3300046459 Bacteria 13124
402 Ga0495629_0027641 3300046459 Bacteria 4028
403 Ga0495629_0053162 3300046459 Bacteria 2834
404 Ga0495638_0090375 3300046460 Bacteria 1846
405 Ga0495653_0022608 3300046463 Bacteria 5085
406 Ga0495650_0000006 3300046471 Bacteria 721347
407 Ga0495650_0001575 3300046471 Bacteria 21452
408 Ga0495580_0070355 3300046472 Bacteria 2444
409 Ga0495580_0193243 3300046472 Bacteria 1403
410 Ga0495582_0005157 3300046473 Bacteria 7312
411 Ga0495639_0019355 3300046475 Bacteria 2971
412 Ga0495662_0034989 3300046476 Bacteria 2424
413 Ga0495664_0010765 3300046477 Bacteria 5141
414 Ga0495664_0024030 3300046477 Bacteria 3540
415 Ga0495585_0028516 3300046492 Bacteria 3184
416 Ga0495594_0000142 3300046499 Bacteria 34212
417 Ga0495594_0000247 3300046499 Bacteria 26230
418 Ga0495583_0031763 3300046506 Bacteria 2556
419 Ga0495583_0041523 3300046506 Bacteria 2154
420 Ga0495606_0039875 3300046507 Bacteria 3159
421 Ga0495606_0076625 3300046507 Bacteria 2090
422 Ga0495606_0112393 3300046507 Bacteria 1641
423 Ga0495618_0013075 3300046514 Bacteria 5045
424 Ga0495618_0017873 3300046514 Bacteria 4352
425 Ga0495628_0000354 3300046516 Bacteria 41766
426 Ga0495628_0088214 3300046516 Bacteria 2404
427 Ga0495630_0004948 3300046517 Bacteria 9370
428 Ga0495631_0038516 3300046518 Bacteria 2125
429 Ga0495631_0039407 3300046518 Bacteria 2097
430 Ga0495632_0079849 3300046519 Bacteria 1561
431 Ga0495643_0000111 3300046522 Bacteria 135372
432 Ga0495644_0000009 3300046523 Bacteria 107125
433 Ga0495648_0033861 3300046524 Bacteria 3332
434 Ga0495648_0072756 3300046524 Bacteria 1988
435 Ga0495648_0124316 3300046524 Bacteria 1381
436 Ga0495666_0015596 3300046526 Bacteria 3782
437 Ga0495642_0030428 3300046528 Bacteria 2159
438 Ga0495652_0006133 3300046529 Bacteria 11235
439 Ga0495652_0039128 3300046529 Bacteria 4102
440 Ga0495640_0019813 3300046533 Bacteria 4961
441 Ga0495586_0009379 3300046535 Bacteria 5207
442 Ga0495586_0012324 3300046535 Bacteria 4536
443 Ga0495587_0047810 3300046536 Bacteria 2536
444 Ga0495587_0088535 3300046536 Bacteria 1790
445 Ga0495609_0012083 3300046538 Bacteria 4098
446 Ga0495609_0034125 3300046538 Bacteria 2308
447 Ga0495645_0003468 3300046543 Bacteria 10698
448 Ga0495645_0009752 3300046543 Bacteria 6719
449 Ga0495645_0010758 3300046543 Bacteria 6428
450 Ga0495622_0025456 3300046557 Bacteria 2763
451 Ga0495633_0015429 3300046558 Bacteria 3963
452 Ga0495668_0117085 3300046616 Bacteria 1457
453 Ga0495625_0000547 3300046660 Bacteria 55124
454 Ga0495625_0013877 3300046660 Bacteria 6453
455 Ga0495625_0029349 3300046660 Bacteria 4115
456 Ga0495625_0039124 3300046660 Bacteria 3465
457 Ga0495625_0050077 3300046660 Bacteria 2999
458 Ga0495625_0112317 3300046660 Bacteria 1862
459 Ga0495599_0011001 3300046678 Bacteria 5552
460 Ga0495599_0054187 3300046678 Bacteria 2512
461 Ga0495669_0005087 3300046684 Bacteria 5473
462 Ga0495613_0007254 3300046689 Bacteria 8250
463 Ga0495613_0074592 3300046689 Bacteria 2470
464 Ga0495670_0038916 3300046691 Bacteria 2371
465 Ga0495649_0035236 3300046694 Bacteria 2753
466 Ga0495600_0038988 3300046809 Bacteria 3093
467 Ga0495581_0023494 3300047315 Bacteria 3572
468 Ga0495604_0014438 3300047317 Bacteria 6300
469 Ga0495604_0017563 3300047317 Bacteria 5729
470 Ga0495636_0001717 3300047318 Bacteria 8356
471 Ga0495636_0058685 3300047318 Bacteria 1623
472 Ga0495674_0027833 3300047319 Bacteria 5162
473 Ga0495672_0000481 3300047320 Bacteria 47172
474 Ga0495687_018867 3300047443 Bacteria 3398
475 Ga0495673_0031739 3300047469 Bacteria 2471
476 Ga0495673_0032177 3300047469 Bacteria 2449
477 Ga0495686_0000252 3300047472 Bacteria 96182
478 Ga0495686_0002559 3300047472 Bacteria 16982
479 Ga0495686_0004933 3300047472 Bacteria 10744
480 Ga0495686_0009416 3300047472 Bacteria 7037
481 Ga0495686_0057198 3300047472 Bacteria 2435
482 Ga0495614_0067661 3300048089 Bacteria 1537
483 Ga0496100_0063960 3300048903 Bacteria 2433
484 Ga0496101_0016650 3300048904 Bacteria 4973
485 Ga0496104_0000072 3300048907 Bacteria 106074
486 Ga0496104_0039062 3300048907 Bacteria 4443
487 Ga0496107_0047373 3300048910 Bacteria 3096
488 Ga0496112_0323751 3300048915 Bacteria 1486
489 Ga0496114_0019888 3300048917 Bacteria 5445
490 Ga0496114_0033341 3300048917 Bacteria 4243
491 Ga0496115_0000751 3300048918 Bacteria 23861
492 Ga0496117_0001359 3300048920 Bacteria 35660
493 Ga0496123_0040403 3300048926 Bacteria 3249
494 Ga0496126_0000018 3300048929 Bacteria 581170
495 Ga0496126_0000085 3300048929 Bacteria 216528
496 Ga0496126_0004143 3300048929 Bacteria 17528
497 Ga0496126_0005400 3300048929 Bacteria 14593
498 Ga0496126_0007079 3300048929 Bacteria 12353
499 Ga0496126_0162452 3300048929 Bacteria 1908
500 Ga0495682_0029954 3300049460 Bacteria 2015
501 Ga0501031_0003475 3300049568 Bacteria 10114
502 Ga0501031_0023766 3300049568 Bacteria 3995
503 Ga0501031_0140078 3300049568 Bacteria 1581
504 Ga0501032_0001467 3300049569 Bacteria 18774
505 Ga0501032_0001834 3300049569 Bacteria 16802
506 Ga0501033_0006599 3300049570 Bacteria 9078
507 Ga0501033_0025734 3300049570 Bacteria 4433
508 Ga0501034_0004684 3300049571 Bacteria 15148
509 Ga0501034_0006950 3300049571 Bacteria 12095
510 Ga0501036_0001824 3300049572 Bacteria 16528
511 Ga0501036_0014403 3300049572 Bacteria 6584
512 Ga0501037_0001210 3300049573 Bacteria 19087
513 Ga0501037_0002249 3300049573 Bacteria 13956
514 Ga0501037_0031208 3300049573 Bacteria 3935
515 Ga0501037_0072103 3300049573 Bacteria 2512
516 Ga0501038_0000686 3300049574 Bacteria 30094
517 Ga0501038_0003372 3300049574 Bacteria 14898
518 Ga0501038_0004106 3300049574 Bacteria 13542
519 Ga0501039_0017213 3300049575 Bacteria 5544
520 Ga0501043_0000537 3300049579 Bacteria 34156
521 Ga0501046_0000106 3300049580 Bacteria 89243
522 Ga0501046_0030096 3300049580 Bacteria 4409
523 Ga0501047_0003390 3300049581 Bacteria 15080
524 Ga0501047_0081513 3300049581 Bacteria 3110
525 Ga0501048_0185884 3300049582 Bacteria 1473
526 Ga0501067_0004821 3300049583 Bacteria 7482
527 Ga0501069_0037416 3300049585 Bacteria 2678
528 Ga0501070_0015424 3300049586 Bacteria 6428
529 Ga0501070_0246172 3300049586 Bacteria 1463
530 Ga0501073_0019825 3300049589 Bacteria 4853
531 Ga0501073_0040932 3300049589 Bacteria 3276
532 Ga0501073_0060168 3300049589 Bacteria 2651
533 Ga0501080_0011841 3300049742 Bacteria 7993
534 Ga0501080_0166807 3300049742 Bacteria 2032
535 Ga0501083_0139444 3300049744 Bacteria 1588
536 Ga0501035_0006786 3300049822 Bacteria 10698
537 Ga0501035_0023702 3300049822 Bacteria 5631
538 Ga0501035_0102693 3300049822 Unclassified 2508
539 Ga0501044_0001138 3300049823 Bacteria 31569
540 Ga0501044_0017911 3300049823 Bacteria 7596
541 Ga0501044_0031801 3300049823 Bacteria 5550
542 Ga0501045_0002577 3300049824 Bacteria 12364
543 nmdc:mga0n895_173_c1 3300050512 Bacteria 39986
544 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
545 nmdc:mga08x19_140434_c1 3300050514 Bacteria 1631
546 nmdc:mga08x19_15382_c1 3300050514 Bacteria 4655
547 nmdc:mga08x19_863_c1 3300050514 Bacteria 19232
548 Ga0495601_0095783 3300053077 Bacteria 1914
549 Ga0500651_0000039 3300053093 Bacteria 96498
550 Ga0500595_000025 3300053119 Bacteria 142073
551 Ga0500616_0000734 3300053153 Bacteria 37933
552 Ga0500616_0004843 3300053153 Bacteria 9398
553 2844855626 2844852863 Bacteria 3849151
554 2857729978 2857729791 Bacteria 4040535
555 2862996036 2862993130 Bacteria 3860849
556 2884218851 2884215851 Bacteria 4554841
557 2928123200 2928121344 Bacteria 3972376
558 2939661218 2939660829 Bacteria 3784848
559 8004214333 8004212874 Bacteria 2861420
560 8056039493 8056037122 Bacteria 3854319
561 8057348857 8057345674 Bacteria 4160394
562 Ga0068855_100022515
563 SwRhRL2b_contig_350266
564 CNXas_1000004
565 JGI25406J46586_10000031
566 JGI25406J46586_10012796
567 rootH2_10016441
568 rootL2_10072798
569 Ga0065704_10006997
570 Ga0070658_10000017
571 Ga0070658_10008811
572 Ga0070658_10018128
573 Ga0070658_10074486
574 Ga0070658_10081548
575 Ga0070658_10092902
576 Ga0070658_10167446
577 Ga0070658_10179832
578 Ga0070683_100230111
579 Ga0070670_100006170
580 Ga0070670_100192817
581 Ga0070666_10001132
582 Ga0070666_10049895
583 Ga0070680_100071992
584 Ga0068868_100295861
585 Ga0070660_100001386
586 Ga0070660_100006810
587 Ga0070660_100082734
588 Ga0070689_100016039
589 Ga0070689_100032077
590 Ga0070689_100067372
591 Ga0070689_100266046
592 Ga0070661_100006180
593 Ga0070661_100056717
594 Ga0070668_100052036
595 Ga0070669_100039231
596 Ga0070675_100014872
597 Ga0070671_100015235
598 Ga0070671_100034864
599 Ga0070671_100074652
600 Ga0070671_100131945
601 Ga0070671_100204836
602 Ga0070674_100012748
603 Ga0070673_100006547
604 Ga0070673_100260365
605 Ga0070688_100006047
606 Ga0070659_100000075
607 Ga0070659_100005119
608 Ga0070659_100013462
609 Ga0070667_100033080
610 Ga0070667_100054755
611 Ga0070709_10033587
612 Ga0070714_100057739
613 Ga0070713_100004876
614 Ga0070713_100077855
615 Ga0070694_100025901
616 Ga0070708_100013729
617 Ga0070708_100026740
618 Ga0070708_100045230
619 Ga0070708_100056443
620 Ga0070708_100161551
621 Ga0070663_100134629
622 Ga0070678_100008889
623 Ga0070681_10017621
624 Ga0070681_10123963
625 Ga0068867_100009876
626 Ga0070685_10056356
627 Ga0070706_100000709
628 Ga0070706_100006581
629 Ga0070706_100016018
630 Ga0070706_100088362
631 Ga0070706_100197054
632 Ga0070706_100233145
633 Ga0070706_100289254
634 Ga0070707_100004838
635 Ga0070707_100042500
636 Ga0070707_100072631
637 Ga0070707_100074680
638 Ga0070707_100127700
639 Ga0070707_100129698
640 Ga0070707_100159234
641 Ga0070698_100004491
642 Ga0070698_100027154
643 Ga0070698_100137031
644 Ga0070698_100143371
645 Ga0070698_100172646
646 Ga0070699_100016883
647 Ga0070699_100037430
648 Ga0070699_100066104
649 Ga0070699_100240004
650 Ga0070679_100031501
651 Ga0070679_100045301
652 Ga0070697_100003578
653 Ga0070697_100010936
654 Ga0070697_100027928
655 Ga0070697_100029192
656 Ga0070697_100033960
657 Ga0070697_100104321
658 Ga0070697_100175957
659 Ga0068853_100000022
660 Ga0068853_100000115
661 Ga0068853_100003373
662 Ga0070672_100014922
663 Ga0070686_100004330
664 Ga0070686_100092476
665 Ga0070665_100075120
666 Ga0070665_100245648
667 Ga0070704_100007209
668 Ga0068855_100003787
669 Ga0068855_100013989
670 Ga0068855_100024962
671 Ga0068855_100067506
672 Ga0068855_100109714
673 Ga0068855_100183396
674 Ga0068855_100211673
675 Ga0068855_100214768
676 Ga0068857_100119777
677 Ga0068854_100000038
678 Ga0068854_100005679
679 Ga0068854_100073621
680 Ga0068856_100015167
681 Ga0068856_100046837
682 Ga0068852_100004487
683 Ga0068852_100044824
684 Ga0068852_100051091
685 Ga0068852_100136327
686 Ga0068864_100036727
687 Ga0068864_100086317
688 Ga0068864_100120740
689 Ga0068863_100035891
690 Ga0068858_100274972
691 Ga0068860_100000159
692 Ga0081455_10000725
693 Ga0081455_10001494
694 Ga0081455_10010167
695 Ga0081540_1000380
696 Ga0081540_1061925
697 Ga0081539_10000564
698 Ga0081539_10001104
699 Ga0070717_10000353
700 Ga0070717_10047081
701 Ga0070717_10187206
702 Ga0070712_100085516
703 Ga0070712_100248422
704 Ga0075362_10000411
705 Ga0075366_10019664
706 Ga0097621_100003193
707 Ga0097621_100035123
708 Ga0068871_100025141
709 Ga0068871_100263907
710 Ga0075428_100026634
711 Ga0075428_100036038
712 Ga0068865_100031192
713 Ga0075435_100000263
714 Ga0075435_100018595
715 Ga0105240_10000001
716 Ga0105240_10008663
717 Ga0105240_10009398
718 Ga0105240_10090430
719 Ga0105240_10105281
720 Ga0105240_10124160
721 Ga0105240_10136095
722 Ga0105240_10217214
723 Ga0105240_10254885
724 Ga0111539_10047245
725 Ga0114129_10033795
726 Ga0105241_10020006
727 Ga0105242_10153726
728 Ga0105248_10057882
729 Ga0105237_10013617
730 Ga0105237_10018010
731 Ga0105237_10030692
732 Ga0105238_10006718
733 Ga0105238_10017937
734 Ga0105238_10035065
735 Ga0105238_10066785
736 Ga0105239_10226302
737 Ga0157370_10018964
738 Ga0157370_10022540
739 Ga0157370_10045365
740 Ga0157370_10101914
741 Ga0157370_10190435
742 Ga0157369_10005530
743 Ga0157369_10007454
744 Ga0157369_10016107
745 Ga0157369_10018413
746 Ga0157369_10019879
747 Ga0157369_10046325
748 Ga0157369_10057375
749 Ga0157369_10071014
750 Ga0157369_10454159
751 Ga0157374_10000028
752 Ga0157374_10003877
753 Ga0157374_10018766
754 Ga0157374_10035443
755 Ga0157374_10046221
756 Ga0157374_10082808
757 Ga0157378_10045848
758 Ga0157378_10210810
759 Ga0163162_10027367
760 Ga0163162_10318227
761 Ga0157372_10006072
762 Ga0157372_10007912
763 Ga0157372_10010637
764 Ga0157372_10023716
765 Ga0157372_10029299
766 Ga0157372_10048421
767 Ga0157372_10079053
768 Ga0157375_10037791
769 Ga0157375_10050251
770 Ga0163163_10008481
771 Ga0163163_10013037
772 Ga0157376_10028530
773 Ga0213872_10000478
774 Ga0213872_10003129
775 Ga0213872_10017606
776 Ga0213874_10033656
777 Ga0213876_10001500
778 Ga0213876_10008676
779 Ga0213871_10012013
780 Ga0209233_1001450
781 Ga0209233_1005386
782 Ga0207697_10000511
783 Ga0207688_10004499
784 Ga0207680_10030795
785 Ga0207680_10093824
786 Ga0207647_10020074
787 Ga0207699_10043297
788 Ga0207705_10000020
789 Ga0207705_10000562
790 Ga0207705_10004135
791 Ga0207705_10009526
792 Ga0207705_10031218
793 Ga0207705_10037451
794 Ga0207705_10051999
795 Ga0207705_10077121
796 Ga0207705_10187126
797 Ga0207684_10000650
798 Ga0207684_10002149
799 Ga0207684_10045510
800 Ga0207684_10189629
801 Ga0207684_10202763
802 Ga0207684_10227514
803 Ga0207654_10000505
804 Ga0207695_10000001
805 Ga0207695_10000249
806 Ga0207695_10003985
807 Ga0207695_10079308
808 Ga0207695_10313834
809 Ga0207671_10006453
810 Ga0207693_10065034
811 Ga0207693_10166306
812 Ga0207693_10272010
813 Ga0207657_10003277
814 Ga0207657_10003920
815 Ga0207657_10012904
816 Ga0207657_10085379
817 Ga0207649_10029706
818 Ga0207649_10040648
819 Ga0207652_10001024
820 Ga0207652_10043440
821 Ga0207652_10340191
822 Ga0207646_10001257
823 Ga0207646_10002214
824 Ga0207646_10027150
825 Ga0207646_10049173
826 Ga0207646_10150230
827 Ga0207646_10194083
828 Ga0207681_10023977
829 Ga0207694_10003813
830 Ga0207694_10098012
831 Ga0207650_10025409
832 Ga0207650_10029443
833 Ga0207650_10048128
834 Ga0207650_10160176
835 Ga0207659_10013676
836 Ga0207700_10060809
837 Ga0207664_10048705
838 Ga0207644_10067976
839 Ga0207690_10024263
840 Ga0207690_10157724
841 Ga0207686_10106416
842 Ga0207670_10051342
843 Ga0207669_10054056
844 Ga0207704_10049158
845 Ga0207665_10077341
846 Ga0207665_10195349
847 Ga0207691_10002134
848 Ga0207661_10198381
849 Ga0207679_10026287
850 Ga0207667_10012883
851 Ga0207667_10015163
852 Ga0207667_10015957
853 Ga0207667_10017144
854 Ga0207667_10087316
855 Ga0207667_10175488
856 Ga0207667_10178565
857 Ga0207668_10015093
858 Ga0207640_10000051
859 Ga0207658_10088597
860 Ga0207703_10242855
861 Ga0207639_10000002
862 Ga0207639_10000069
863 Ga0207639_10003062
864 Ga0207678_10003373
865 Ga0207678_10016333
866 Ga0207678_10072128
867 Ga0207678_10123885
868 Ga0207702_10010689
869 Ga0207641_10113688
870 Ga0207648_10006358
871 Ga0207676_10077133
872 Ga0207674_10006812
873 Ga0207683_10004826
874 Ga0268266_10002216
875 Ga0268266_10202007
876 Ga0268266_10220243
877 Ga0268264_10000363
878 Ga0265337_1011546
879 Ga0265319_1006133
880 Ga0265334_10007737
881 Ga0265323_10000049
882 Ga0265323_10027656
883 Ga0265336_10000667
884 Ga0265338_10000420
885 Ga0265338_10003150
886 Ga0265338_10024388
887 Ga0265338_10039737
888 Ga0265338_10052396
889 Ga0265328_10015755
890 Ga0265320_10007008
891 Ga0265325_10033064
892 Ga0265329_10000594
893 Ga0265340_10015100
894 Ga0265331_10054503
895 Ga0265327_10001754
896 Ga0265316_10065150
897 Ga0265316_10078336
898 Ga0265316_10111926
899 Ga0307513_10080560
900 Ga0316575_10007083
901 Ga0316579_10000223
902 Ga0265314_10022627
903 Ga0316576_10101021
904 Ga0316578_10062240
905 Ga0316593_10000461
906 Ga0307510_10018128
907 Ga0307510_10024597
908 Ga0316596_1000420
909 Ga0373928_0000279
910 Ga0373944_0000216
911 Ga0373949_0000474
912 Ga0373932_0000005
913 Ga0373955_0079416
914 Ga0373955_0103048
915 Ga0373962_0000483
916 Ga0373931_0000016
917 Ga0373935_0010110
918 Ga0373935_0041838
919 Ga0373927_0019734
920 Ga0373933_0084114
921 Ga0373947_0058156
922 Ga0373947_0085481
923 Ga0373937_0177617
924 Ga0373937_0255119
925 Ga0373925_0000514
926 Ga0395900_0001406
927 Ga0395900_0339133
928 Ga0395898_0017405
929 Ga0395905_0035278
930 Ga0436364_1160864
931 Ga0395901_0213998
932 Ga0436365_0377191
933 Ga0436365_0838450
934 Ga0436365_0909065
935 Ga0436365_1147197
936 Ga0436365_1383407
937 Ga0436360_0799469
938 Ga0436360_0921181
939 Ga0436360_1109878
940 Ga0436361_0111757
941 Ga0436361_0264843
942 Ga0436361_0298522
943 Ga0436361_0528354
944 Ga0436361_1030048
945 Ga0436363_0937124
946 Ga0436362_0064032
947 Ga0451855_1043235
948 Ga0451577_0000033
949 Ga0451577_0000047
950 Ga0466969_0011903
951 Ga0466966_0042268
952 Ga0453684_0000109
953 Ga0453684_0000611
954 Ga0453684_0003475
955 Ga0453684_0026393
956 Ga0451576_0044480
957 Ga0451576_0095872
958 Ga0466967_0026996
959 Ga0466967_0183007
960 Ga0495592_0043835
961 Ga0495603_0001453
962 Ga0495629_0002888
963 Ga0495629_0027641
964 Ga0495629_0053162
965 Ga0495638_0090375
966 Ga0495653_0022608
967 Ga0495650_0000006
968 Ga0495650_0001575
969 Ga0495580_0070355
970 Ga0495580_0193243
971 Ga0495582_0005157
972 Ga0495639_0019355
973 Ga0495662_0034989
974 Ga0495664_0010765
975 Ga0495664_0024030
976 Ga0495585_0028516
977 Ga0495594_0000142
978 Ga0495594_0000247
979 Ga0495583_0031763
980 Ga0495583_0041523
981 Ga0495606_0039875
982 Ga0495606_0076625
983 Ga0495606_0112393
984 Ga0495618_0013075
985 Ga0495618_0017873
986 Ga0495628_0000354
987 Ga0495628_0088214
988 Ga0495630_0004948
989 Ga0495631_0038516
990 Ga0495631_0039407
991 Ga0495632_0079849
992 Ga0495643_0000111
993 Ga0495644_0000009
994 Ga0495648_0033861
995 Ga0495648_0072756
996 Ga0495648_0124316
997 Ga0495666_0015596
998 Ga0495642_0030428
999 Ga0495652_0006133
1000 Ga0495652_0039128
1001 Ga0495640_0019813
1002 Ga0495586_0009379
1003 Ga0495586_0012324
1004 Ga0495587_0047810
1005 Ga0495587_0088535
1006 Ga0495609_0012083
1007 Ga0495609_0034125
1008 Ga0495645_0003468
1009 Ga0495645_0009752
1010 Ga0495645_0010758
1011 Ga0495622_0025456
1012 Ga0495633_0015429
1013 Ga0495668_0117085
1014 Ga0495625_0000547
1015 Ga0495625_0013877
1016 Ga0495625_0029349
1017 Ga0495625_0039124
1018 Ga0495625_0050077
1019 Ga0495625_0112317
1020 Ga0495599_0011001
1021 Ga0495599_0054187
1022 Ga0495669_0005087
1023 Ga0495613_0007254
1024 Ga0495613_0074592
1025 Ga0495670_0038916
1026 Ga0495649_0035236
1027 Ga0495600_0038988
1028 Ga0495581_0023494
1029 Ga0495604_0014438
1030 Ga0495604_0017563
1031 Ga0495636_0001717
1032 Ga0495636_0058685
1033 Ga0495674_0027833
1034 Ga0495672_0000481
1035 Ga0495687_018867
1036 Ga0495673_0031739
1037 Ga0495673_0032177
1038 Ga0495686_0000252
1039 Ga0495686_0002559
1040 Ga0495686_0004933
1041 Ga0495686_0009416
1042 Ga0495686_0057198
1043 Ga0495614_0067661
1044 Ga0496100_0063960
1045 Ga0496101_0016650
1046 Ga0496104_0000072
1047 Ga0496104_0039062
1048 Ga0496107_0047373
1049 Ga0496112_0323751
1050 Ga0496114_0019888
1051 Ga0496114_0033341
1052 Ga0496115_0000751
1053 Ga0496117_0001359
1054 Ga0496123_0040403
1055 Ga0496126_0000018
1056 Ga0496126_0000085
1057 Ga0496126_0004143
1058 Ga0496126_0005400
1059 Ga0496126_0007079
1060 Ga0496126_0162452
1061 Ga0495682_0029954
1062 Ga0501031_0003475
1063 Ga0501031_0023766
1064 Ga0501031_0140078
1065 Ga0501032_0001467
1066 Ga0501032_0001834
1067 Ga0501033_0006599
1068 Ga0501033_0025734
1069 Ga0501034_0004684
1070 Ga0501034_0006950
1071 Ga0501036_0001824
1072 Ga0501036_0014403
1073 Ga0501037_0001210
1074 Ga0501037_0002249
1075 Ga0501037_0031208
1076 Ga0501037_0072103
1077 Ga0501038_0000686
1078 Ga0501038_0003372
1079 Ga0501038_0004106
1080 Ga0501039_0017213
1081 Ga0501043_0000537
1082 Ga0501046_0000106
1083 Ga0501046_0030096
1084 Ga0501047_0003390
1085 Ga0501047_0081513
1086 Ga0501048_0185884
1087 Ga0501067_0004821
1088 Ga0501069_0037416
1089 Ga0501070_0015424
1090 Ga0501070_0246172
1091 Ga0501073_0019825
1092 Ga0501073_0040932
1093 Ga0501073_0060168
1094 Ga0501080_0011841
1095 Ga0501080_0166807
1096 Ga0501083_0139444
1097 Ga0501035_0006786
1098 Ga0501035_0023702
1099 Ga0501035_0102693
1100 Ga0501044_0001138
1101 Ga0501044_0017911
1102 Ga0501044_0031801
1103 Ga0501045_0002577
1104 nmdc:mga0n895_173_c1
1105 nmdc:mga0rr50_2_c1
1106 nmdc:mga08x19_140434_c1
1107 nmdc:mga08x19_15382_c1
1108 nmdc:mga08x19_863_c1
1109 Ga0495601_0095783
1110 Ga0500651_0000039
1111 Ga0500595_000025
1112 Ga0500616_0000734
1113 Ga0500616_0004843
1114 2844855626
1115 2857729978
1116 2862996036
1117 2884218851
1118 2928123200
1119 2939661218
1120 8004214333
1121 8056039493
1122 8057348857

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

313

428

0.96

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

69

305

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ls6-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) i108f mutant from bacillus subtilis 0.9502 12 408
6olt-assembly1.cif.gz_A crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabf, and c12-crypto acyl carrier protein, acpp 0.95 13 407
3g0y-assembly1.cif.gz_A structure of e. coli fabf(c163q) in complex with dihydroplatensimycin 0.9493 14 407
4ls5-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from bacillus subtilis 0.9487 12 408
1e5m-assembly1.cif.gz_A-2 beta ketoacyl acyl carrier protein synthase ii (kasii) from synechocystis sp. 0.9484 14 408
ID Description Score Start End Superfamily
af_P9WQD9_267_416_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9702 259 407 3.40.47.10
af_I1N0K0_264_378_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9688 257 366 3.40.47.10
af_Q0E328_1_239_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.967 190 406 3.40.47.10
1tqyG02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9636 259 407 3.40.47.10
af_P9WQD9_267_416_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9577 259 407 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A3B9LGG8-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9954 207 409 GO:0004315
GO:0006633
AF-A0A3B9LGG8-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9905 207 409 GO:0004315
GO:0006633
AF-A0A2V5M7Z2-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase family protein 0.9889 88 409 GO:0004315
GO:0005829
GO:0006633
AF-A0A2V6H2M4-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9858 248 409 GO:0004315
GO:0005829
GO:0006633
AF-A0A2V5M7Z2-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase family protein 0.9858 88 409 GO:0004315
GO:0005829
GO:0006633

Map